Search Results

Search found 11924 results on 477 pages for 'openoffice org'.

Page 289/477 | < Previous Page | 285 286 287 288 289 290 291 292 293 294 295 296  | Next Page >

  • Backup Mongodb on EC2 through EBS snapshots - timing issue

    - by DmitrySemenov
    I'm following this guidance http://docs.mongodb.org/ecosystem/tutorial/backup-and-restore-mongodb-on-amazon-ec2/ I have 4 EBS 1000 IOPS volumes assigned to instance These 4 volumes through MDADM assembled into software RAID10 array. I want to do backups through EBS Snapshots as explained in the article above Question: Mongodb says - that I need to mongo shelldb.runCommand({fsync:1,lock:1}); -- this will lock the db for writing ....run snapshot creation... mongo shell db.$cmd.sys.unlock.findOne(); -- this will unlock the db for writing so do I need to unlock the DB for writing after I issued the comand ec2-create-snapshot or after it's finished and the actual snapshot is created thanks, Dmitry

    Read the article

  • Xorg configuration file on Debian Testing

    - by nubicurio
    I cannot find the Xorg configuration file on my newly installed Debian on my tablet-pc, so I followed this tutorial http://wiki.debian.org/Xorg and ran the command "Xorg -configure", to which I got the following error messages: (EE) Failed to load module "vmwgfx" (module does not exist, 0) (EE) vmware: Please ignore the above warnings about not being able to load module/driver vmwgfx (++) Using config file: "/root/xorg.conf.new" (==) Using system config directory "/usr/share/X11/xorg.conf.d" FATAL: Module fbcon not found. Number of created screens does not match number of detected devices. Configuration failed. Dose anyone know what this means and how I should proceed? Why is there a warning about vmware, and what is this fbcon module?

    Read the article

  • Are there any tools for monitoring individual Apache virtual hosts in real-time?

    - by Dave Forgac
    I'm looking for a way to monitor and record Apache traffic, separated by virtual host. I am currently using Munin to capture this and other data for the entire server however I can't seem to find a way to do this by vhost. This link describes using a module called mod_watch which is apparently no longer in development: http://www.freshnet.org/wordpress/2007/03/08/monitoring-apaches-virtualhost-with-munin/ The file that is listed as being compatible with Apache 2.x is reported to have problems with missing vhosts an reporting data correctly. Does anyone know of a reliable way to determine real-time traffic per vhost? If I can find this it should be easy enough to write a new Munin plugin.

    Read the article

  • Can't get port forwarding to work on Ubuntu

    - by Znarkus
    I'm using my home server as NAT/router, which works well. But now I'm trying to forward port 3478, which I can't get to work. eth0 = public interface eth1 = private network $ cat /proc/sys/net/ipv4/conf/eth0/forwarding 1 $ cat /proc/sys/net/ipv4/conf/eth1/forwarding 1 Then to forward port 3478 to 10.0.0.7, I read somewhere that I should run iptables -t nat -A PREROUTING -p tcp -i eth0 --dport 3478 -j DNAT --to-destination 10.0.0.7:3478 iptables -A FORWARD -p tcp -d 10.0.0.7 --dport 3478 -m state --state NEW,ESTABLISHED,RELATED -j ACCEPT I also ran ufw allow 3478 But testing port 3478 with http://www.canyouseeme.org/ doesn't work. Any idea what I have done wrong?

    Read the article

  • How to configure installed Ruby and gems?

    - by NARKOZ
    My current gem env returns: RubyGems Environment: - RUBYGEMS VERSION: 1.3.6 - RUBY VERSION: 1.8.7 (2008-08-11 patchlevel 72) [x86_64-linux] - INSTALLATION DIRECTORY: /home/USERNAME/.gems - RUBYGEMS PREFIX: /home/narkoz - RUBY EXECUTABLE: /usr/bin/ruby1.8 - EXECUTABLE DIRECTORY: /home/USERNAME/.gems/bin - RUBYGEMS PLATFORMS: - ruby - x86_64-linux - GEM PATHS: - /home/USERNAME/.gems - /usr/lib/ruby/gems/1.8 - GEM CONFIGURATION: - :update_sources => true - :verbose => true - :benchmark => false - :backtrace => false - :bulk_threshold => 1000 - "gempath" => ["/home/USERNAME/.gems", "/usr/lib/ruby/gems/1.8"] - "gemhome" => "/home/USERNAME/.gems" - REMOTE SOURCES: - http://rubygems.org/ How can I change path /home/USERNAME/ to my own without uninstalling? OS: Debian Linux

    Read the article

  • How can I delete everything after the first column in Notepad++?

