Search Results

Search found 7897 results on 316 pages for 'generate'.

Page 191/316 | < Previous Page | 187 188 189 190 191 192 193 194 195 196 197 198  | Next Page >

  • Subprocess fails to catch the standard output

    - by user343934
    I am trying to generate tree with fasta file input and Alignment with MuscleCommandline import sys,os, subprocess from Bio import AlignIO from Bio.Align.Applications import MuscleCommandline cline = MuscleCommandline(input="c:\Python26\opuntia.fasta") child= subprocess.Popen(str(cline), stdout = subprocess.PIPE, stderr=subprocess.PIPE, shell=(sys.platform!="win32")) align=AlignIO.read(child.stdout,"fasta") outfile=open('c:\Python26\opuntia.phy','w') AlignIO.write([align],outfile,'phylip') outfile.close() I always encounter with these problems Traceback (most recent call last): File "<string>", line 244, in run_nodebug File "C:\Python26\muscleIO.py", line 11, in <module> align=AlignIO.read(child.stdout,"fasta") File "C:\Python26\Lib\site-packages\Bio\AlignIO\__init__.py", line 423, in read raise ValueError("No records found in handle") ValueError: No records found in handle

    Read the article

  • Are there any tools to help the user to design a State Machine to be consumed by my application?

    - by kolrie
    When reading this question I remembered there was something I have been researching for a while now and I though Stackoverflow could be of help. I have created a framework that handles applications as state machines. Currently all the state business logic and transactions are handled via Java code. I was looking for some UI implementation that would allow the user to draw the state machines and transactions and generate a file that can later on be consumed by my framework to "run" the workflow according to one or more defined state machines. Ideally I would like to use an open standard like SCXML. The goal as the UI would be to have something like this plugin IBM have for Rational Software Architect: Do you know any editor, plugin or library that would have something similar or at least serve as a good starting point?

    Read the article

  • Rails route, show all elements on the same page

    - by Igor Oliveira Antonio
    I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

    Read the article

  • Is there an "extended" UIHint attribute to apply CSS styles for DisplayFor - EditorFor templates?

    - by AJ
    Intro: After reading Brad Wilson Metadata series and searching unsuccesfully on google, I was wondering: Question: Has any OS project / code been created that allows you to tag CSS styles in the Meta information, for example in my (buddy) Model, I want to be able to decorate a property with multiple CSS styles (a single style you can fake with UIHint, I want to set many possible styles - and be able to "cross-utilise") eg. public class MyModel { [DisplayCssHint("h5")] [DisplayCssHint("color:#777;")] [EditorCssHint(".myCoolTextClass")] [EditorCssHint(".myOtherCoolTextClass")] public string Title{ get;set; } [DisplayCssHint(".normaltext")] [EditorCssHint(".myCoolTextClass")] [EditorCssHint(".myOtherCoolTextClass")] public string Message {get;set;} } Thoughts: I know that this does not seem like a logical place to put styling information, however as it is metadata and is discriptive... besides it would be nice to do this while prototyping - (especially being able to apply class styles and extending it further - to generate .Less files would really be cool! more to the point I would hate to write it, if its already been done ;). Any links/pointers/idea's would be appreciated. Thanks,

    Read the article

  • .NET interop COM DLL behaves differently in VB6 debugger

    - by Aheho
    I have a .NET v2.0 Dll that exposes a few classes to COM. The assembly is called BLogic.DLL I'm calling these classes from a legacy visual basic 6.0 application. I can generate and EXE file and if I have Blogic.dll in the same folder as the EXE, the program runs without a hitch. However If I try and launch the same program within the VB6 debugger I get a: Automation Error The system cannot find the file specified I assume when I'm running in the debugger, the PLogic.dll file can't be found. I tried putting it in the System32 folder, and the same folder as the VB6.EXE file, but I still get the same error. Other facts that may help: PLogic.dll is NOT a strongly-named assembly. It depends on a 3rd party reference that isn't strongly signed so VS doesn't let me strongly sign it. However the 3rd party functionality isn't being called by the VB6 code, and it is not ComVisible.

    Read the article

  • Stack trace in website project, when debug = false

    - by chandmk
    We have a website project. We are logging unhanded exceptions via a appdomain level exception handler. When we set debug= true in web.config, the exception log is showing the offending line numbers in the stack trace. But when we set debug = false, in web.config, log is not displaying the line numbers. We are not in a position to convert the website project in to webapplication project type at this time. Its legacy application and almost all the code is in aspx pages. We also need to leave the project in 'updatable' mode. i.e. We can't user pre-compile option. We are generating pdb files. Is there anyway to tell this kind of website projects to generate the pdb files, and show the line numbers in the stack trace?

    Read the article

  • Problem with migrating a model in ruby

    - by Shreyas Satish
    I run script/generate model query edit query.rb in models.. class Query < ActiveRecord::Base #I even tried Migrations instead of Base def sef.up create table :queries do|t| t.string :name end end def self.down drop_table :queries end end ,run rake db:migrate. and what I see in db is this: mysql> desc queries; +------------+----------+------+-----+---------+----------------+ | Field | Type | Null | Key | Default | Extra | +------------+----------+------+-----+---------+----------------+ | id | int(11) | NO | PRI | NULL | auto_increment | | created_at | datetime | YES | | NULL | | | updated_at | datetime | YES | | NULL | | +------------+----------+------+-----+---------+----------------+ Where is the "name" field? HELP ! Cheers !

