Search Results

Search found 4962 results on 199 pages for 'parse'.

Page 22/199 | < Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >

  • How to parse org.w3c.dom.Element RPX XML response

    - by Kenshin
    I am using rpxnow in Java, how do I use org.w3c.dom API to get the field identifier in this XML reponse for example? <?xml version='1.0' encoding='UTF-8'?> <rsp stat='ok'> <profile> <displayName> brian </displayName> <identifier> http://brian.myopenid.com/ </identifier> <preferredUsername> brian </preferredUsername> <providerName> Other </providerName> <url> http://brian.myopenid.com/ </url> </profile> </rsp>

    Read the article

  • Most clever way to parse a Facebook OAuth 2 access token string

    - by RyOnLife
    It's a bit late, but I'm disappointed in myself for not coming up with something more elegant. Anyone have a better way to do this... When you pass an OAuth code to Facebook, it response with a query string containing access_token and expires values. access_token=121843224510409|2.V_ei_d_rbJt5iS9Jfjk8_A__.3600.1273741200-569255561|TxQrqFKhiXm40VXVE1OBUtZc3Ks.&expires=4554 Although if you request permission for offline access, there's no expires and the string looks like this: access_token=121843224510409|2.V_ei_d_rbJt5iS9Jfjk8_A__.3600.1273741200-569255561|TxQrqFKhiXm40VXVE1OBUtZc3Ks. I attempted to write a regex that would suffice for either condition. No dice. So I ended up with some really ugly Ruby: s = s.split("=") @oauth = {} if s.length == 3 @oauth[:access_token] = s[1][0, s[1].length - 8] @oauth[:expires] = s[2] else @oauth[:access_token] = s[1] end I know there must be a better way!

    Read the article

  • jQuery won't parse my JSON from AJAX query

    - by littlecharva
    Hi, I'm having difficulty parsing some JSON data returned from my server using jQuery.ajax() To perform the AJAX I'm using: $.ajax({ url: myUrl, cache: false, dataType: "json", success: function(data){ ... }, error: function(e, xhr){ ... } }); And if I return an array of items then it works fine: [ { title: "One", key: "1" }, { title: "Two", key: "2" } ] The success function is called and receives the correct object. However, when I'm trying to return a single object: { title: "One", key: "1" } The error function is called and xhr contains 'parsererror'. I've tried wrapping the JSON in parenthesis on the server before sending it down the wire, but it makes no difference. Yet if I paste the content into a string in Javascript and then use the eval() function, it evaluates it perfectly. Any ideas what I'm doing wrong? Anthony

    Read the article

  • Parse string with bash and extract number

    - by cleg
    Hello I've got supervisor's status output, looking like this. frontend RUNNING pid 16652, uptime 2:11:17 nginx RUNNING pid 16651, uptime 2:11:17 redis RUNNING pid 16607, uptime 2:11:32 I need to extract nginx's PID. I've done it via grep -P command, but on remote machine grep is build without perl regular expression support. Looks like sed or awk is exactly what I need, but I don't familiar with them. Please help me to find a way how to do it, thanks in advance.

    Read the article

  • Parse XML and populate in List Box

    - by cedar715
    I've posted the same question here and I've also got couple of good answers as well. While I was trying the same answers, I was getting compilation errors. Later I got to know that we are using .NET 2.0 and our existing application has no references to LINQ files. After searching in SO, i tried to figured out partly: public partial class Item { public object CHK { get; set; } public int SEL { get; set; } public string VALUE { get; set; } } Parsing: XmlDocument doc = new XmlDocument(); doc.LoadXml("<LISTBOX_ST> <item><CHK></CHK><SEL>00001</SEL><VALUE>val01</VALUE></item> <item><CHK></CHK><SEL>00002</SEL><VALUE>val02</VALUE></item> <item><CHK></CHK><SEL>00003</SEL><VALUE>val03</VALUE></item> <item><CHK></CHK><SEL>00004</SEL><VALUE>val04</VALUE></item> <item><CHK></CHK><SEL>00005</SEL><VALUE>val05</VALUE></item> </LISTBOX_ST>"); List<Item> _lbList = new List<Item>(); foreach (XmlNode node in doc.DocumentElement.ChildNodes) { string text = node.InnerText; //or loop through its children as well //HOW - TO - POPULATE THE ITEM OBJECT ?????? } listBox1.DataSource = _lbList; listBox1.DisplayMember = "VALUE"; listBox1.ValueMember = "SEL"; How to read two child nodes - SEL and VALUE of node and populate the same in the new Item DTO??

