Search Results

Search found 34195 results on 1368 pages for 'try'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 251/1368 | < Previous Page | 247 248 249 250 251 252 253 254 255 256 257 258  | Next Page >

  • XP, how can I copy permissions from one partition to another, had no permssions and getting access denied trying to fix ?

    - by Jules
    For some reason, I'm not sure why, I have no permissions in the security tab/advanced tab for one partition. I'm trying to add them back by copying them manually from another partition. However when I try to replace permissions entries on some files it says access denied, then I have to click continue. I haven't much clue what this is all about, but I'd like to fix this as some folders in my partition aren't accessible in shares from other machines.

    Read the article

  • "make menuconfig" throwing cannot find -lc error in my Fedora 11 PC

    - by Sen
    When i try to do a make menuconfig in a Fedora 11 machine it is throwing the following error message: [root@PC04 kernel]# make menuconfig HOSTCC -static scripts/basic/fixdep scripts/basic/fixdep.c: In function âtrapsâ: scripts/basic/fixdep.c:377: warning: dereferencing type-punned pointer will break strict-aliasing rules scripts/basic/fixdep.c:379: warning: dereferencing type-punned pointer will break strict-aliasing rules /usr/bin/ld: cannot find -lc collect2: ld returned 1 exit status make[1]: *** [scripts/basic/fixdep] Error 1 make: *** [scripts_basic] Error 2 Please help me on this issue? How can i solve this? Thanks, Sen

    Read the article

  • Wherer can I get Windows XP Images for WMware Workstation

    - by Saif Bechan
    Does anyone know where I can get windows images for vmware. I know Microsoft gives away the images for Virtual PC. These images work pretty well, but when I try to import them in VMware I need to activate the copies again, because the virtual hardware they use is just to different. I want Images of different versions of windows 2000,xp,vista. Does anyone where I can download them, or do I need to build them from CD.

    Read the article

  • Problem with bash scripting

    - by eple
    Hi. I terrible with bash scripting, and need some help with the following: #!/bin/bash if [ -e Pretty* ];then ncftpput -R -DD -v -u xbmc -p xbmc 192.168.1.100 /home/xbmc/TV/Pretty_Little_Liars/ Pretty* else echo "No new folders" fi find -depth -type d -empty -exec rmdir {} \; Problem here is the ncftpput line.. if I just do a simple [ echo "working" ] instead, everything is OK, but when I try the ncftpput-line it just gives me [ line 5: [: too many arguments ] the ncftpput command alone works fine.. Any ideas?

    Read the article

  • Ubuntu 10.04 doesn't accept keyboard input when running under VMware on Windows 7

    - by anwar
    I have just installed Ubuntu for the first time using VMWare on Windows 7. Everything has been installed smoothly but after the installation in the login screen username is coming and when I try to enter password it is not taking any input, keyboard is not working at all. After moving away from Ubuntu keyboard and everthing else is working fine. Does anyone know what's the cause behind this ?

    Read the article

  • Printing Large PDF from Outlook 2003

    - by mrach
    Whenever I try to print an attached oversized PFF sheet (larger then letter sized) from Outlook, the print is cut off. How can I configure Outlook to automatically fit the PDF to page sized with out having to open it up in Adobe Reader?

    Read the article

  • mdadm: Win7-install created a boot partition on one of my RAID6 drives. How to rebuild?