    Read the article

  • wrapp a function whose parameters are out type pointer to structure using swig

    - by pierr
    I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • Generating Graph with 2 Y Values from Text File

    - by Joey jie
    Hi all, I have remade my original post as it was terribly formatted. Basically I would like some advice / tips on how to generate a line graph with 2 Y Axis (temperature and humidity) to display some information from my text file. It is contained in a textfile called temperaturedata.txt I have included a link to one of my posts from the JpGrapher forum only because it is able to display the code clearly. I understand that since it is JpGraph problem I shouldn't post here however the community here is a lot more supportive and active. Many thanks for all your help guys in advance! my code

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

  • xsl with javascript

    - by Vignesh
    I've a file with xml data. And I want to generate a report out of it. I tried to integrate xsl with java script, but can I get a handle of individual data elements in xsl and pass it on to a java script function. Lets say <value>true</value> is in the xml and I want to pass it on to a javascript function while doing something like this in xsl. <xsl:for-each select="/valgroup"> <xsl:value-of select="value"/> </xsl:for-each> The alternative is to parse the xml in java script and get the values, I've got little idea of how to integrate it with xsl. Are there any java script libraries. I've seen my libraries that run on servers(AJAXSLT), but I need something that runs locally. I'm a new to xslt, so consider this a worthy question.

    Read the article

  • Entity Framework: Data Centric vs. Object Centric

    - by Eric J.
    I'm having a look at Entity Framework and everything I'm reading takes a data centric approach to explaining EF. By that I mean that the fundamental relationships of the system are first defined in the database and objects are generated that reflect those relationships. Examples Quickstart (Entity Framework) Using Entity Framework entities as business objects? The EF documentation implies that it's not necessary to start from the database layer, e.g. Developers can work with a consistent application object model that can be mapped to various storage schemas When designing a new system (simplified version), I tend to first create a class model, then generate business objects from the model, code business layer stuff that can't be generated, and then worry about persistence (or rather work with a DBA and let him worry about the most efficient persistence strategy). That object centric approach is well supported by ORM technologies such as (n)Hibernate. Is there a reasonable path to an object centric approach with EF? Will I be swimming upstream going that route? Any good starting points?

    Read the article

  • Consuming an RPC/encoded Web Service in .NET

    - by Timmy O' Tool
    I'm trying to build the proxy class for a web service using the wsdl Executing this command: wsdl [http://WSDL_URL] I'm getting Warning: This web reference does not conform to WS-I Basic Profile v1.1. R2706: A wsdl:binding in a DESCRIPTION MUST use the value of "literal" for the use attribute in all soapbind:body, soapbind:fault, soapbind:header and soapbind:headerfault elements. ... Error: Cannot find definition for http://schemas.xmlsoap.org/wsdl/:BouBinding. Service Description with namespace http://schemas.xmlsoap.org/wsdl/ is missing. Parameter name: name The author of the web service told me that the SOAP protocol is RPC/encoded. Is there is any way to generate a proxy class for this?

    Read the article

  • how to run javascript from c# code ?

    - by dotnetcoder
    I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

    Read the article

  • Modeling software for network serialization protocol design

    - by Aurélien Vallée
    Hello, I am currently designing a low level network serialization protocol (in fact, a refinement of an existing protocol). As the work progress, pen and paper documents start to show their limits: i have tons of papers, new and outdated merged together, etc... And i can't show anything to anyone since i describe the protocol using my own notation (a mix of flow chart & C structures). I need a software that would help me to design a network protocol. I should be able to create structures, fields, their sizes, their layout, etc... and the software would generate some nice UMLish diagrams.

    Read the article

  • Is there a standard practice for synchronizing SQL Server tables?

    - by EngineeringAutomation
    I've written an application that retrieves pricing and part options from a SQL database to generate a 3D Model of the product and create a sales proposal. My client likes it so much they want to be able to use it on laptops in the field now. The catch is, they won't have an internet connection. I'm considering setting up a SQLite database as part of the standard installation. The SQLite database on each laptop will synchronize with the main database when the internet connection is re-established. Are there best practices regarding synchronizing SQL tables like this? Are there any pitfalls I should consider? I'm open to all options. Thank you.

    Read the article

  • Adding file of the same name into the same list and unable to update name of the SPFile

    - by BeraCim
    Hi all: I'm having difficulties adding file of the same name in the same list and subsequently updating/changing/modifying the name of a SPFile. Basically, this is what I'm trying to do: string fileName = "something"; // obtained from a loop -- loop omitted here. SPFile file = folder.Files.Add(fileName, otherFile.OpenBinary()); The Add method will generate a runtime exception when it finds another file of the same name in the same list/folder. So I thought of changing the file name later in the process: string newGuid = Guid.NewGuid().ToString(); SPFile file = folder.Files.Add(newGuid, otherFile.OpenBinary()); // some other processing... afterwards, rename the file file.name = fileName; file.Item.Update(); A few minute of googling indicated I need to either move the file around, or update the name field by using ["Name"] instead. I was wondering are there any other better ways to get around this problem? Thanks.