    - by Bob J
    I'm trying to get rid of everything after a column in Notepad++. Column mode is not an option. Is it possible? What I have 70.97.110.40 159 ms [n/a] 21 70.97.117.177 134 ms [n/a] 21 70.97.120.10 75 ms [n/a] 21 70.97.122.105 87 ms www.portless.net 21 70.97.122.106 89 ms www.popovetsky.org 21 70.97.122.107 95 ms www.psmythe.net 21 70.97.122.104 98 ms wasabi.prostructure.com 21 70.97.122.108 89 ms crm.prostructure.com 21 70.97.122.109 87 ms internal.prostructure.com21 What I want 70.97.110.40 70.97.117.177 70.97.120.10 70.97.122.105 70.97.122.106 70.97.122.107 70.97.122.104 70.97.122.108 70.97.122.109 Thanks

    Read the article

  • Consume an XML Feed with PowerPoint 2010

    - by Matt Schweers
    Hi there. I'm looking for a way to consume an XML feed from a web-service directly into PowerPoint 2010. I found the LiveWeb plugin (http://skp.mvps.org/liveweb.htm) for PowerPoint that, while pretty cool, really only pulls in actual web content in a way that feels more like an iframe. Ideally, I would like to consume raw XML web service/feed with PowerPoint, parse it, and stylize the results. Is this possible? Even reading from a static XML file would be a good start.

    Read the article

  • Distributing a Python Software for Linux [closed]

    - by zfranciscus
    Hi, I am writing my first software in Python for Ubuntu (or Debian based Linux). I am looking for a good advise on the best way to distribute my software. The easist alternative that I can think of at the moment is to archive the python code into *.tar.gz, and let user execute the main python script as an executable to run the software. I realize that this may not be the best approach. I looked at the Debian maintainer guide: "http://www.debian.org/doc/maint-guide/ch-dother.en.html", not too sound lazy, but the guide looks very intimidating for a beginner. Are there any other tutorial that show how to create a debian package for a beginner ? If anyone has a suggestion do let me know. Thanks ^_^

    Read the article

  • Which universal or driverless printing solution do you use/recommend?

    - by Matt
    I'm in need of a driverless printing solution for Microsoft Terminal Services 2003/2008. This is mainly to support clients who are connected through broadband into our hosted servers. We were hoping that MSTS 2008 thinprint would be the answer but unfortunately it performs poorly in the print area. The files are too large. I found the following slightly outdated URL: http://www.msterminalservices.org/software/Printing/ This lists a number of products but I have no experience with any of them. I'd like a product that works/easy to install (as our clients are remote and not particularly tech savvy) and ideally I just pay for the server license and not every clients. What is your experience/recommendation and tips you can offer me in regards to TS printing? thanks in advance.

    Read the article

  • Why is there no 64-bit Linux Firefox build?

    - by Legooolas
    It seems that I have to build my own 64-bit Firefox for Linux, as Mozilla won't support it until Firefox 4. Why is this? It looks to me as though it works fine, although without some of the speed improvements to the Javascript engine which the 32-bit version gets. (Edit: Yes I could run the 32-bit version but I'm trying to keep my system clear of 32-bit cruft and libraries etc, and all the plug-ins worked fine in 3.0.11 64-bit unofficial builds.) Update : No longer relevant as Mozilla provide 64-bit builds, but they don't show them on the download pages of mozilla.org, just on the ftp site as mentioned in one of the answers below.

    Read the article

  • Non interactive git clone (ssh fingerprint prompt)

    - by qwe
    I want to clone a repo in a non-interactive way. When cloning, git asks to confirm host's fingerprint: The authenticity of host 'bitbucket.org (207.223.240.182)' can't be established. RSA key fingerprint is 97:8c:1b:f2:6f:14:6b:5c:3b:ec:aa:46:46:74:7c:40. Are you sure you want to continue connecting (yes/no)? no How do I force "yes" every time this questions pops up? I tried using yes yes | git clone ..., but it doesn't work. EDIT: Here's a solution: Can I automatically add a new host to known_hosts? (adds entires to known_hosts with ssh-keyscan).

    Read the article

  • X11 not sending windows to remote computer matlab

    - by MZimmerman6
    I am trying to set up my home desktop, running OS X Mountain Lion, to basically do a bunch of grunt work for me remotely. I have set up ssh, and am able to remotely control the computer fine, but the issue comes in when I try to run X11 apps, like MATLAB, remotely and get windows to pop up. Every time I try to bring up a new window it either opens that window on the remote computer (not the one I am using to control it), or it tells me it can't find a display. here is how I am setting up my ssh assume my matlab alias is set up properly, which it is. ssh -X username@host.org matlab -nodesktop figure; This will open the window on the computer I am SSHing into, and not on the remote one. Basically I want that window to open on the computer I am remoting from. I changed my SSH X11Forwarding and stuff to be yes in ssh_config and sshd_config. Any other suggestions?

