Search Results

Search found 36658 results on 1467 pages for 'line length'.

Page 445/1467 | < Previous Page | 441 442 443 444 445 446 447 448 449 450 451 452  | Next Page >

• Configure PL2303-based USB-to-RS232 adapter to stay awake when no active device is present

  - by casualuser

  I am resurrecting some X10 devices with the aid of a USB-to-RS232 adapter. The problem is, that the adapter only works with the Firecracker device when there is another serial device on the line (the Firecracker is a pass-through device that monitors the RTS and DTR lines to do its magic). Is the PL2303 going to sleep without a real device on the line? Is there an option or command to keep it awake? Is there a cable configuration that would make it work without a real serial device present?

  Read the article

• PHP session files have permissions of 000 - They're unusable

  - by vanced

  I kept having issues with a Document Management System I'm trying to install as, at the first step of the installation process, it would error with: Warning: Unknown: open(/tmp/sess_d39cac7f80834b2ee069d0c867ac169c, O_RDWR) failed: Permission denied (13) in Unknown on line 0 Warning: Unknown: Failed to write session data (files). Please verify that the current setting of session.save_path is correct (/tmp) in Unknown on line 0 I looked in /tmp and saw the sess_* files have the following permissions ---------- 1 vanced vanced 1240 Jan 20 08:48 sess_d39cac7f80834b2ee069d0c867ac169c All the session files look like this. So obviously, they're unusable by PHP and it's causing me lots of problems. How can I get PHP to set the correct permissions? I've tried changing the directory which php.ini uses to /tmp/phpsessions and the same thing occurs. The directories are a+rwx.

  Read the article

• Tool to launch a script driven by modem activity

  - by Will M

  Can anyone suggest a software tool (preferably under Windows XP or later) that would launch an application or script in response to a phone call being received on a landline phone line connected to a data modem on the same PC? or, better, in response to a sequence of touch-tones being played over such a phone line. This would allow, for example, using the telephone to manipulate firewall settings so as to create another layer of security in connection with remote internet access to that computer. I seem to recall seeing tools to do this sort of thing in the days before broadband internet access, when there was more attention to various tips and tricks for the dial-up modem, but a few attempts at Google hasn't turned anything up.

  Read the article

• Underlying Concept Behind Keyboard Mappings

  - by ajay

  I am frustrated with key mapping issues. On my Linux box, if I type Home/End in Vim, then the cursor actually moves to the beginning/end of the line. On my Mac when I am on TextEdit, if I do Fn + Left or Fn + Right, it takes me to beginning/end of the line. But if I am on Vim on my Mac terminal, then the same key combinations don't work. Why? I see online all the different cryptic settings that I have to paste in .vimrc to make this work, but I can't find any explanation for those cryptic map, imap settings. What is the underlying issue here, and how can I fix it? Thanks!

  Read the article

• how to install OpenSSL in windows 7 and also how to check, its enabled or not?

  - by Andy

  how to install OpenSSL in windows 7 and also how to check, its enabled or not? I currently run php through the command line locally not on a server. Thanks I recently installed php 5.2.17 I ran a program which connect with a https server and I got the following error Notice: file_get_contents(): Unable to find the wrapper "https" - did you forget to enable it when you configured PHP? in C:\java\newsweaver-api-v2\simple\list- tags.php on line 30 I added extension=php_openssl.dll to php.ini but I'm wondering is openssl native to php 5.2.17 or do I need to download an extntion. Thanks

  Read the article

• MSSQL, ASP.NET, IIS. SQL Server perfmon log question

  - by Datapimp23

  Hi, I'm testing a web application that runs on a hypervisor. The database server and the webserver are seperate vm's that run on the same hypervisor. We did some tests and the functions perform ok. I want you guys to look at a screenshot of a permon log of the sql 2005 server on the busiest moment. The webserver perfmon log looks fine and it's obvious that we have enough resources to present the page in a timely fashion. http://d.imagehost.org/view/0919/heavyload http://d.imagehost.org/0253/heavyloadz.jpg Zoomed out The striped blue line maxing out is the Processor que length (scale 100,0) The green line at around value 30 is Available MBytes (scale 0,01) The rest of the counters are visible on the screenshot. The sql server machine has no CPU limitations on the hypervisor resources and has 5 vcpu's and 5 GB RAM. Can someone help me to interpret this log. Thanks

  Read the article

• Server 2008 SP1 VSS Writers Not Responding

  - by Jason

  I've got a Windows Server 08 box on SP1 that is having some problems. We've experienced backup problems and I've traced it down to VSS Writers not responding. From the command line, if I type vssadmin list providers, I get Provider name: 'Microsoft Software Shadow Copy provider 1.0' Provider type: System Provider Id: {b5946137-7b9f-4925-af80-51abd60b20d5} Version: 1.0.0.7 If I type vssadmin list writers, I get this vssadmin 1.1 - Volume Shadow Copy Service administrative command-line tool (C) Copyright 2001-2005 Microsoft Corp. Waiting for responses. These may be delayed if a shadow copy is being prepared. I could wait this out for hours and it won't move. I looked up how Server 2008 handles VSS writers, and you can't reregister them like you could in Server 2003 http://social.technet.microsoft.com/Forums/en/windowsserver2008r2general/thread/062cc52c-899b-45f3-8d0c-798b92363f41 Does anyone know how to fix something like this or where to turn next?