    Read the article

  • C# SHA-1 vs. PHP SHA-1...Different Results?

    - by Arcdigital
    Hey, I am trying to calculate a SHA-1 Hash from a string, but when I calculate the string using php's sha1 function I get something different than when I try it in C#. I need C# to calculate the same string as PHP (since the string from php is calculated by a 3rd party that I cannot modify). How can I get C# to generate the same hash as PHP? Thanks!!! String = [email protected] C# Code (Generates d32954053ee93985f5c3ca2583145668bb7ade86) string encode = secretkey + email; UnicodeEncoding UE = new UnicodeEncoding(); byte[] HashValue, MessageBytes = UE.GetBytes(encode); SHA1Managed SHhash = new SHA1Managed(); string strHex = ""; HashValue = SHhash.ComputeHash(MessageBytes); foreach(byte b in HashValue) { strHex += String.Format("{0:x2}", b); } PHP Code (Generates a9410edeaf75222d7b576c1b23ca0a9af0dffa98) sha1();

    Read the article

  • is there a such thing as a randomly accessible pseudo-random number generator? (preferably open-sour

    - by lucid
    first off, is there a such thing as a random access random number generator, where you could not only sequentially generate random numbers as we're all used to, assuming rand100() always generates a value from 0-100: for (int i=0;i<5;i++) print rand100() output: 14 75 36 22 67 but also randomly access any random value like: rand100(0) would output 14 as long as you didn't change the seed rand100(3) would always output 22 rand100(4) would always output 67 and so on... I've actually found an open-source generator algorithm that does this, but you cannot change the seed. I know that pseudorandomness is a complex field; I wouldn't know how to alter it to add that functionality. Is there a seedable random access random number generator, preferably open source? or is there a better term for this I can google for more information? if not, part 2 of my question would be, is there any reliably random open source conventional seedable pseudorandom number generator so I could port it to multiple platforms/languages while retaining a consistent sequence of values for each platform for any given seed?

    Read the article

  • Jquery autocomplete for input form, using Textpattern category list as a source

    - by John Stephens
    I'm using the Textpattern CMS to build a discussion site-- I have a firm grasp of XHTML and CSS, as well as Textpattern's template language, but PHP and Javascript are a bit beyond my cunning. On the input form to begin a new topic, users need to select a category from a list of over 5,000 options. Using the HTML select-type input element is very unwieldy, but it works. I would like to use some kind of Javascript magic to display a text-type input element that will read user input and display matches or autocomplete from the available categories, passing the required option's value into the appropriate database field. I've seen several autocomplete plugins for jquery, but the instructions presuppose that you understand how Javascript works. As I mentioned above, it's easy for me to generate the category list as a select-type input element, and I can hide that element using CSS. Is it possible to control select-list input using an autocomplete mechanism in a text-type input element? How would I do that?

    Read the article

  • DTO and mapper generation from Domain Objects

    - by Nicolas
    I have plenty of java domain objects that I need to transform to DTOs. Please, don't start with the anti-pattern thing, the Domain Objects are what they are because of a long history, and I can't modify them (or not too much, see below). So, of course, we've passed the age of doing all that manually. I've looked around, and dozer seems the framework of choice for DTO mapping. But... what I'd really like is this: annotate classes and fields that I want in DTO, and run a tool that would generate the DTOs and the mappers. Does that sound too unreasonable? Does such a tool already exist?

    Read the article

  • Generating C++ BackTraces in OS/X (10.5.7)

    - by phillipwei
    I've been utilizing backtrace and backtrace_symbols to generate programmatic stack traces for the purposes of logging/diagnosis. It seems to roughly work, however, I'm getting a little bit of mangling and there are no accompanying file/line numbers associated with each function invocation (as I'd expect within a gdb bt call or something). Here's an example: 1 leonardo 0x00006989 _ZN9ExceptionC2E13ExceptionType + 111 2 leonardo 0x00006a20 _ZN9ExceptionC1E13ExceptionType + 24 3 leonardo 0x0000ab64 _ZN5Rules11ApplyActionER16ApplicableActionR9GameState + 1060 4 leonardo 0x0000ed15 _ZN9Simulator8SimulateEv + 2179 5 leonardo 0x0000eec9 _ZN9Simulator8SimulateEi + 37 6 leonardo 0x00009729 main + 45 7 leonardo 0x000025c6 start + 54 Anything I'm missing something, doing something silly, or is this all I can expect out of backtrace on OS/X? Some other tidbits: I don't see a rdynamic link option for the g++ version (4.0.1) I'm using. -g/-g3 doesn't make any difference. abi::__cxa__demangle doesn't seem to do anything

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 187 188 189 190 191 192 193 194 195 196 197 198  | Next Page >