    Read the article

  • Install Composer on Ubuntu

    - by Milos
    I am trying to install composer with the command: sudo curl -s https://getcomposer.org/installer | php And I am getting this error: All settings correct for using Composer Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied Downloading... Download failed: failed to open stream: Permission denied The download failed repeatedly, aborting. I don't know why? Do you have an idea? I tryed to google it but nothing.

    Read the article

  • Link two or more text boxes in Visio

    - by Dan
    I am working on creating a template in Visio 2007 (Professional). Each page should reflect a document number and a revision number (two text boxes). I would like to make the template such that entering or changing text in one of these boxes on one page will automatically update the equivalent text boxes on all other pages. Is there an easy way to link two (or more) text boxes to show the same data (mirror each other)? I've looked into creating a ShapeData set and then using the ShapeData field in place of each box, but this will require training others to access and adjust the ShapeData field. In short - I want the issue that was attempting to be solved in Changing Text in Visio Org Chart Shape Changes Multiple Shapes' Text .

    Read the article

  • ionice idle is ignored

    - by Ferran Basora
    I have been testing the ionice command for a while and the idle (3) mode seems to be ignored in most cases. My test is to run both command at the same time: du <big folder> ionice -c 3 du <another big folder> If I check both process in iotop I see no difference in the percentage of io utilization for each process. To provide more information about the CFQ scheduler I'm using a 3.5.0 linux kernel. I started doing this test because I'm experimenting a system lag each time a daily cron job updatedb.mlocate is executed in my Ubuntu 12.10 machine. If you check the /etc/cron.daily/mlocate file you realize that the command is executed like: /usr/bin/ionice -c3 /usr/bin/updatedb.mlocate Also, the funny thing is that whenever my system for some reason starts using swap memory, the updatedb.mlocate io process is been scheduled faster than kswapd0 process, and then my system gets stuck. Some suggestion? References: http://ubuntuforums.org/showthread.php?t=1243951&page=2 https://bugs.launchpad.net/ubuntu/+source/findutils/+bug/332790

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Expertise Location [closed]

    - by Alexey Shatygin
    Is there some really working implementations of the expertise location systems exist? It is very hard to find anything about it. What sources to use, what to read, where to look? I've started with reading David W. McDonald's, Mark S. Ackerman's overview "Just talk to me" and now need just something more detailed. For those, who voting this question to be closed for off-topic: it is connected to IT sphere, if you don't know what it is - why ever vote? http://en.wikipedia.org/wiki/Expertise_finding http://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.40.4654&rep=rep1&type=pdf

    Read the article

  • Running JBoss 6 with Runit / daemontools or other process supervision framework

    - by Alex Recarey
    I'm tying to use runit to daemonize JBoss. I use the /opt/jboss-6.1.0.Final/bin/run.sh script to start the server. When I do so from the comandline, JBoss does not detach (which is what we want), and will also shut down when CTRL+C is pressed. In theory a perfect candidate to use runit on. Everything works fine except when I try to get runit to shut down JBoss. When I issue the command sv stop jboss nothing happens. Runit thinks the process is stopped but jboss continues to run normally. I'm not doing anything special with the run script. This is my runit run script: #!/bin/sh exec 2>&1 exec /opt/jboss-6.1.0.Final/bin/run.sh -c standard -b 0.0.0.0 Looking at the jboss_init_redhat.sh script, the start section does mention ./bin/run.sh but the stop section has the following text: JBOSS_CMD_STOP=${JBOSS_CMD_STOP:-"java -classpath $JBOSSCP org.jboss.Shutdown --shutdown"} Any ideas of what I could try?

    Read the article

  • How can I use target mode in Linux with USB?

    - by dash17291
    Kernel 3.5 introduces: This release includes a driver for using an IEEE-1394 connection as a SCSI transport. This enables to expose SCSI devices to other nodes on the Firewire bus, for example hard disk drives. It's a similar functionality to Firewire Target Disk Mode on many Apple computers. This release also adds a usb-gadget driver that does the same with USB. The driver supports two USB protocols are supported that is BBB or BOT (Bulk Only Transport) and UAS (USB Attached SCSI). BOT is advertised on alternative interface 0 (primary) and UAS is on alternative interface 1. Both protocols can work on USB 2.0 and USB 3.0. UAS utilizes the USB 3.0 feature called streams support. http://kernelnewbies.org/Linux_3.5 I have an Arch Linux with kernel 3.5.3-1 and wanna try out this feature.

