Search Results

Search found 34195 results on 1368 pages for 'try'.

Page 252/1368 | < Previous Page | 248 249 250 251 252 253 254 255 256 257 258 259  | Next Page >

  • Security System Preference won't open on Macos 10.6 Snow Leopard

    - by adambox
    When I try to open the Security preference pane on my iMac running Mac OS 10.6.6, it says "loading..." and it never opens. I get this in the console: 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetOk: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetCancel: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] *** -[NSCFDictionary initWithObjects:forKeys:count:]: attempt to insert nil value at objects[0] (key: NSFont)

    Read the article

  • No Option to Burn ISO on Windows 7

    - by Michael Gorsuch
    From what I hear, Windows 7 is able to burn ISO files natively. I should be able to right-click on a given ISO and choose "Burn disk image", but I do not have that option on any ISO I try. I am assuming that I fudged the associations somehow. Can you help me get back on track?

    Read the article

  • Installing SQL Server 2008 R2 on Windows 8 (Enterprise Evaluation)

    - by Nalaka526
    When I Try to install SQL Server 2008 R2 on Windows 8 (Enterprise Evaluation), a compatibility warning massage is displayed, Tried Get help online option but it is says No solution found, but setup starts when I select Run the program without getting help. Do I have to install any Service Pack or Update to make it compatible or SQL Server 2008/R2 is not supported on this version of windows? and what are the effects if I run the setup ignoring the warning message?

    Read the article

  • Getting a redirect in gmail/google apps in Google Documents

    - by Lee Carlton
    Good afternoon, For some reason when I try to download documents from google docs in both my standard gmail account and my work's google apps, it goes into a redirect. I've tried opening it on my roommate's computer, and it works just fine. I'm guessing that it has something to do with my particular browser. I get the same error in both chrome and ie though.

    Read the article

  • Paint Shop Pro-like open-source software?

    - by overtherainbow
    I need to add shapes that have been available in Paint Shop Pro since version 7 like curved arrows, etc. I gave Paint.Net and IrfanView a try, but they don't seem to support more sophisticated shapes than straight lines, circles, or rectangles. If this is correct, does someone know of a PSP-equivalent open-source solution for Windows? Thank you.

    Read the article

  • Any tool to check which ports/protocols firewalls prevent?

    - by Jus12
    Suppose I have a setup as: host_1 --- Firewall_1 --- Internet --- Firewall_2 --- host_2 I need to check which ports are open on host_2 from host_1 (which may be blocked by either firewalls) If there a tool that comes in two parts (one running on host_1 and other on host_2) that does this for me? It should be something like: 1 Listen to all ports on host_2 2 Try to connect to every port on host_2 from host_1 3 Give a report what ports are allowed.

    Read the article

  • Which Twitter app do you use?

    - by Jeff Fritz
    It seems like everyone is writing their own Twitter front-end application nowadays. So I must ask: What is your preferred Twitter front-end management application? Please discuss: Form Factor: Desktop, Mobile, Web based OS Support: Windows, Mac, Linux, iPhone, BlackBerry, etc Killer Feature that made you convert Please try to format your responses using the bullet points above. This way, we can all easily compare features. Please list 1 app per response

    Read the article

  • Windows service process priority.

    - by staemer
    I would like to run the Windows Desktop Search indexer at below normal priority. When I try to set this via task manager, I get 'Access is denied'. Is there a way to remove whatever restrictions are protecting this process? Or ideally, configure it to have the lower priority on startup? XPSP3 btw.

    Read the article

  • "Error 1067: The process terminated unexpectedly" when trying to install MySQL on Win7 x64.

