Search Results

Search found 44742 results on 1790 pages for 'create'.

Page 447/1790 | < Previous Page | 443 444 445 446 447 448 449 450 451 452 453 454  | Next Page >

  • SHA1 form .exe file in C#

    - by alibipl
    Hi! I hope that someone could help me with reading exe files in C# and create a SHA1 hash from it. I have tried to read from executable file using StreamReader and BinaryReader. Then using built-in SHA1 algorithm I tried to create a hash but without success. The algorithm results for StreamReader was "AEUj+Ppo5QdHoeboidah3P65N3s=" and for BinaryReader was "rWXzn/CoLLPBWqMCE4qcE3XmUKw=". Can anyone help me to acheive SHA1 hash from exe file? Thx. BTW Sorry for my English ;)

    Read the article

  • Is it required to generate java classes to use spring-ws client

    - by vishnu
    Hi, I want to use spring ws to create the webservice client. I have seen some documentation. In all using jaxb marshalling and unmarshalling. But to start of need to create java classes from xsd. I tried to download the elcipse plugin for this. The location in java.net is not showing any thing to download. Sourceforce net showing the link to download. But that plugin is not working. I have tried wsimport, but it is generating only .classes? My question is if i want to use spring ws, is it required to generate .java classes? If so where can i find the elipse plugin or how to generate the classes? Is there any other way we can do without generating these classes?

    Read the article

  • Guice creates Swing components outside of UI thread problem?

    - by Boris Pavlovic
    I'm working on Java Swing application with Google Guice as an IOC container. Things are working pretty well. There are some UI problems. When a standard L&F is replaced with Pushing pixels Substance L&F application is not running due to Guice's Swing components creation outside of UI thread. Is there a way to tell Guice to create Swing components in the UI thread? Maybe I should create custom providers which will return Swing components after SwingUtilities.invokeAndWait(Runnable) creates them. I don't like the idea of running the whole application in UI thread, but maybe it's just a perfect solution.

    Read the article

  • WPF: CollectionViewSource - uneven grouping

    - by Eddy
    Hi! Im using the WPF-Toolkit DataGrid with an CollectionViewSource as Source. With PropertyGroupDescriptions I can create and display groups in the Grid. My problem is that i cannot create "uneven" groups, like: A A.A A.B B B.A B.B B.B.A B.B.B C D I want some groups that are deeper than other, and some, that are only elements (C and D) and no groups. I hope it is undestandable... Has someone an idea to solve this? Thanks!

    Read the article

  • PDF Generation Help needed

    - by Kobojunkie
    Hi, I am brandnew to PDF Generation or rendering but have a project to, create a PDF Template system that allows users to save Template to Database, and later generate a PDF document using the template and values from my database. Questions a) Is there a PDF tool out there that can help me with this and documentation I can study to learn of this? b) Are there free tools out there for this? c) How do I create a PDF Template? XML? Thanks in Advance!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Run Exchange Management Shell cmdlets from Visual Basic/C#/.NET app

    - by nowarninglabel
    Goal: Provide a web service using Visual Basic or C# or .NET that interacts with the Exchange Management Shell, sending it commands to run cmdlets, and return the results as XML. (Note that we could use any lanaguage to write the service, but since it is a Windows Box and we have Visual Studio 2008, it seemed like easiest solution would be just use it to create a VB/.NET web service. Indeed, it was quite easy to do so, just point and click.) Problem: How to run an Exchange Management Shell cmdlet from the web service, e.g, Get-DistributionGroupMember "Live Presidents" Seems that we should be able to create a PowerShell script that runs the cmdlet, and be able to call that from the command line, and thus just call it from within the program. Does this sound correct? If so how would I go about this? Thanks. Answer can be language agnostic, but Visual Basic would probably be best since that is what I loaded the test web service up in.

    Read the article

  • SQL Count Query with Grouping by multiple Columns

    - by Christian
    I have a table with three filled columns named "Name", "City" and "Occupation". I want to create a new column in the same table that contains the number of people who have the same occupation. "Name" | "City" | "Occupation" ------------------------------ Amy | Berlin | Plumber Bob | Berlin | Plumber Carol | Berlin | Lawyer David | London | Plumber I want to have a table that contains: "Name" | "City" | "Occupation" | "Number" --------------------------------------- Amy | Berlin | Plumber | 2 Bob | Berlin | Plumber | 2 Carol | Berlin | Lawyer | 1 David | London | Plumber | 1 How does the SQL Query that creates the new columns have to look like? I want to actually create a new column in the database that I can access later.

    Read the article

  • Roles / Permissions framework for c#?

