Search Results

Search found 11767 results on 471 pages for 'x org'.

Page 283/471 | < Previous Page | 279 280 281 282 283 284 285 286 287 288 289 290  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to perform a nested mount when using chroot?

    - by user55542
    Note that this question is prompted by the circumstances detailed by me (as Xl1NntniNH7F) in http://www.linuxquestions.org/questions/linux-desktop-74/boot-failure-upon-updating-e2fsprogs-in-ubuntu-10-10-a-947328/. Thus if you could address the underlying cause of the boot failure, I would very much appreciate it. I'm trying to replicate the environment in my ubuntu installation (where the home folder is on a separate partition) in order to run make uninstall. I'm using a live cd. How to mount a dir in one partition (sda2, mounted in ubuntu as the home folder) into a directory on another mounted partition (sda3)? I did chroot /mnt/sda2 but I don't know how to mount sda3 to /home, and my various attempts didn't work. As I am unfamiliar with chroot, my approach could be wrong, so it would be great if you could suggest what I should do, given my circumstances.

    Read the article

  • Expertise Location [closed]

    - by Alexey Shatygin
    Is there some really working implementations of the expertise location systems exist? It is very hard to find anything about it. What sources to use, what to read, where to look? I've started with reading David W. McDonald's, Mark S. Ackerman's overview "Just talk to me" and now need just something more detailed. For those, who voting this question to be closed for off-topic: it is connected to IT sphere, if you don't know what it is - why ever vote? http://en.wikipedia.org/wiki/Expertise_finding http://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.40.4654&rep=rep1&type=pdf

    Read the article

  • Odd SVN Checkout failures occur frequenctly on VMWare virtual machines

    - by snowballhg
    We've recently been experiencing seemingly random SVN checkout failures on our Hudson build system. Google search has failed me; I'm hoping the super user community can help me out :-) We are occasionally receiving the following SVN error when our Hudson build jobs checkout source via the Hudson Subversion plug-in (which uses svn kit): ERROR: Failed to check out http://server/svnroot/trunk org.tmatesoft.svn.core.SVNException: svn: Processing REPORT request response failed: XML document structures must start and end within the same entity. (/svnroot/!svn/vcc/default) svn: REPORT request failed on '/svnroot/!svn/vcc/default' This issue seems to only occur when checking out from our Virtual Machines (Windows XP, Fedora 9, Fedora 12) using Hudson's SVN Plug-in. Systems that use the traditional SVN client seem to work. SVN Server version: 1.6.6 Hudson version: 1.377 Hudson SVN Plugin Version: 1.17 Has anyone dealt with this issue, or have any suggestions? Thanks

    Read the article

  • How to move a windows machine properly from RAID 1 to raid 10? [migrated]

    - by goober
    Goal I would like to add two more hard drives to my current RAID 1 setup and create a RAID 0 setup on top of the two RAID 1 setups (which I believe is referred to as "RAID 10"). Components Involved Intel P68 Chipset Motherboard 4 SATA ports that can be configured for Raid An intel SSD cache that sits in front of the RAID, and a 64 GB SSD configured in that manner Two 1TB HDDs configured in RAID 1 OS: Windows 7 Professional Resources Consulted so far I found a great resource on LinuxQuestions.org for a good "best practices" process for Linux machines, but I'd like to develop a similar process that I know works on Windows Machines.

    Read the article

  • time on files differ by 1 sec. FAIL Robocopy sync

    - by csmba
    I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

    Read the article

  • Window 2003 is PHP Limiting my Download Speed?

    - by JohnScout
    Hello, I have window 2003 100mbps server, i have tried using php script such as php indexer, zina pancake.org and others. The php script use to serve download such as images and music songs. I personally have 20mbps internet speed. When i use the php script (download pass thru PHP headers) , it will download at constant speed of 30-40KBps. I have tried different webserver such as apache 1.3, apache 2.2, abyss webserver & lighttpd for windows. The speed while relying on php is same constant 30-40KBps however when i tried direct link/straight from apache, the speed is 1MB/s. Is there any settings in Window 2003 Registry or PHP should i change to make the download speed is more faster when going thru PHP?