  Read the article

• How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

  - by Piotr Piaseczny

  Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

  Read the article

• How to read iptables -L output?

  - by skrebbel

  I'm rather new to iptables, and I'm trying to understand its output. I tried to RTFM, but to no avail when it comes to little details like these. When iptables -vnL gives me a line such as: Chain INPUT (policy DROP 2199 packets, 304K bytes) I understand the first part: on incoming data, if the list below this line does not provide any exceptions, then the default policy is to DROP incoming packets. But what does the 2199 packets, 304K bytes part mean? Is that all the packets that were dropped? Is there any way to find out which packets that were, and where they came from? Thanks!

  Read the article

• How to set original error message for apache 2.2

  - by ffffff

  Apache 2.2 default 414 message is Request-URI Too Large The requested URL's length exceeds the capacity limit for this server. I wanna set custom message so I set http.conf ErrorDocument 414 /error/HTTP_REQUEST_URI_TOO_LARGE.html.var But I do not get along well How to set original error message for apache 2.2

  Read the article

• Is drupal going to improve these small features ?

  - by Patrick

  Is drupal going to improve the following features ? 1) multi-line description for CCK fields such as images (at the moment I can only write in a line but a text-area would be better 2) thumbnails upload for CCK Video fields (so I can upload a thumbnails for each video if I cannot install ffmpeg on the server) 3) merge CCK Images and Videos in a single group. So my customer can order them in the same list by dragging and dropping them, and in my front-end I have them ordered in the same list. This would be very useful for me. Do you know if I can get some of theme with some modules maybe ? thanks

  Read the article

• Alternatives to the Stylewriter program

  - by Brett

  I have just gone to windows 7 x64 and the StyleWriter program is not compatible. Does anyone know of a program that looks for passive verbs and sentence length of 20 words? I want a program, that helps identify passive verbs so I can change them to active verbs. I would appreciate any suggestions. Screenshot thank you

  Read the article

• slow startup of event viewer on windows 7 but fast on server 2008

  - by Tim

  Hi, Since switching to Windows 7 for my desktop I've started to get really p***ed off at the length of time it takes to start the event viewer to display the application event log (typically 20-30 secs or disk griding - presumably to load and cache all the events) I've just noticed that on server 2008 R2 it seems instantaneous. Is my experience typical? Is there any setting I can tweak to make it fast on Windows 7 as well? Tim

  Read the article

• Pressing 'Enter' doesn't really work in Firefox

  - by inkedmn

  When I'm typing just about anywhere in Firefox on OSX and press enter, it simply doesn't do anything. This includes typing in a textarea element (which should take the cursor to the next line), in a search form (which should submit the form). I'm typing this very question in Firefox right now and I'm unable to advance the cursor to the beginning of the next line. I have no clue what I did to make this happen, but it's kinda driving me insane. This is Firefox 3.6.3 under Mac OS X 10.6. Thanks!

  Read the article

• Disabled annotation tools in Skim

  - by Kit

  Here's a portion of the toolbar in Skim In the Add Note section, why are the following tools disabled (dimmed)? Add New Highlight (A in the yellow box) Add New Underline (red line under A) Add New Strike Out (A struck out by red line) However, in the Tool Mode section, there is a drop down button (shown as active in the screenshot). To illustrate, I can select and use the Add New Underline tool, as well as the other tools I mentioned above, using the drop down button. But those tools are dimmed out in the Add Note section. Why? I have observed that the drop down button is just a duplicate of the Add Note section. Why not just enable all the buttons in the Add Note section and save the user from making an extra click just to bring down a list of tools? Is this because of some property of the presently open PDF, or what?

  Read the article

• Proccess of carrying out a BER Test

  - by data

  I am subscribed to an ISP supplying a 3meg ADSL line. Lately (for the last 4 weeks) speeds have dropped from the usual average downstream speed of ~250kbps to just 0.14Mbps (according to speedtest.net) and employees are complaining about lack of access to the server. I have been calling customer support and logging calls for the last 3 weeks, but they have been unable to determine the source of the problem other carrying out a few bitstream tests and checking the DHCP renewal times. I am going to call back and suggest carrying out a BER test. What type of equipment is needed to carry out this test? I have access to a wide range of Cisco networking equipment. Other: We dont need a leased line as there are less than ten employees.