    - by mark smith
    Hi there, Does anyone know of a good framework to allow me design permission and roles against users. Basically allowing me to automatically check a user can do a certain thing, and then disabling or enabling menu items etc I am not really looking for asp.net security ... as i need to use it in my own service layer and clients both WEB and WPF will use it. I was hoping for something that allows me to create new roles and groups against users and then check what type of permissions a user has or a group has Any help really appreciated.. I am sure some kind of open source framework is available, well i was hoping not having to create my own Thanks

    Read the article

  • .NET library for generating javascript?

    - by Rune
    Do you know of a .NET library for generating javascript code? I want to generate javascript code based on information in my .NET application. I would like to be able to create an AST-like datastructure (using C#) and have it turned into valid javascript. I need to be able to create functions, statements, expressions etc., so I need something more than a JSON serializer - but I guess you could think of this as a (very) generalized JSON serializer. Do such libraries exist and if so, could you recommend any? Thank you.

    Read the article

  • uninitialized constant Active Scaffold rails 2.3.5

    - by Kiva
    Hi guy, I update my rails application 2.0.2 to 2.3.5. I use active scaffold for the administration part. I change nothing in my code but a problem is coming with the update. I have a controller 'admin/user_controller' to manage users. Here is the code of the controller: class Admin::UserController < ApplicationController layout 'admin' active_scaffold :user do |config| config.columns.exclude :content, :historique_content, :user_has_objet, :user_has_arme, :user_has_entrainement, :user_has_mission, :mp, :pvp, :user_salt, :tchat, :notoriete_by_pvp, :invitation config.list.columns = [:user_login, :user_niveau, :user_mail, :user_bloc, :user_valide, :group_id] #:user_description, :race, :group, :user_lastvisited, :user_nextaction, :user_combats_gagner, :user_combats_perdu, :user_combats_nul, :user_password, :user_salt, :user_combats, :user_experience, :user_mana, :user_vie config.create.link.page = true config.update.link.page = true config.create.columns.add :password, :password_confirmation config.update.columns.add :password, :password_confirmation config.create.columns.exclude :user_password, :user_salt config.update.columns.exclude :user_password, :user_salt config.list.sorting = {:user_login => 'ASC'} config.subform.columns = [] end end This code hasn't change with the update, but when I go in this page, I got this error: uninitialized constant Users /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/dependencies.rb:443:in `load_missing_constant' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/dependencies.rb:80:in `const_missing' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/dependencies.rb:92:in `const_missing' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/inflector.rb:361:in `constantize' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/inflector.rb:360:in `each' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/inflector.rb:360:in `constantize' /Users/Kiva/.gem/ruby/1.8/gems/activesupport-2.3.5/lib/active_support/core_ext/string/inflections.rb:162:in `constantize' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:28:in `reverse_matches_for' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:24:in `each' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:24:in `reverse_matches_for' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/extensions/reverse_associations.rb:11:in `reverse' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold/data_structures/column.rb:117:in `autolink?' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold.rb:107:in `links_for_associations' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold/data_structures/columns.rb:62:in `each' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold/data_structures/columns.rb:62:in `each' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold.rb:106:in `links_for_associations' /Users/Kiva/Documents/Projet-rpg/jeu/vendor/plugins/active_scaffold/lib/active_scaffold.rb:59:in `active_scaffold' /Users/Kiva/Documents/Projet-rpg/jeu/app/controllers/admin/user_controller.rb:11 I search since 2 days but I don't find the problem, can you help me please.

    Read the article

  • WaitForSingleObject( )

    - by Rakesh Agarwal
    I have got myself stuck into a really amazing issue here.The code is like as below. class A { public: A(){ m_event = CreateEvent(NULL, false, false, NULL); // create an event with initial value as non-signalled m_thread = _beginthread(StaticThreadEntry, 0, this); // create a thread } static void StaticThreadEntry(A * obj) { obj->ThreadEntry(); } void ThreadEntry(); }; void A::ThreadEntry() { WaitforSingleObject(m_event,INFINITE); } int main() { A a; SetEvent(m_event); // sets the event to signalled state which causes the running thread to terminate WaitForSingleObject(m_thread, INFINITE); // waits for the thread to terminate return 0; } Problem : When the above code is run,sometimes( 1 out of 5 ) it hangs and the control gets stuck in the call to WaitforSingleObject()( inside the main function ).The code always calls SetEvent() function to ensure that the thread would terminate before calling Wait() function. I do not see any reason why it should ever hang?

    Read the article

  • Problem with autocommit in ANT SQL task

    - by Alex Stamper
    I have an SQL script and want to apply it witn ANT task. This script clears out schema, creates new tables and views. The ANT defined task as follows: <sql driver="com.mysql.jdbc.Driver" url="jdbc:mysql://host:3306/smth" userid="smth" password="smth" expandProperties="false" autocommit="true" src="all.sql" > </sql> When this task launches, it shows in log that tables are cleared and created. But when it tries to create first view, it fails with: Failed to execute: CREATE VIEW component... AS SELECT component_raw.id AS MySQLSyntaxErrorException: Table 'component_raw' doesn't exist I have no idea why it fails here. Running this all.sql from MySQL query browser gives no errors. When I launched ANT with -v option, I didn't see any "COMMIT" messages.. Please, help to resolve the problem.

