Search Results

Search found 44742 results on 1790 pages for 'create'.

Page 449/1790 | < Previous Page | 445 446 447 448 449 450 451 452 453 454 455 456  | Next Page >

  • How to run Jquery constructor from own function?

    - by Invidian
    I need to create a function which will returning jQuery.Color object and i have no idea how to do it. Here is code example function newcolor () { var obj = new $.Color( 'rgb(0,0,0)' ); return obj;} var foo = newcolor(); foo.red(); Edit: My full code: function my (element,a,b,c){ //class my this.target = $(elem); this.new_color = function (a,b,c) { return new $.Color( 'rgb('+a+','+b+','+c+')'); } this.base_color = new_color (a,b,c); this.colorize = function () ( this.target.css({ background-color: new_color }); } var div = new My($('foo'),0,0,0); div.new_color(255,255,255); div.colorize(); My goal is to create class which can hold jquery element and operate on it. Now I'm stuck on returning $.Color().

    Read the article

  • difference between DataContract attribute and Serializable attribute in .net

    - by samar
    I am trying to create a deep clone of an object using the following method. public static T DeepClone<T>(this T target) { using (MemoryStream stream = new MemoryStream()) { BinaryFormatter formatter = new BinaryFormatter(); formatter.Serialize(stream, target); stream.Position = 0; return (T)formatter.Deserialize(stream); } } This method requires an object which is Serialized i.e. an object of a class who is having an attribute "Serializable" on it. I have a class which is having attribute "DataContract" on it but the method is not working with this attribute. I think "DataContract" is also a type of serializer but maybe different than that of "Serializable". Can anyone please give me the difference between the two? Also please let me know if it is possible to create a deepclone of an object with just 1 attribute which does the work of both "DataContract" and "Serializable" attribute or maybe a different way of creating a deepclone? Please help!

    Read the article

  • Creating a list of integers in XML for android.

    - by Leif Andersen
    I would like to create a list of Integers in the /res folder of an android project. However, I want those integers to point resources in /res/raw. So for example, I would like something like this: <?xml version="1.0" encoding="utf-8"?> <resources> <integer-array name="built_in_sounds"> <item>@raw/sound</item> </integer-array> </resources> But id doesn't look like I can do that, is there any way to do this? Or should I just create the list in a java class? Thank you

    Read the article

  • Possible: Set Operations on Disparate Maps with Same Key Type?

    - by Catskul
    Let's say I have two maps: typedef int Id; std::map<Id, std::string> idToStringMap; std::map<Id, double> idToDoubleMap; And let's say I would like to do a set operation on the keys of the two maps. Is there an easier way to do this than to create a custom "inserter" iterator? such that I could do something like: std::set<Id> resultSet; set_difference( idToStringMap.begin(), idToStringMap.end(), idToDoubleMap.begin(), idToDoubleMap.end(), resultSet.begin() ); My experimentation results imply that it will be necessary to create a custom inserter and perhaps a custom key comparer to do this, but I want for some insight/shortcut before doing so.

    Read the article

  • A code using SharePoint classes doesn't run on systems not having SharePoint installed

    - by Manish
    I have a window application which uses SP classes to create a site. I works fine on a system having Windows Server 2003 R2 with sharepoint installed. But it doesn't work on a system having XP installed and SharePoint not installed. The fact is that both of these systems are on a intranet. So I assumed that the NON-SP system would be able to run the code and create a site on the system having SP installed if all the required parameters (like serverLocation, domain, username, password) are provided. I did copied the DLLs to these NON-SP system and referenced them to build the project: Microsoft.SharePoint.dll microsoft.sharepoint.portal.dll Microsoft.SharePoint.Publishing.dll But this too didn't worked. What am I missing? Is my assumption wrong?

    Read the article

  • jQuery image grid effect

    - by anon
    I have an image sitting on a page that I want to create a grid type overlay (that covers the image with a black fill) which will be partitioned into 50x50 pixels (what ever size, tbh) squares. The squares on the grid will then flip over, one at a time, in random positions revealing the image below it. The only way I can think of accomplishing this would be to create a whole bunch of grid squares and overlay them on the image with jQuery, then flip each image square individually. This, though, would be a pain in the ass. Doing this all dynamically in jQuery is what I'm hoping to accomplish. Any ideas?