    - by Gravitas
    Hi, I've run into a brick wall trying to install MySQL v5.5 on my machine. My PC is Windows 7 x64, Enterprise edition. MySQL installs fine, but when I run the "MySQL Instance Configuration Wizard", it pauses forever on the step "Start Service" (I can let it run for 30 minutes with no response). If I go into services, I see that the "MySQL" service hasn't started, and if I try to start it, it says "Windows could not start MySQL Service on Local Computer. Error 1067: The process terminated unexpectedly." I've tried the following: Turning off firewall. Uninstalling all antivirus software. Installing / reinstalling 32-bit version of MySQL. Installing / reinstalling 64-bit version of MySQL. Uninstalling, deleting the contents of "C:\program files\MySQL" and "C:\program files (x86)\MySQL", reinstalling. Checking to see that there is no rogue services named MySQL???? (from a previous install). Checking that port 3306 is not used by an alternate program. Changing the default port that MySQL uses. Checking for "my.ini" and "my.ini.cnf" in "C:\windows" (nothing there but that can cause a problem). Running both MySQL installer, and configuration wizard, in "Adminstrator mode". Turning off UAC. Installing with defaults, not changing anything. Rebooting my machine (about 6 reboots so far). Opening up port 3306 in the firewall (both TCP and UDP, inbound and outbound). Swearing at the klutz of a programmer who designed MySQL so you can't even install it (as if that would help!) My machine is working 100% in every other way. InfiniDB (a MySQL compatible database) installs 100%, as does Visual Studio 2010, Microsoft SQL Server, etc, etc. Your advice on how to work around this? p.s. Here is the screen it got stuck on for 15 minutes until I killed the process: Update 2010-12-20 Tried MySQL v5.1, it didn't work either. Its amazing - if you type "mysqld /?", or "mysqld -help", it doesn't give you any help. And, if you try to restart the service manually, it doesn't display any error messages. Could it be any more unhelpful? Update 2010-12-21 Installed MySQL 6.0 alpha, and it worked. However, I'd rather not use an alpha release, given that the "stable" release is anything but :( Update 2010-12-21 Found http://dev.mysql.com/doc/refman/5.1/en/windows-troubleshooting.html, dealing with troubleshooting under Windows. Discovered that you can generate an error log if the service doesn't start - see here: http://dev.mysql.com/doc/refman/5.1/en/error-log.html

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • recovering USB printer

    - by shodanex
    I have an USB printer, that was discovered and installed properly. At some point, I suppressed it in the printer view of the config panel. If I try to add a new local printer, it says : Only use this option if you don't have an USP printer ( Windows automatically installs USB printer). How can I make windows automatically reinstall the USB printer I accidentally suppressed ? Edit : It is a dell all-in-one 920 printer, and I just tried to download and reinstall dell software.

    Read the article

  • Hell: NTFS "Restore previous versions"...

    - by ttsiodras
    The hell I have experienced these last 24h: Windows 7 installation hosed after bluetooth driver install. Attempting to recover using restore points via "Repair" on the bootable Win7 installation CD. Attempting to go back one day in the restore points. No joy. Attempting to go back two days in the restore points. No joy. Attempting to go back one week in the restore points. Stil no joy. Windows won't boot. Apparently something is REALLY hosed. And then it hits me - PANIC - the restore points somehow reverted DATA files to their older versions! Word, Powerpoint, SPSS, etc document versions are all one week old now. Using the "freshest" restore point. Failed to restore yesterday's restore point!!! I am stuck at old versions of the data!!! Booting KNOPPIX, mounting NTFS partition as read-only under KNOPPIX. Checking. Nope, the data files are still the one week old versions. Booting Win7 CD, Recovery console - Cmd prompt - navigating - yep, data files are still one week old. Removing the drive, mounting it under other Win7 installation. Still old data. Running NTFS undelete on the drive (read-only scan), searching for file created yesterday. Not found. Despair. At this point, idea: I will install a brand new Windows installation, keeping the old one in Windows.old (default behaviour of Windows installs). I boot the new install, I go to my C:\Data\ folder, I choose "Restore previous versions", click on yesterday's date, and click open... YES! It works! I can see the latest versions of my files (e.g. from yesterday). Thank God. And then, I try to view the files under the "yesterday snapshot-version" of c:\Users\MyAccount\Desktop ... And I get "Permission Denied" as soon as I try to open "Users\MyAccount". I make sure I am an administrator. No joy. Apparently, the new Windows installation does not have access to read the "NTFS snapshots" or "Volume Shadow Snapshots" of my old Windows account! Cross-installation permissions? I need to somehow tell the new Windows install that I am the same "old" user... So that I will be able to access the "Users\MyAccount" folder of the snapshot of my old user account. Help?

    Read the article

  • Trying to setup a PHP daemon using System_Daemon and I'm having issues getting it to run.

    - by yummm
    I get the following error when trying to start a daemon using Ubuntu 10.04 and the PHP5: PHP Warning: PHP Startup: Unable to load dynamic library 'usr/lib/php5/20060613/pcntl.so' - /usr/lib/php5/20060613/pcntl.so: cannot open shared object file: No such file or directory in Unknown on line 0 Does System_Daemon try to call pcntl? If so, why is it looking for the file where it does not exist?