    Read the article

  • best way to parse plain text file with a nested information structure

    - by Beffa
    The text file has hundreds of these entries (format is MT940 bank statement) {1:F01AHHBCH110XXX0000000000}{2:I940X N2}{3:{108:XBS/091502}}{4: :20:XBS/091202/0001 :25:5887/507004-50 :28C:140/1 :60F:C0914CHF7789, :61:0912021202D36,80NTRFNONREF//0887-1202-29-941 04392579-0 LUTHY + xxx, ZUR :86:6034?60LUTHY + xxxx, ZUR vom 01.12.09 um 16:28 Karten-Nr. 2232 2579-0 :62F:C091202CHF52,2 :64:C091302CHF52,2 -} This should go into an Array of Hashes like [{"1"=>"F01AHHBCH110XXX0000000000"}, "2"=>"I940X N2", 3 => {108=>"XBS/091502"} etc. } ] I tried it with tree top, but it seemed not to be the right way, because it's more for something you want to do calculations on, and I just want the information. grammar Mt940 rule document part1:string spaces [:|/] spaces part2:document { def eval(env={}) return part1.eval, part2.eval end } / string / '{' spaces document spaces '}' spaces { def eval(env={}) return [document.eval] end } end end I also tried with a regular expression matches = str.scan(/\A[{]?([0-9]+)[:]?([^}]*)[}]?\Z/i) but it's difficult with recursion ... How can I solve this problem?

    Read the article

  • T-Sql SPROC - Parse C# Datatable to XML in Database (SQL Server 2005)

    - by Goober
    Scenario I've got an application written in C# that needs to dump some data every minute to a database. Because its not me that has written the spec, I have been told to store the data as XML in the SQL Server database and NOT TO USE the "bulk upload" feature. Essentially I just wanted to have a single stored procedure that would take XML (that I would produce from my datatable) and insert it into the database.....and do this every minute. Current Situation I've heard about the use of "Sp_xml_preparedocument" but I'm struggling to understand most of the examples that I've seen (My XML is far narrower than my C Sharp ability). Question I would really appreciate someone either pointing me in the direction of a worthwhile tutorial or helping explain things. EDIT - Using (SQL Server 2005)

    Read the article

  • How do I parse boolean logic?

    - by d03boy
    I need to write a boolean logic parser which will translate the boolean logic language to a SQL WHERE clause. The order of the operands will always be in the correct order (with value on the right). Here is a relatively simple example. There could be nested parentheses and the use of NOT operators, etc. (CACOUNT=01 OR CACOUNT=02 OR CACOUNT=03 OR CACOUNT=05 OR CACOUNT=07 OR CACOUNT=09 OR CACOUNT=12 OR CACOUNT=13 OR CACOUNT=18) AND Q4=1 AND NAME=TIMOTHY Here is what the WHERE clause would resemble. WHERE ( EXISTS ( SELECT 1 FROM MyVerticalTable b WHERE b.Key=a.Key AND b.Key='CACOUNT' AND b.Value='01' ) )

    Read the article

  • Parse simple JSON with Jackson

    - by siik
    Here is my JSON: { "i": 53691, "s": "Something" } Here is my model: public class Test() { private int i; private String s; public setInt(int i){ this.i = i; } public setString(String s){ this.s = s; } // getters here } Here is my class for server's response: public class ServerResponse(){ private Test; public void setTest(Test test){ this.test = test;} public Test getTest(){ return Test; } } When I do: ObjectMapper mapper = new ObjectMapper(); mapper.readValue(json, serverResponse); I'm getting an exception like: JsonProcessingException: Unrecognized field "i" (Class MyClass), not marked as ignorable Please advice.