    Read the article

  • Data table with legends in JfreeChart

    - by TiNS
    Hi All, I am using JFreeChart to generate images. I am trying to create barchart like below. I am able to create it successfully without data table. I tried to get from the jfreechar forums and found this post). According to the post , its not supported by JfreeChart. Is it still not supported by jfreechart API ? If yes, can I use any other charting (open source) tool to generate chart with data table ? Thanks

    Read the article

  • How to increment counters based on a printed array

    - by Sam Liew
    I managed to developed a simple board of 5x5 using random numbers and array. Big achievement for someone like me! :) Now I have to increment the counters depending on the frequency of the numbers. If the value within 0-49 is printed..then nCounter++ If the value within 50-75 is printed..then pCounter++ something like that. The problem is that I don't know how to increase the counters based on the printed board. Here is the code: #include <stdio.h> #include <stdlib.h> #include <time.h> int main() { //Initialize Variables int randomNumber; int rows; int columns; int hdCounter =0; int hCounter = 0; int cCounter = 0; int pCounter = 0; int nCounter = 0; //Declare board size int board[5][5]; //size of board is 5 x 5 //Create the random number generator seed srand(time(NULL)); //Assign the random numbers from 1 - 25 into variable randomNumber //Create the rows for the board for ( rows = 1; rows <= 5 ; rows++ ) { //Create the colimns for the board for ( columns = 1; columns <= 5 ; columns++ ) { //Assign variable randomNumber into variable board randomNumber = rand() %100 + 1; board[rows][columns] = randomNumber; //print the board printf("%d\t", board[rows][columns]); //calculate the frequency of numbers on the printed board if (randomNumber >= 85 && randomNumber <= 100 ) hdCounter++; else if ( randomNumber >= 75 ) hCounter++; else if ( randomNumber >= 65 ) cCounter++; else if ( randomNumber >= 50 ) pCounter++; else if ( randomNumber >= 1 ) nCounter++; else continue; } //Newline after the end of 5th column. printf("\n\n"); } printf( "N \t P \t C \t H \t HD\n\n" ); printf("%d \t %d \t %d \t %d \t %d \t", nCounter, pCounter, cCounter, hCounter, hdCounter); }//end main I tried replacing randomNumber in the if-statement with board[rows][columns] but I seem to get the same undesired results.

    Read the article

  • problem in basic implementation of MVVM pattern - Services

    - by netmajor
    I watch some video and read articles about MVVM pattern and start thinking how should I implement it in my Silverlight app. So at first I create Silverlight application. I think that for clear view I create 3 folders: View - for each user control page in my app, ViewModel - for c# class which will querying date and Model- Entity Data Model of my SQL Server or Oracle Database. And now I am confused, cause I want to implement *WCF/RIA Services/Web services* in my project. In which folder should I put in class of services? I see in examples that Services take date and filtering it and then output data was binding in View - so It looks as ViewModel. But I was sure that someone use Services in Model and that I want to do. But how? Can someone explain me implementing Services as Model? Is my point of view at MVVM is correctly?

    Read the article

  • PrincipalPermission - roles seperate from permissions

    - by Leblanc Meneses
    I've been using PrincipalPermission for a while in wcf services. [PrincipalPermission(SecurityAction.Demand, Role = SecurityRoles.CanManageUsers)] although now i have a requirement to simplify roles by business unit. - currently aspnet_roles has fine grained can* permissions. Here is my approach and wanted to see if anyone can provide feedback, code review before i implement my suggestion. 1) aspnet_roles - business unit role 2) create permission table and Role_Permission table and User_Permission table (many to many) 3) create custom CodeAccessSecurityAttribute + that looks at new tables [CustomPermissionCheck(Security.Demand, HasPermission="can*")] first iteration i'll statically new the dependent repository.. ideally i would like an aop style attribute that has repository injected IPermissionRepository.HasPermission(...); If i approach new aop way i probably will stop inheriting from CodeAccessSecurityAttribute -- what do the security guys have to say about this? has anyone else solved this, is there something in the framework that i've missed?

    Read the article

  • Using an IBAction method when it is not called from an action?

    - by cannyboy
    Are there any issues when using IBAction when it is not actually called from a user's action? If you have an action like -(IBAction)sayHello:(id)sender; You can call it from within your class like: [self sayHello:@"x"] The @"x" doesn't do anything, it just fills in for the sender. You can actually create an IBAction method without (id)sender -(IBAction)sayHello; and call it from both user's actions and from within the code, but then you won't get any useful sender info from the interface. What's the 'correct' way of filling in for the sender, when calling from the code? And can you create sender info to send when it's called from within the code? Just trying to figure it out.