    - by EXIT_FAILURE
    My problem happened when I attempted to install Windows 7 on it's own SSD. The Linux OS I used which has knowledge of the software RAID system is on a SSD that I disconnected prior to the install. This was so that windows (or I) wouldn't inadvertently mess it up. However, and in retrospect, foolishly, I left the RAID disks connected, thinking that windows wouldn't be so ridiculous as to mess with a HDD that it sees as just unallocated space. Boy was I wrong! After copying over the installation files to the SSD (as expected and desired), it also created an ntfs partition on one of the RAID disks. Both unexpected and totally undesired! . I changed out the SSDs again, and booted up in linux. mdadm didn't seem to have any problem assembling the array as before, but if I tried to mount the array, I got the error message: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I then used qparted to delete the newly created ntfs partition on /dev/sdd so that it matched the other three /dev/sd{b,c,e}, and requested a resync of my array with echo repair > /sys/block/md0/md/sync_action This took around 4 hours, and upon completion, dmesg reports: md: md0: requested-resync done. A bit brief after a 4-hour task, though I'm unsure as to where other log files exist (I also seem to have messed up my sendmail configuration). In any case: No change reported according to mdadm, everything checks out. mdadm -D /dev/md0 still reports: Version : 1.2 Creation Time : Wed May 23 22:18:45 2012 Raid Level : raid6 Array Size : 3907026848 (3726.03 GiB 4000.80 GB) Used Dev Size : 1953513424 (1863.02 GiB 2000.40 GB) Raid Devices : 4 Total Devices : 4 Persistence : Superblock is persistent Update Time : Mon May 26 12:41:58 2014 State : clean Active Devices : 4 Working Devices : 4 Failed Devices : 0 Spare Devices : 0 Layout : left-symmetric Chunk Size : 4K Name : okamilinkun:0 UUID : 0c97ebf3:098864d8:126f44e3:e4337102 Events : 423 Number Major Minor RaidDevice State 0 8 16 0 active sync /dev/sdb 1 8 32 1 active sync /dev/sdc 2 8 48 2 active sync /dev/sdd 3 8 64 3 active sync /dev/sde Trying to mount it still reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so and dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I'm a bit unsure where to proceed from here, and trying stuff "to see if it works" is a bit too risky for me. This is what I suggest I should attempt to do: Tell mdadm that /dev/sdd (the one that windows wrote into) isn't reliable anymore, pretend it is newly re-introduced to the array, and reconstruct its content based on the other three drives. I also could be totally wrong in my assumptions, that the creation of the ntfs partition on /dev/sdd and subsequent deletion has changed something that cannot be fixed this way. My question: Help, what should I do? If I should do what I suggested , how do I do that? From reading documentation, etc, I would think maybe: mdadm --manage /dev/md0 --set-faulty /dev/sdd mdadm --manage /dev/md0 --remove /dev/sdd mdadm --manage /dev/md0 --re-add /dev/sdd However, the documentation examples suggest /dev/sdd1, which seems strange to me, as there is no partition there as far as linux is concerned, just unallocated space. Maybe these commands won't work without. Maybe it makes sense to mirror the partition table of one of the other raid devices that weren't touched, before --re-add. Something like: sfdisk -d /dev/sdb | sfdisk /dev/sdd Bonus question: Why would the Windows 7 installation do something so st...potentially dangerous? Update I went ahead and marked /dev/sdd as faulty, and removed it (not physically) from the array: # mdadm --manage /dev/md0 --set-faulty /dev/sdd # mdadm --manage /dev/md0 --remove /dev/sdd However, attempting to --re-add was disallowed: # mdadm --manage /dev/md0 --re-add /dev/sdd mdadm: --re-add for /dev/sdd to /dev/md0 is not possible --add, was fine. # mdadm --manage /dev/md0 --add /dev/sdd mdadm -D /dev/md0 now reports the state as clean, degraded, recovering, and /dev/sdd as spare rebuilding. /proc/mdstat shows the recovery progress: md0 : active raid6 sdd[4] sdc[1] sde[3] sdb[0] 3907026848 blocks super 1.2 level 6, 4k chunk, algorithm 2 [4/3] [UU_U] [>....................] recovery = 2.1% (42887780/1953513424) finish=348.7min speed=91297K/sec nmon also shows expected output: ¦sdb 0% 87.3 0.0| > |¦ ¦sdc 71% 109.1 0.0|RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR > |¦ ¦sdd 40% 0.0 87.3|WWWWWWWWWWWWWWWWWWWW > |¦ ¦sde 0% 87.3 0.0|> || It looks good so far. Crossing my fingers for another five+ hours :) Update 2 The recovery of /dev/sdd finished, with dmesg output: [44972.599552] md: md0: recovery done. [44972.682811] RAID conf printout: [44972.682815] --- level:6 rd:4 wd:4 [44972.682817] disk 0, o:1, dev:sdb [44972.682819] disk 1, o:1, dev:sdc [44972.682820] disk 2, o:1, dev:sdd [44972.682821] disk 3, o:1, dev:sde Attempting mount /dev/md0 reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so And on dmesg: [44984.159908] EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! [44984.159912] EXT4-fs (md0): group descriptors corrupted! I'm not sure what do do now. Suggestions? Output of dumpe2fs /dev/md0: dumpe2fs 1.42.8 (20-Jun-2013) Filesystem volume name: Atlas Last mounted on: /mnt/atlas Filesystem UUID: e7bfb6a4-c907-4aa0-9b55-9528817bfd70 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: user_xattr acl Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 244195328 Block count: 976756712 Reserved block count: 48837835 Free blocks: 92000180 Free inodes: 243414877 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 791 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 RAID stripe width: 2 Flex block group size: 16 Filesystem created: Thu May 24 07:22:41 2012 Last mount time: Sun May 25 23:44:38 2014 Last write time: Sun May 25 23:46:42 2014 Mount count: 341 Maximum mount count: -1 Last checked: Thu May 24 07:22:41 2012 Check interval: 0 (<none>) Lifetime writes: 4357 GB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: e177a374-0b90-4eaa-b78f-d734aae13051 Journal backup: inode blocks dumpe2fs: Corrupt extent header while reading journal super block