    Read the article

  • Unable to open websites that use HTTPS on linux

    - by negai
    I have the following network configuration: My PC 192.168.1.20/24 uses 192.168.1.1/24 as a gateway. Dlink-2760U router with Local address 192.168.1.1/24 has a VPN connection open with the provider using PPTP. Whenever I'm trying to open some web-sites that has some authorization (e.g. gmail.com, coursera.org), I'm getting a request timeout. This problem is observed mostly on linux (Ubuntu 12.04 and Debian 6.0), while most of such websites work correctly on windows XP. Could you please help me diagnose the problem? Could it be related to NAT + HTTPS? Thanks

    Read the article

  • debian installation without internet connection

    - by Gobliins
    Hi i want to install some Debian distributions (Grip, Crush, Lenny...) for arm / armel architectures. www.emdebian.org/ i refer to this guide www.aurel32.net/info/debian_arm_qemu.php The Problem i have is that i dont have internet connection with My Linux VM or Qemu i am behind a Proxy. I want to know is there a way where i can dl all the needed files and save them to disk that i don´t need an i.c. during the installation? I am working under Windows now. my regards

    Read the article

  • Setting up a copy of a site with IIS 7?

    - by SJaguar13
    I have a site running on IIS with a dyndns.org domain that points to the IP of the Windows 2008 machine hosting it. I need a copy of that site for development purposes. I set up another folder with all the files, and create a new site in IIS. I don't really have a domain for it, so I was just going to use the IP address. When I go to localhost, 127.0.0.1, or the internal IP, I get bad hostname. If I use the IP address on port 80 (the same as the real version of the site), I get 404 not found. If I use a different port so I don't have them both on the same IP with the same port, I get connection timed out. How do I go about setting this up?

    Read the article

  • Redirecting HTTP traffic from a local server on the web

    - by MrJackV
    Here is the situation: I have a webserver (let's call it C1) that is running an apache/php server and it is port forwarded so that I can access it anywhere. However there is another computer within the webserver LAN that has a apache server too (let's call it C2). I cannot change the port forwarding nor I can change the apache server (a.k.a. install custom modules). My question is: is there a way to access C2 within a directory of C1? (e.g. going to www.website.org/random_dir will allow me to browse the root of C2 apache server.) I am trying to change as little as possible of the config/other (e.g. activating modules etc.) Is there a possible solution? Thanks in advance.

    Read the article

  • How to combine with openvpn, dynamic-ip?

    - by asfasdv
    Dear everyone, I am currently using openvpn to surf online to bypass censorship. Let me show you the initial scenario: before openvpn is turned on: IP: 1.2.3.4 (hypothetical, checked by visiting whatismyip.com/) after openvpn is turned on IP: 10.2.3.4 (this is also checked with whatismyip.com/, I assume this is where the vpn's exit point's IP ) Situation: Once I enable openvpn, I can still ssh into this computer by sshing into 1.2.3.4, even though visiting whatismyip.com/ says it's 10.2.3.4. However, I am on dynamic IP, I run a website, and am using tools (inadyn in particular) which pings the freedns.afraid.org (my dns server) and updates my ip. The messed up part is when inadyn does so, my dns changes the ip to 10.2.3.4, which is presumably the exit point of my vpn. How do I get around this? (Note that sshing into 1.2.3.4 STILL works).

    Read the article

  • How to upgrade Nginx?

    - by jwerre
    I'm on Ububtu and I'm trying upgrade Nginx 1.0.5 to the latest version 1.2.6. Here's what I did and what didn't work. $ nginx -v nginx: nginx version: nginx/1.0.5 $ curl -O http://nginx.org/download/nginx-1.2.6.tar.gz $ tar xvzf nginx-1.2.6.tar.gz $ cd nginx-1.2.6/ $ ./configure $ make && sudo make install $ nginx -v nginx: nginx version: nginx/1.0.5 <<< still old version!!! Any ideas would be much appreciated. Thanks.

    Read the article

  • Missing time zones in OSX and Windows

    - by pellepim
    I am working on a javascript to automatically detect a user's timezone (https://bitbucket.org/pellepim/jstimezonedetect/). But there are two timezones that I have a really hard time to test, since I can not set my system to observe these timezones. The timezones I am talking about are UTC+1245 (Chatham Islands, NZ) and UTC+0845 (Australia/Eucla). As far as I can tell in OSX (Snow Leopard) and in Windows 7 these timezones do not exist as a setting. Granted, very few people live in these areas, and it might just not be worth it. Does anyone know of a way to set these timezones on a system level? In any operating system? If it is not possible in a trivial way, what do people who live in these areas do to get their systems working as they would like?