    Read the article

  • Parse int to string with stringstream

    - by SoulBeaver
    Well! I feel really stupid for this question, and I wholly don't mind if I get downvoted for this, but I guess I wouldn't be posting this if I had not at least made an earnest attempt at looking for the solution. I'm currently working on Euler Problem 4, finding the largest palindromic number of two three-digit numbers [100..999]. As you might guess, I'm at the part where I have to work with the integer I made. I looked up a few sites and saw a few standards for converting an Int to a String, one of which included stringstream. So my code looked like this: // tempTotal is my int value I want converted. void toString( int tempTotal, string &str ) { ostringstream ss; // C++ Standard compliant method. ss << tempTotal; str = ss.str(); // Overwrite referenced value of given string. } and the function calling it was: else { toString( tempTotal, store ); cout << loop1 << " x " << loop2 << "= " << store << endl; } So far, so good. I can't really see an error in what I've written, but the output gives me the address to something. It stays constant, so I don't really know what the program is doing there. Secondly, I tried .ToString(), string.valueOf( tempTotal ), (string)tempTotal, or simply store = temptotal. All refused to work. When I simply tried doing an implicit cast with store = tempTotal, it didn't give me a value at all. When I tried checking output it literally printed nothing. I don't know if anything was copied into my string that simply isn't a printable character, or if the compiler just ignored it. I really don't know. So even though I feel this is a really, really lame question, I just have to ask: How do I convert that stupid integer to a string with the stringstream? The other tries are more or less irrelevant for me, I just really want to know why my stringstream solution isn't working.

    Read the article

  • Angularjs: addition of integers even after I parse the variable as integer

    - by Shiv Kumar
    I really have a weird problem in adding two numbers. Here is my code, in the first controller everything is working fine, but in the second controller instead of 0 if I add 10, the output is completely weird Here is html code <div ng-app=""> <div ng-controller="Controller1"> <br/>**** Controller-1 <br/>Add 0 : {{update1(0)}} <br/>Add 10 : {{update1(10)}} <br/>Add 50 : {{update1(50)}} <br/>Add -60 : {{update1(-60)}}</div> <div ng-controller="Controller2"> <br/>**** Controller-2 <br/>Add 10 : {{update2(10)}} <br/>Add 10 : {{update2(10)}} <br/>Add 50 : {{update2(50)}} <br/>Add -60 : {{update2(-60)}}</div> </div> Here is my javascript function Controller1($scope) { var x = 0; $scope.update1 = function (smValue) { x += parseInt(smValue); return x; } } function Controller2($scope) { var y = 0; $scope.update2 = function (smValue) { y += parseInt(smValue); return y; } } and here is the output **** Controller-1 Add 0 : 0 Add 10 : 10 Add 50 : 60 Add -60 : 0 **** Controller-2 Add 0 : 110 Add 10 : 120 Add 50 : 170 Add -60 : 110 here is the link to try: http://jsfiddle.net/6VqqN/ can anyone please explain me why it is behaving like that. Even if I add a 3or4 digit number, output is completely different then what I expected.

    Read the article

  • Parse XML function names and call within whole assembly

    - by Matt Clarkson
    Hello all, I have written an application that unit tests our hardware via a internet browser. I have command classes in the assembly that are a wrapper around individual web browser actions such as ticking a checkbox, selecting from a dropdown box as such: BasicConfigurationCommands EventConfigurationCommands StabilizationCommands and a set of test classes, that use the command classes to perform scripted tests: ConfigurationTests StabilizationTests These are then invoked via the GUI to run prescripted tests by our QA team. However, as the firmware is changed quite quickly between the releases it would be great if a developer could write an XML file that could invoke either the tests or the commands: <?xml version="1.0" encoding="UTF-8" ?> <testsuite> <StabilizationTests> <StressTest repetition="10" /> </StabilizationTests> <BasicConfigurationCommands> <SelectConfig number="2" /> <ChangeConfigProperties name="Weeeeee" timeOut="15000" delay="1000"/> <ApplyConfig /> </BasicConfigurationCommands> </testsuite> I have been looking at the System.Reflection class and have seen examples using GetMethod and then Invoke. This requires me to create the class object at compile time and I would like to do all of this at runtime. I would need to scan the whole assembly for the class name and then scan for the method within the class. This seems a large solution, so any information pointing me (and future readers of this post) towards an answer would be great! Thanks for reading, Matt