    Read the article

  • Ember multiple property changes but want to trigger single event

    - by Ankur Agarwal
    I have a ArrayController for date picker with properties to and from. Now when user selects a new date range from the UI both to and from value changes. So a function which observers on to and from is trigger twice for a single change in date range. I want to trigger the function only one every date range change. Any suggestions how to do that with ember app = Ember.Application.create(); app.Time = Ember.ArrayController.create({ to: null, from: null, rootElement: "#time", debug1: function() { this.set('to', 1); this.set('from', 2); }, debug2: function() { this.setProperties( { 'to': 3, 'from': 4 }); }, debug3: function() { this.beginPropertyChanges(); this.set('to', 5); this.set('from', 6); this.endPropertyChanges(); }, search: function() { alert('called'); }.observes('to', 'from') }); View in JS Fiddle

    Read the article

  • Routing a location that matches one controller to another

    - by Luca Romagnoli
    Hi I have a controller named "places" with some actions like "view", "new", "create" When a user goes to mysite.com/places I want to execute the action "show" of another controller called "cores" So I've put this in the routes.rb file: map.connect '/:id/show', :controller => "cores", :action => "show" But it doesn't work. I receive this error: Processing PlacesController#show (for 127.0.0.1 at 2010-04-16 00:52:07) [GET] ActionController::UnknownAction (No action responded to show. Actions: admin_denied, admin_required, auto_complete_for_location, auto_complete_for_name, change_location, create, create_facebook_session, create_facebook_session_with_secret, edit, exist, facebook_params, facebook_session, facebook_session_expired, facebook_session_parameters, get_form, is_admin?, new, one_or_true, redirect_to, render_publisher_error, render_publisher_interface, render_publisher_response, set_facebook_session, top_redirect_to, update, wants_interface?, and zero_or_false): How can i do to map that action in another controller? thanks

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • C++: set of C-strings

    - by Nicholas
    I want to create one so that I could check whether a certain word is in the set using set::find However, C-strings are pointers, so the set would compare them by the pointer values by default. To function correctly, it would have to dereference them and compare the strings. I could just pass the constructor a pointer to the strcmp() function as a comparator, but this is not exactly how I want it to work. The word I might want to check could be part of a longer string, and I don't want to create a new string due to performance concerns. If there weren't for the set, I would use strncmp(a1, a2, 3) to check the first 3 letters. In fact, 3 is probably the longest it could go, so I'm fine with having the third argument constant. Is there a way to construct a set that would compare its elements by calling strncmp()? Code samples would be greatly appreciated.

    Read the article

  • Clean Up Controller, Update Item Quantity within Cart

    - by Karl Entwistle
    Hi guys I was wondering if anyone could help me out, I need to clean up this controller as the resulting code to simply update an items quantity if it already exists seems way too complex. class LineItemsController < ApplicationController def create @product = Product.find(params[:product_id]) if LineItem.exists?(:cart_id => current_cart.id) item = LineItem.find(:first, :conditions => [ "cart_id = #{@current_cart.id}"]) LineItem.update(item.id, :quantity => item.quantity + 1) else @line_item = LineItem.create!(:cart => current_cart, :product => @product, :quantity => 1, :unit_price => @product.price) flash[:notice] = "Added #{@product.name} to cart." end redirect_to root_url end end ` As always any help is much appreciated, the code should be fairly self explanatory, thanks :) PS posted it here as well as it looks a bit funny on here http://pastie.org/994059

    Read the article

  • iPhone SDK - CGBitmapContextCreate

    - by nax_
    Hi, I would like to create an image of my own. I already know its width (320*2 = 640) and height (427). So I have some raw data : unsigned char *rawImg = malloc(height * width * 4 *2 ); Then, I will fill it :) Then, I have to do something like that to get a bitmap and return a (UIImage *) : ctx = CGBitmapContextCreate(rawImg,width*2,height,8, ???, ???, kCGImageAlphaPremultipliedLast); UIImage * imgFinal = [UIImage imageWithCGImage:CGBitmapContextCreateImage(ctx)]; CGContextRelease(ctx); return imgFinal; But I don't know how to create my context ctx, as you can see with the "???", even tough I read the documentation... Please help ! Thanks :)