    Read the article

  • DVD playback with Windows Media Player 11 works fine, but when copied to HDD and then played back, t

    - by stakx
    I have several DVDs with short documentaries on it. Since the notebook I'm using (a Dell Latitude E6400) has only one DVD drive, and I might play back those short movies very often, I thought of copying them to the HDD and playing them back from there. However, I've run into a problem, namely stuttering audio. Problem description: When I play back these movies directly from DVD (with Windows Media Player 11 under Windows Vista), everything works fine. Smooth video, no significant audio problems (only the occasional click). But as soon as I copy any of these DVDs to the HDD and try to play them back from there (e.g. using the wmpdvd://drive/title/chapter?contentdir=path protocol, I get stuttering audio — audio playback sounds like a machine gun for a third of a second or so, approx. every 8 seconds. I have tried converting the VOB files from the DVD to another format (ie. ripping), but that resulted in a noticeable downgrade of picture quality. Therefore I thought it best to keep the files in their original format, if possible. Still, I suspect that the stuttering audio is due to some (de-)muxing problem, and that changing the file format might help. (After all, video playback is fine; therefore I don't think that the hardware is too slow for playback.) Only thing is, I don't know how to convert the VOB files to another Windows Media Player-compatible format without quality loss. I hope someone can help me, or give me further pointers on things I could try out to get HDD playback to work without the problem described. Some things I've tried so far, without any success: VOB2MPG, in order to convert the .vob file to a .mpg file. But that changes only the A/V container, not the content. No re-encoding takes place at all. Re-encoding with MPlayer/MEncoder. Lots of quality loss there, and I frankly haven't got the time to test all possible settings combinations available. Disabling all plug-ins, equalizers, etc. in Windows Media Player. Disabling all hardware acceleration on the audio playback device. Further info on the VOB files I'm trying to playback: The video format is MPEG ES, PAL 720x576 pixels @ 24/25 frames per second. The sound stream is uncompressed PCM, 16-bit stereo @ 48kHz. (Might it help if I somehow re-encoded the sound stream at a lower resolution, or as an MP3? If so, how would I do this without changing the video stream?) P.S.: I am limited to using Windows Media Player (11). (I previously tried MPlayer btw., but the video playback quality was surprisingly bad.)

    Read the article

  • How do you stop an FTP Service resetting?

    - by Jenski
    While using an FTP service through the command line, I try to retrieve a directory listing. I get: ftp> ls 200 PORT command successful. 150 Opening ASCII mode data connection for file list. > ftp: get :Connection reset by peer Any ideas how I should go about resolving this problem? Thanks in advance.

    Read the article

  • Restart browser on error

    - by billfredtom
    Is there a way to restart a browser (Internet Explorer, Firefox, etc) automatically upon receiving an error such as a DNS error or Page not found? Background: It is for a web based signage application that has intermittent network drop outs, therefore if there's no internet, and the sign tries to go to the next page, an error occurs on browser, and we get one big ugly sign. We need a way to either restart the browser, or customise displayed error messages to use javascript to try redirection to the live sign again.

    Read the article

  • Windows 2003 registry corrupt - endless reboot

    - by Jack
    Windows 2003 will run the loading screen then it stop with "Stop c000218 registry file failure or corrupt. The registry can not load the hive \systemroot\system32\config\security" then it start a count down about dumping the physical memory to disk and reboot itself again. I found Error starting Windows SBS 2003 - STOP: c0000218 but the config is different directory than mine. Is it the same step to try for recovery console?

    Read the article

  • Explorer: programmatically select file/directory with space in the path

    - by Mike L.
    When I try to select a file or directory which has a space in its path in the Windows Explorer, it selects a completely different directory: explorer.exe "/select,C:\Program Files\foobar" I've tried it from Java with Runtime.getRuntime().exec(new String[] { "explorer.exe", "/select," + filePath }); and with the above command line. In both cases, the same result. What can I do to solve the problem?

    Read the article

  • One incorrect SSH login attempt locks me out for an hour...

    - by Legend
    I've never observed this problem neither did any of my colleagues trying to SSH into the same system. If I try logging into my server using a wrong username and then press ^C to terminate or exhaust my password attempts, I am locked out for at least an hour. Is there something I can do on my end to fix this problem?

    Read the article

  • Windows 2012 VPN setup without Active Directory

    - by iss42
    I have followed the guide here: http://www.youtube.com/watch?v=9qbpxKRb-94 But my situation differs with respect to there being no AD (Active Directory) setup. When I try to connect I get this in the server event log: "The user xx connected from x.x.x.x but failed an authentication attempt due to the following reason: The account does not have permission to dial in." Is there a way to enable this without AD?

    Read the article

< Previous Page | 248 249 250 251 252 253 254 255 256 257 258 259  | Next Page >