    Read the article

  • Odd SVN Checkout failures occur frequenctly on VMWare virtual machines

    - by snowballhg
    We've recently been experiencing seemingly random SVN checkout failures on our Hudson build system. Google search has failed me; I'm hoping the super user community can help me out :-) We are occasionally receiving the following SVN error when our Hudson build jobs checkout source via the Hudson Subversion plug-in (which uses svn kit): ERROR: Failed to check out http://server/svnroot/trunk org.tmatesoft.svn.core.SVNException: svn: Processing REPORT request response failed: XML document structures must start and end within the same entity. (/svnroot/!svn/vcc/default) svn: REPORT request failed on '/svnroot/!svn/vcc/default' This issue seems to only occur when checking out from our Virtual Machines (Windows XP, Fedora 9, Fedora 12) using Hudson's SVN Plug-in. Systems that use the traditional SVN client seem to work. SVN Server version: 1.6.6 Hudson version: 1.377 Hudson SVN Plugin Version: 1.17 Has anyone dealt with this issue, or have any suggestions? Thanks

    Read the article

  • time on files differ by 1 sec. FAIL Robocopy sync

    - by csmba
    I am trying to use Robocopy to sync (/IMG) a folder on my PC and a shared network drive. The problem is that the file attributes differ by 1 sec on both locations (creation,modified and access). So every time I run robocopy, it syncs the file again... BTW, problem is the same if I delete the target file and robocopy it from new... still, new file has 1 sec different properties. Env Details: Source: Win 7 64 bit Target: WD My Book World Edition NAS 1TB which takes its time from online NTP pool.ntp.org (I don't know if file system is FAT or not)

    Read the article

  • How to move a windows machine properly from RAID 1 to raid 10? [migrated]

    - by goober
    Goal I would like to add two more hard drives to my current RAID 1 setup and create a RAID 0 setup on top of the two RAID 1 setups (which I believe is referred to as "RAID 10"). Components Involved Intel P68 Chipset Motherboard 4 SATA ports that can be configured for Raid An intel SSD cache that sits in front of the RAID, and a 64 GB SSD configured in that manner Two 1TB HDDs configured in RAID 1 OS: Windows 7 Professional Resources Consulted so far I found a great resource on LinuxQuestions.org for a good "best practices" process for Linux machines, but I'd like to develop a similar process that I know works on Windows Machines.

    Read the article

  • debian installation without internet connection

    - by Gobliins
    Hi i want to install some Debian distributions (Grip, Crush, Lenny...) for arm / armel architectures. www.emdebian.org/ i refer to this guide www.aurel32.net/info/debian_arm_qemu.php The Problem i have is that i dont have internet connection with My Linux VM or Qemu i am behind a Proxy. I want to know is there a way where i can dl all the needed files and save them to disk that i don´t need an i.c. during the installation? I am working under Windows now. my regards

    Read the article

  • How to perform a nested mount when using chroot?

    - by user55542
    Note that this question is prompted by the circumstances detailed by me (as Xl1NntniNH7F) in http://www.linuxquestions.org/questions/linux-desktop-74/boot-failure-upon-updating-e2fsprogs-in-ubuntu-10-10-a-947328/. Thus if you could address the underlying cause of the boot failure, I would very much appreciate it. I'm trying to replicate the environment in my ubuntu installation (where the home folder is on a separate partition) in order to run make uninstall. I'm using a live cd. How to mount a dir in one partition (sda2, mounted in ubuntu as the home folder) into a directory on another mounted partition (sda3)? I did chroot /mnt/sda2 but I don't know how to mount sda3 to /home, and my various attempts didn't work. As I am unfamiliar with chroot, my approach could be wrong, so it would be great if you could suggest what I should do, given my circumstances.

    Read the article

  • Window 2003 is PHP Limiting my Download Speed?

    - by JohnScout
    Hello, I have window 2003 100mbps server, i have tried using php script such as php indexer, zina pancake.org and others. The php script use to serve download such as images and music songs. I personally have 20mbps internet speed. When i use the php script (download pass thru PHP headers) , it will download at constant speed of 30-40KBps. I have tried different webserver such as apache 1.3, apache 2.2, abyss webserver & lighttpd for windows. The speed while relying on php is same constant 30-40KBps however when i tried direct link/straight from apache, the speed is 1MB/s. Is there any settings in Window 2003 Registry or PHP should i change to make the download speed is more faster when going thru PHP?

    Read the article

< Previous Page | 285 286 287 288 289 290 291 292 293 294 295 296  | Next Page >