    Read the article

  • parse results in MySQL via REGEX

    - by Derek Adair
    Hi, I'm a bit confused on the functionality of the REGEX support for MySQL and I have yet to find a solid example on how to separate a result with REGEX within an sql statement. Example: How could I pull data from a table emails that looks something like... +-------------------------+ |Emails | |-------------------------| |[email protected]| +-------------------------+ and return something through an sql statement that looks like... +------------------------------+ |Username | Domain | TLD | |-----------|------------|-----| |some.email | yourdomain | com | +------------------------------+

    Read the article

  • PyYAML parse into arbitary object

    - by Philip Fourie
    I have the following Python 2.6 program and YAML definition (using PyYAML): import yaml x = yaml.load( """ product: name : 'Product X' sku : 123 features : - size : '10x30cm' weight : '10kg' """ ) print type(x) print x Which results in the following output: <type 'dict'> {'product': {'sku': 123, 'name': 'Product X', 'features': [{'weight': '10kg', 'size': '10x30cm'}]}} It is possible to create a strongly typed object from x? I would like to the following: print x.features(0).size I am aware that it is possible to create and instance from an existent class, but that is not what I want for this particular scenario.

    Read the article

  • Replace newline from MySQL TEXT field to parse w/ JSON

    - by dr3w
    Hi, "replace newline" seems to be a question asked here and there like hundred times already. But however, i haven't found any working solution for myself yet. I have a textarea that i use to save data into DB. Then using AJAX I want to get data from the DB in the backend that is in TEXT field and to pass it to frontend using JSON. But pasing JSON returns an error, as new lines from DB are not valid JSON syntax, I guess i should use \n instead... But how do i replace newlinew from DB with \n? I've tried this $t = str_replace('<br />', '\n', nl2br($t)); and this $t = preg_replace("/\r\n|\n\r|\r|\n/", "\n", $t); and using CHAR(13) and CHAR(10), and still I get an error the new line in textarea is equivalent to, i guess $t = 'text with a newline'; it gives the same error. And in notepad i clearly see that it is crlf

    Read the article

  • Parse Directory Structure (Strings) to JSON using PHP

    - by Ecropolis
    I have an array of file-path strings like this videos/funny/jelloman.wmv videos/funny/bellydance.flv videos/abc.mp4 videos/june.mp4 videos/cleaver.mp4 fun.wmv jimmy.wmv herman.wmv Is there a library or easy way I can get to a data structure json or xml? Something like this: (I see there are a lot of snippets available for traversing actual folders, but again, I just have strings.) { files:{ file:[ { filename:'fun.wmv' }, { filename:'jimmy.wmv' }, { filename:'herman.wmv' } ], folder:{ foldername:'videos', file:[ { filename:'abc.mp4' }, { filename:'june.mp4' }, { filename:'cleaver.mp4' } ], folder:{ foldername:'funny', file:[ { filename:'jelloman.wmv' }, { filename:'bellydance.flv' } ] } } } }

    Read the article

  • Can't parse a 1904 date in ARPA format (email date)

    - by Ramon
    I'm processing an IMAP mailbox and running into trouble parsing the dates using the mxDateTime package. In particular, early dates like "Fri, 1 Jan 1904 00:43:25 -0400" is causing trouble: >>> import mx.DateTime >>> import mx.DateTime.ARPA >>> mx.DateTime.ARPA.ParseDateTimeUTC("Fri, 1 Jan 1904 00:43:25 -0400").gmtoffset() Traceback (most recent call last): File "<interactive input>", line 1, in <module> Error: cannot convert value to a time value >>> mx.DateTime.ARPA.ParseDateTimeUTC("Thu, 1 Jan 2009 00:43:25 -0400").gmtoffset() <mx.DateTime.DateTimeDelta object for '-08:00:00.00' at 1497b60> >>> Note that an almost identical date from 2009 works fine. I can't find any description of date limitations in mxDateTime itself. Any ideas why this might be? Thx, Ramon