  Read the article

• Know any file compare utility for chunks of text?

  - by Belun

  Is there any file-compare utility-software that can help me compare chunks of text from two text files ? As in, I want to know what chunks of text that are in one file can be found again in the second file. What I need to do is more like a 'compare and search' operation, not just a compare line by line. I need this for finding common errors in application logs. Eg., I have a Java application and logs from two different days. I want to find out which stack-traces (that are actually chunks of text inside a text file) are common to both days.

  Read the article

• How to install php cli with pnctl alongside Zend Server

  - by fazy

  I have Zend Server CE 5.6 with PHP 5.2 running on Ubuntu 11.10. Now the need has arisen to run a command line PHP script that uses PHP's pnctl functionality. First of all, I had no PHP command line in my path, so I made a symlink from the Zend one: sudo ln -s /usr/local/zend/bin/php /usr/bin However, when I run my script, I now get this error: PHP Fatal error: Call to undefined function pcntl_fork() The Zend web control panel doesn't offer pnctl in the list of modules, so how do I get this functionality? Is it safe to use apt-get to install PHP directly, to run alongside the Zend instance? If so, how do I make sure I get version 5.2? I guess the following would pull in PHP 5.3: apt-get php5-cli I could probably muddle through but any pointers to help me avoid making a mess would be much appreciated!

  Read the article

• How to failover to local account on a cisco switch/router if radius server fails?

  - by 3d1l

  I have the following configuration on a switch that I testing for RADIUS authentication: aaa new-model aaa authenticaton login default group radius local aaa authentication enable default group radius enable aaa authorization exec default group radius local enable secret 5 XXXXXXXXX ! username admin secret 5 XXXXXXXXX ! ip radius source-interface FastEthernet0/1 radius-server host XXX.XXX.XXX.XXX auth-port 1812 acct-port 1813 key XXXXXXXXX radius-server retransmit 3 ! line con 0 line vty 5 15 Radius authentication is working just fine but if the server is not available I can not log into the router with the ADMIN account. What's wrong there? Thanks!

  Read the article

• Custom prompt doesn't work on Mac Terminal

  - by mareks

  I like to use a custom prompt (current path in blue) on my unix machine: export PS1='\[\e[0;34m\]\w \$\[\e[m\] ' But when I try to use it on Mac's terminal it doesn't work: it fails to detect the end of the prompt and overwrites the prompt when I type commands. This also happens when I'm inputting a long command where it wraps over the same line instead of starting a new line. I don't understand why this is the case since I use bash on both machines. Any suggestions on how to remedy this?

  Read the article

• What's the advantage of using a bash script for cron jobs?

  - by AlxVallejo

  From my understanding you can write your crons by editing crontab -e I've found several sources that instead refer to a bash script in the cron job, rather than writing a job line for line. Is the only benefit that you can consolidate many tasks into one cron job using a bash script? Additional question for a newbie: Editing crontab -e refers to one file correct? I've noticed that if I open crontab -e and close without editing, when I open the file again there is a different numerical extension such as: "/tmp/crontab.XXXXk1DEaM" 0L, 0C I though the crontab is stored in /var/spool/cron or /etc/crontab ?? Why would it store the cron in the tmp folder?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• xmonad + urxvt issue: text disappears after resizing

  - by user1212010

  I'm using Arch Linux + xmonad + urxvt bundle and trying to resolve the conflict between xmonad and urxvt. Better to explain with shots: Firstly, open the terminal and get some full-length output. Secondly, create another window, which squeezes the first. And, finally, close it to find out that half of the output disappeared. Sometimes it behaves correctly, sometimes not. Tried to find out why, but failed. Many thx in advance!

  Read the article

• How do I get `set show-all-if-ambiguous on` in my .inputrc to play nice with the Python interpreter?

  - by ysim

  I noticed that after I added the set show-all-if-ambiguous on line to my ~/.inputrc, whenever I pressed tab to indent a block, it would show me the bash Display all ... possibilities? (y or n) prompt, and leave me unable to indent the actual code. Is there any way to keep that line in my .inputrc but still have the tab key work as expected in the Python interpreter? This is in my VirtualBox Ubuntu 12.04 VM, if it matters. EDIT: Curiously, I now have a different issue with the Python shell that comes with Django -- when I press tab, I get Python tab completion, but only with one Tab press. I've opened a separate question here for it.

  Read the article

• Create text file named after a cell containing other cell data

  - by user143041

  I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

  Read the article

< Previous Page | 441 442 443 444 445 446 447 448 449 450 451 452  | Next Page >