    Read the article

  • Creating multiple markers in Google Maps using XML

    - by Jessica Stanley
    I'm almost sure this question has been asked before, but for the love of me I just can't find the answer anywhere. Basically what I want to do is create multiple markers on a custom Google Map I'm building. I already have an XML file with the coordinates (lat/lng) and title of each item. I'd like to take the data from the XML file and use it to create markers on the map. I've found how to do this using KML files and MySQL/PHP, but I need to know how to do it in Javascript. One more thing: I have a .xml file of my own, so it won't be like I'll be getting the data from a webpage because I believe (from research I've done today) that the code for that may be different. If anyone knows if this has been posted somewhere else before, could you please direct me there? I've literally been searching all day, this is my last resort. Thanks a ton!!!

    Read the article

  • Are Symphony and CakePHP too slow to be usable?

    - by Aziz Light
    Until now, I have always said that CakePHP is too bloated and slow. I don't really know that, I just saw "some" benchmarks. What I really want to know, is that if those two frameworks (Symfony and CakePHP) are too slow to be usable in a way that the user will get frustrated. I already know that those frameworks are slower than other alternatives, but that's not the question. I ask the question because I want to create a project management web application and I still hesitate between a couple frameworks. I've had some trouble learning Zend, but imho I haven't tried hard enough. So in conclusion, in addition to the first question above, I would like to ask another question: If I want to create a project management tool (which is a pretty big project), which of the following should you suggest, considering the developement time, the speed of the resulting application, and the robustness of the final product: Symphony CakePHP Zend Framework Also I should mention that I don't know any of those frameworks, and that I want to learn one of them (at least).

    Read the article

  • Monotone-increasing Version Number based on Mercurial Commits

    - by Isaac
    When I was using subversion for the code for an application, I could append a period and the result of svnversion to the version number to create a unique and monotone-increasing version number and also be guaranteed that any check-out of the same revision of the code would generate the same version number. In Mercurial, because revision numbers are not necessarily consistent across clones, the local revision number is not suitable. The hash is appropriately unique and consistent, but does not create a number that is monotone-increasing. How can I generate a suitable number to append to the version number based on the Mercurial repository commits?

    Read the article

  • Seam cache provider with ehcache null

    - by Cateno Viglio
    Hi every one, I'm trying to configure seam/ehcache following the tutorial from jboss page: http://docs.jboss.org/seam/2.1.2/reference/en-US/html/cache.html I put the ehcache.1.2.3.jar in project.ear/lib and injected CacheProvider as especified, but the CacheProvider always return null. The documentation doesn't show any aditional configuration for ehcache, just for jboss cache. I am probably doing something wrong, it's impossible be so easy :). besides put the jar in /lib, i created the following seam component to test: @Scope(ScopeType.SESSION) @Name("cacheBean") public class CacheSeamBean implements java.io.Serializable { @In(required=false, create=true) private EntityManager em; @Logger private Log log; @In private Events events; @In CacheProvider cacheProvider; Boolean blLoaded = Boolean.FALSE; @Create public void buscar() { if (!blLoaded){ List<Parametro> lstParametro = em.createQuery("select p from Parametro p").getResultList(); for (Parametro parametro : lstParametro){ cacheProvider.put(parametro.getCodigo(), parametro.getValor()); } blLoaded= Boolean.TRUE; } } } Thanks

    Read the article

  • SQL: select random row from table where the ID of the row isn't in another table?

    - by johnrl
    I've been looking at fast ways to select a random row from a table and have found the following site: http://74.125.77.132/search?q=cache:http://jan.kneschke.de/projects/mysql/order-by-rand/&hl=en&strip=1 What I want to do is to select a random url from my table 'urls' that I DON'T have in my other table 'urlinfo'.The query I am using now selects a random url from 'urls' but I need it modified to only return a random url that is NOT in the 'urlinfo' table. Heres the query: SELECT url FROM urls JOIN (SELECT CEIL(RAND() * (SELECT MAX(urlid) FROM urls ) ) AS urlid ) AS r2 USING(urlid); And the two tables: CREATE TABLE urls ( urlid INT NOT NULL AUTO_INCREMENT PRIMARY KEY, url VARCHAR(255) NOT NULL, ) ENGINE=INNODB; CREATE TABLE urlinfo ( urlid INT NOT NULL PRIMARY KEY, urlinfo VARCHAR(10000), FOREIGN KEY (urlid) REFERENCES urls (urlid) ) ENGINE=INNODB;

    Read the article

< Previous Page | 443 444 445 446 447 448 449 450 451 452 453 454  | Next Page >