    Read the article

  • XamlReader.Parse throws exception on empty String

    - by sub-jp
    In our app, we need to save properties of objects to the same database table regardless of the type of object, in the form of propertyName, propertyValue, propertyType. We decided to use XamlWriter to save all of the given object's properties. We then use XamlReader to load up the XAML that was created, and turn it back into the value for the property. This works fine for the most part, except for empty strings. The XamlWriter will save an empty string as below. <String xmlns="clr-namespace:System;assembly=mscorlib" xml:space="preserve" /> The XamlReader sees this string and tries to create a string, but can't find an empty constructor in the String object to use, so it throws a ParserException. The only workaround that I can think of is to not actually save the property if it is an empty string. Then, as I load up the properties, I can check for which ones did not exist, which means they would have been empty strings. Is there some workaround for this, or is there even a better way of doing this?

    Read the article

  • How to parse app.config using ConfigurationManager?

    - by Amokrane
    I was using a certain method for parsing my app.config file. Then I was told that using ConfigurationManager is better and simpler. But the thing is I don't know how to do it with ConfigurationManager. My original code looked like this: XmlNode xmlProvidersNode; XmlNodeList xmlProvidersList; XmlNodeList xmlTaskFactoriesList; XmlDocument xmlDoc = new XmlDocument(); xmlDoc.Load("app.config"); xmlProvidersNode = xmlDoc.DocumentElement.SelectSingleNode("TaskProviders"); xmlProvidersList = xmlProvidersNode.SelectNodes("TaskProvider"); foreach (XmlNode xmlProviderElement in xmlProvidersList) { if (xmlProviderElement.Attributes.GetNamedItem("Name").Value.Equals(_taskProvider)) { xmlTaskFactoriesList = xmlProviderElement.SelectNodes("TaskTypeFactory"); foreach (XmlNode xmlTaskFactoryElement in xmlTaskFactoriesList) { if (xmlTaskFactoryElement.Attributes.GetNamedItem("TaskType").Value.Equals(_taskType)) { taskTypeFactory = xmlTaskFactoryElement.Attributes.GetNamedItem("Class").Value; } } } } What would be the equivalent using ConfigurationManager? (Because all I can see is how to get keys not nodes..) Thanks

    Read the article

  • Parse tree and grammars information

    - by fuzzylogikk
    Do anyone know where to find good online resources with examples how to make grammars and parsetrees? Preferebly introductary materials. Info that is n00b friendly, haven't found anything good with google myself. edit: I'm thinking about theory, not a specific parser software.

    Read the article

  • Parse filename from full path using regular expressions in C#

    - by WindyCityEagle
    How do I pull out the filename from a full path using regular expressions in C#? Say I have the full path C:\CoolDirectory\CoolSubdirectory\CoolFile.txt. How do I get out CoolFile.txt using the .NET flavor of regular expressions? I'm not really good with regular expressions, and my RegEx buddy and me couldn't figure this one out. Also, in the course of trying to solve this problem, I realized that I can just use System.IO.Path.GetFileName, but the fact that I couldn't figure out the regular expression is just making me unhappy and it's going to bother me until I know what the answer is.

    Read the article

  • How could I parse this HTML file?

    - by Sergio Tapia
    <div id="main"> <style type="text/css"> </style> <script language="JavaScript"> </script> <p style="margin: 0pt 0pt 0.5em;"><b>Media from&nbsp;<a onclick="(new Image()).src='/rg/find-media-title/media_strip/images/b.gif?link=/title/tt0087538/';" href="/title/tt0087538/">The Karate Kid</a> (1984)</b></p> <style type="text/css"> </style> <table style="border-collapse: collapse;"> </table> </div> I need to somehow extract the href value of the (new Image()). How exactly would I accomplish this with HtmlAgilityPack? I'm new to it, and so far I haven't found a useful tutorial on how to effectively use it for parsing. Thanks for the help!

    Read the article

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 18 19 20 21 22 23 24 25 26 27 28 29  | Next Page >