    Read the article

  • Solver Add-in not loading correctly

    - by Paul
    When I try to open solver from inside excel 2010, I get the error message: "Solver: An unexpected internal error occurred, or available memory was exhausted." The only way I have been able to get Solver to work is by going to "C:\Program Files\Microsoft Office\Office14\Library\SOLVER\", and just opening the file called "SOLVER.xlam". If I open excel through that file, the program works fine. Is there a way to solve this issue?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Windows 2012 VPN setup without Active Directory

    - by iss42
    I have followed the guide here: http://www.youtube.com/watch?v=9qbpxKRb-94 But my situation differs with respect to there being no AD (Active Directory) setup. When I try to connect I get this in the server event log: "The user xx connected from x.x.x.x but failed an authentication attempt due to the following reason: The account does not have permission to dial in." Is there a way to enable this without AD?

    Read the article

  • Hell: NTFS "Restore previous versions"...

    - by ttsiodras
    The hell I have experienced these last 24h: Windows 7 installation hosed after bluetooth driver install. Attempting to recover using restore points via "Repair" on the bootable Win7 installation CD. Attempting to go back one day in the restore points. No joy. Attempting to go back two days in the restore points. No joy. Attempting to go back one week in the restore points. Stil no joy. Windows won't boot. Apparently something is REALLY hosed. And then it hits me - PANIC - the restore points somehow reverted DATA files to their older versions! Word, Powerpoint, SPSS, etc document versions are all one week old now. Using the "freshest" restore point. Failed to restore yesterday's restore point!!! I am stuck at old versions of the data!!! Booting KNOPPIX, mounting NTFS partition as read-only under KNOPPIX. Checking. Nope, the data files are still the one week old versions. Booting Win7 CD, Recovery console - Cmd prompt - navigating - yep, data files are still one week old. Removing the drive, mounting it under other Win7 installation. Still old data. Running NTFS undelete on the drive (read-only scan), searching for file created yesterday. Not found. Despair. At this point, idea: I will install a brand new Windows installation, keeping the old one in Windows.old (default behaviour of Windows installs). I boot the new install, I go to my C:\Data\ folder, I choose "Restore previous versions", click on yesterday's date, and click open... YES! It works! I can see the latest versions of my files (e.g. from yesterday). Thank God. And then, I try to view the files under the "yesterday snapshot-version" of c:\Users\MyAccount\Desktop ... And I get "Permission Denied" as soon as I try to open "Users\MyAccount". I make sure I am an administrator. No joy. Apparently, the new Windows installation does not have access to read the "NTFS snapshots" or "Volume Shadow Snapshots" of my old Windows account! Cross-installation permissions? I need to somehow tell the new Windows install that I am the same "old" user... So that I will be able to access the "Users\MyAccount" folder of the snapshot of my old user account. Help?