    Read the article

  • How to make vim display unicode

    - by Yitzchak
    I am trying to work with a utf-8 encoded xml file in vim 7.3 running on ubuntu. ASCII characters display normally but vim gives me gibberish instead of the unicode characters. After trying the following, I've reached the limits of my knowledge: 1) Checked that unicode was enabled by running set termencoding?. Output was termencoding=utf-8. 2) I installed the script from here (vim.org/scripts) 3) moved my ~/.vimrc file into ~/.vim 4) moved it back into ~ 5) followed the instructions in the accepted answer to this question. Is there some other variable I'm supposed to set? I know my system has the fonts I need. Update: Issue seems to be limited to html files for some reason.

    Read the article

  • How to limit server to specific IP addresses with mod_authz_host?

    - by BeeDog
    Hi! I am very new to this area, so please bear with me. :) Right now I am running an Apache HTTP server on my setup, a very basic configuration. The website hosted on it is accessible from anywhere, and I want to limit the access to a specific IP address range. I've looked into this and I found that one Apache module called mod_authz_host handles this. http://httpd.apache.org/docs/2.2/mod/mod_authz_host.html The problem is, I haven't managed to find documentation that explains well how to actually do the stuff. How do I actually make sure only a certain range of IP addresses can access my site/server? The machine is running Ubuntu Server 10.10, the web files are stored in /var/www/, the apache2 daemon has its stuff stored in /etc/apache2/ and /usr/lib/apache2/modules/*. Thanks in advance, and sorry if this is a stupid question!

    Read the article

  • SFTP not working, but SSH is

    - by Dan
    I've had a server running CentOS for a few months now. A few days ago, I stopped being able to connect to it over SFTP. I've tried from multiple computers, OSes, clients, and internet connections. I can SSH in just fine, though. For example, Nautilus gives me this: Error: DBus error org.freedesktop.DBus.Error.NoReply: Did not receive a reply. Possible causes include: the remote application did not send a reply, the message bus security policy blocked the reply, the reply timeout expired, or the network connection was broken. Please select another viewer and try again. I was under the impression that SFTP was just pure SSH, and if one worked, the other would, and vice-versa. Clearly that's not the case, though. What could I have done wrong?

    Read the article

  • Can GnomeKeyring store passwords unencrypted?

    - by antimeme
    I have a Fedora 15 laptop with the root and home partitions encrypted using LUKS. When it boots I have to enter a pass phrase to unlock the master key, so I have it configured to automatically log me in to my account. However, GnomeKeyring remains locked, so I have to enter another pass phrase for that. This is unpleasant and completely pointless since the entire disk is encrypted. I've not been able to find a way to configure GnomeKeyring to store its pass phrases without encryption. For example, I was not able to find an answer here: http://library.gnome.org/users/seahorse-plugins/stable/index.html.en Is there a solution? If not, is there a mailing list where it would be appropriate to plead my case?

    Read the article

  • Allow Internet Access with Default Gateway on Windows 7 VPN Server

    - by Hakoda
    I have a Windows 7 box at home (which I'll refer to as Home-VPN) that runs a simple PPTP VPN server. I have a range of 2 IP address (192.168.1.10-192.168.1.11) to give out, although the server is only able to give out one concurrent connection. Ports 1723 & 47 are correctly forwarded to the server. IPv6 is disabled on both Home-VPN and the client. I setup Home-VPN just like this Youtube video: http://www.youtube.com/watch?v=1s5JxMG06L4 I can connect to it just fine but I can't access the Internet when connected to Home-VPN, all outside web servers (eg. google.com, mozilla.org, apple.com) are unreachable. I know I can uncheck "Use Default Gateway on Remote Servers" on the client side under IPv4 settings but that will route all my traffic through my current connection, rather than through the VPN, defeating the purpose of said VPN. Any ideas on how I can fix this?

    Read the article

  • How to host my own cloud so that videos are viewable via desktop web browser?

    - by jake9115
    I want to host my own cloud storage solution, something like Dropbox but entirely dependent on my own central machine. This way things are more secure if setup correctly, and there are artificial storage limitations or pay-walls. Some thing similar to ownCloud: http://owncloud.org/ There is one important feature I want to have: the ability the stream movies in a web browser from my personal cloud to anywhere in the world. In the past I tried this with a NAS, and I mapped XBMC to the NAS via SFTP, and certain media types could stream in this manner. I've also used things like PLEX. In this case, I am looking for a single solution for personal cloud storage and movie streaming from that cloud into a web browser. Does anyone know if this can be accomplished? Thanks for the suggestions!