    Read the article

  • could not connect to server: Operation timed out

    - by JohnMerlino
    I am able to ssh into my ubuntu server with a user name and password from the terminal. However, when I try to connect to the server using the same name and password via pgadmin, I am getting the following error: could not connect to server: Operation timed out Is the server running on host "xx.xxx.xx.xxx" and accepting TCP/IP connections on port 5432? Why am I able to connect through terminal but not pgadmin?

    Read the article

  • What setting can cause a monitor to flicker under X11?

    - by BCS
    I've been dinking with the xorg.conf file on my system and now when I try to start X I get a flickering effect and no usable image. I think (and this is just a guess) that it's a settings out of bound error of some kind but I don't know what setting. I'm almost completely sure that the hardware is good given that everything is brand new.and works just fine in text mode. Any ideas?

    Read the article

  • Can you mount a sysprep image using DISM

    - by Tester123
    I created a script to mount a sysprepped Windows 7 image to a directory so I can edit a specific file in the image and then unmount it. The script seems to work just fine however, each time I try I seem to be getting some sort of error about the Image. Errors such as: The image is supposedly damaged or corrupted The image mounts but nothing appears in the directory So I guess the overall question is it possible to mount an syprepped Windows 7 Wim Image into a directory?

    Read the article

  • Security System Preference won't open on Macos 10.6 Snow Leopard

    - by adambox
    When I try to open the Security preference pane on my iMac running Mac OS 10.6.6, it says "loading..." and it never opens. I get this in the console: 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetOk: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetCancel: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] *** -[NSCFDictionary initWithObjects:forKeys:count:]: attempt to insert nil value at objects[0] (key: NSFont)

    Read the article

  • Explorer: programmatically select file/directory with space in the path

    - by Mike L.
    When I try to select a file or directory which has a space in its path in the Windows Explorer, it selects a completely different directory: explorer.exe "/select,C:\Program Files\foobar" I've tried it from Java with Runtime.getRuntime().exec(new String[] { "explorer.exe", "/select," + filePath }); and with the above command line. In both cases, the same result. What can I do to solve the problem?

    Read the article

  • Dell E6400 Display issue - "doubling up" intermittently

    - by alex
    I've got a Dell E6400 It's suddenly developed an intermittent fault with the display Every now and again, it seems to boot up with "double vision" By that I mean, its split horizontally, with each half showing the same thing, but with low resolution, and looks grainy - if that makes sense (I will try to get a couple of pictures if I can) I haven't changed any hardware or anything. I have re-built windows, to see if that fixed the problem, it didn't. I've upgraded the BIOS to see if that would help, still same problem. I'm out of ideas :-(

    Read the article

  • Clear Type problem in Windows 7

    - by Florin Sabau
    I try to tune ClearType in Windows 7 x64 using the ClearType Text Tuner. I can choose whatever options I want on the first 3 pages, but on the last page, whatever I choose is reverted as soon as I click finish. Next time I run the tuner I can see that the second option is selected, not the option that I wanted (the last one). Has anybody else found this odd behavior?

    Read the article

  • Thunderbird loses all settings if PC is being shut down abnormally

    - by Roland
    If my PC shut downs suddenly with power dips etc I loose all my Thunderburd settings and mail in Thunderbird, although the Profiles folder still exists. I had a look in the profiles text file and that file looks unchanged. Are there things I could try to solve this issue? I do not know what do do? Any help will be greaatly appreciated. OS: Win XP Professional SP2 Thunderbird Version: 2.0.0.19

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 247 248 249 250 251 252 253 254 255 256 257 258  | Next Page >