    Read the article

  • Subdomain returns error when restarting Apache

    - by xXx
    I try to install a subdomain on my dedicated server. I made a new DNS rules to point my sub domain to the IP of my serv. After reading this Subdomain on apache i tried to add new rules on Apache : NameVirtualHost *:80 <VirtualHost *:80> ServerName tb.mysite.org DocumentRoot /home/mysite/wwww/tb/ <Directory "/home/mysite/wwww/tb/"> AllowOverride All Allow from all </Directory> </VirtualHost> Then i restart Apache but it returns sudo /etc/init.d/apache2 restart * Restarting web server apache2 Warning: DocumentRoot [/home/mysite/wwww/tb/] does not exist [Wed Jun 27 10:32:58 2012] [warn] NameVirtualHost *:80 has no VirtualHosts ... waiting Warning: DocumentRoot [/home/mysite/wwww/tb/] does not exist [Wed Jun 27 10:32:59 2012] [warn] NameVirtualHost *:80 has no VirtualHosts the tb/ folder is existing, don't why Apache can't find it... And it says that NameVirtualHost:80 has no VirtualHosts...

    Read the article

  • How can I install Java SDK on Windows 7 without messing up the system?

    - by robert_d
    I've installed Java SE Development Kit 1.6.0_31 32bit on Windows 7 64bit system, but this installation messed up my system, e.g. when I start Google Chrome I get error Your preferences can not be read Visual Studio 2010 after launching shows error that The Application Data folder for Visual Studio could not be created The shortcut to the Downloads folder in Windows Explorer no longer works. BTW this is pretty clean install, on other occasions after Java installation I had problems like this http://forums.techguy.org/windows-vista/808717-solved-c-windows-system32-config.html Is there a way to install Java SDK without messing up Windows 7? Or maybe this mess can be cleaned up after installation of Java, but how?

    Read the article

  • Move and clone VirtualBox machines with filesystem commands

    - by mit
    I know of 2 ways to clone a VirtualBox machine on a linux host, one is by using the VirtualBox gui and exporting and re-importing as Appliance (in the file menu of VirtualBox). The other is by cloning only the virtual disk containers: VBoxManage clonevdi source.vdi target.vdi (Taken from http://forums.virtualbox.org/viewtopic.php?p=853#p858 ) I would have to create a new VM afterwards and use the cloned virtual disk. Is there a way I can just copy a virtual disk and the and do the rest by hand? I'd have to manually edit the ~/VirtualBox/VirtualBox.xml and insert a new disk and a new machine: Can I just make up UUIDs or how would this work? I would very much prefer this hardcore method of doing things as it allows me to freely and rapdily backup, restore, move or clone machines. Or ist there a better way to do this?

    Read the article

  • What is the `/etc/hostname` used/required for?

    - by static
    I found in the /etc/hostname my IP-address, than I deleted it and each time I use sudo - I get a message and a system email sudo: unable to resolve host (none) or if in the /etc/hostname is saved myhostname than sudo: unable to resolve host (myhostname). I know it is used to set the system's hostname via /etc/init.d/hostname.sh while booting process, but what is this setting required for (programs, services, daemons ...)? What if i set to localhost (so it doesn't happen any sudo: unable to resolve host (none) anymore, but is it still ok?)? UPD1: I found some information here: http://jblevins.org/log/hostname, but it is all about how to use it and not about - why it is required.

    Read the article

  • Windows Server 2008 - Setting Up DNS and Web Server (IIS) to host personal website?

    - by Car Trader
    Okay, I have a server, (Windows Server 2008 R2 to be more precise) and I have installed PHP, MySQL, phpMyAdmin, for web hosting purposes. I have set up a static ip address internally. I have installed the role DNS and Web Server (IIS) role. I now set up my forward looking zone as my chosen domain. I set up the nameservers as ns1.domain.co.uk with my IP address which I found from whatismyip.org. However, when I type my IP address, it times out with an error (Timeout Error). Am I doing something wrong? Am I missing something? Also I have seen that most websites have multiple nameservers, which are apparently mirror IP addresses which all redirect to one IP address. Also, I can locally connect using the IP address 192.168.0.8, however, I want to put my website online/live on the internet. Can anyone help me with this? -- Regards

    Read the article

< Previous Page | 279 280 281 282 283 284 285 286 287 288 289 290  | Next Page >