    Read the article

  • Subversion for version control

    - by Gabriel Parenza
    Hi, I am working on an application whose primary purpose would be to provide source control management. My idea is to use to SVNKit for file check-out and check-in. However, while working with SVNKit, I realised it does not have the speed I was looking for. For instance, whenever developers create a ChangeRequest, which can encompass change in 3-40 files, I have to create a directory structure distributed across 32 folders. Doing so takes around 50 seconds, Another instance is that after creating change request developers can add files to the request. Copying even a single file from Trunk to branch takes around 6-7 secs. My question is has anyone had experience like this and what did you do to improve the performance? Moreover, is my approach correct? NOTE: I am using "http" protocol and can't use "svn" protocol.

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Formating a text in a table cell with PHPWord e.g. bold, font, size e.t.c

    - by alphy
    I have the code snippet below //create a new word document $word= new PHPWord(); //create potrait orientation $section=$word->createSection(); $table = $section->addTable(); $word->addFontStyle('rStyle', array('bold'=>true, 'italic'=>true, 'size'=>16)); //header row $table->addRow(400, array('bgColor'=>'dbdbdb')); $table->addCell(2000, array('bgColor'=>'dbdbdb'))->addText('Cell 1','rStyle'); $table->addCell(3500, array('bgColor'=>'dbdbdb'))->addText('Cell 1'); $table->addCell(1500, array('bgColor'=>'dbdbdb'))->addText('Cell 1','rStyle'); $table->addCell(2000, array('bgColor'=>'dbdbdb'))->addText('Cell 1'); // Save File $objWriter = PHPWord_IOFactory::createWriter($word, 'Word2007'); $objWriter->save('Text.docx'); echo 'Text.docx created successfully'; } How can i add text formatting to a cell value to bold, italic, font-size etc, I have tried as shown above but it does not work

    Read the article

  • Knowledge for writing a compiler for Win32

    - by saf
    I have created an interpreter for my programming language (educational) and now I'd like to go one step further and create a compiler for it. I know that this is pretty hard work. What I already know is: I need to translate my input language to assembler A lot, isn't it? Now what I don't know is: What assembler do I need to create Win32 PE executables like, for example, Visual Studio does? What about file headers? I'd prefer not to use MASM but it seems like I'll have to. How to combine the assembler with my compiler?

    Read the article

  • C# Drawing Oracle Spatial Geometries

    - by Keeper
    I need to create a simple app which can display geometries from Oracle Spatial in C#. These geometries are exported from AutoCAD Map 3D 2010 to Oracle Spatial. I need to pan, zoom, manage layers of these objects, events (like right click to popup a contextual menu, potentially different for every object), creating/deleting points (maybe also other polygons): a sort of simple AutoCAD interface. Should I look for an AutoCAD OEM license? Is there a drawing framework which can handle this or do I need to create my own?

    Read the article

  • Android v1.5 w/ browser data storage

    - by Sirber
    I'm trying to build an offline web application which can sync online if the network is available. I tryed jQuery jStore but the test page stop at "testing..." whitout result, then I tryed Google Gears which is supposed to be working on the phone but it gears is not found. if (window.google && google.gears) { google.gears.factory.getPermission(); // Database var db = google.gears.factory.create('beta.database'); db.open('cominar-compteurs'); db.execute('create table if not exists Lectures' + ' (ID_COMPTEUR int, DATE_HEURE timestamp, kWh float, Wmax float, VAmax float, Wcum float, VAcum float);'); } else { alert('Google Gears non trouvé.'); } the code does work on Google Chrome v5.

    Read the article

  • How to retain the state of a activity that has a GLSurfaceView

    - by user348639
    My problem is our game can switch into menu and setting mode instantly but it will need 4-6 seconds to load texture, init GL render mode eventually I just used 6 simple textures to create 6 sprites in game. Please help me answer two questions: 1. How can I preload our assets in android os to start our game quicker? 2. In order to use a trick to create instance switch between activity, how can I retain my activity with GLSurfaceView state? I order to help you understanding my situation, please read the following code: The game using 3 activities as you can see in following configuration: <application android:label="@string/app_name" android:icon="@drawable/icon" android:allowBackup="true"> <activity android:name=".Menu" android:screenOrientation="portrait" android:theme="@android:style/Theme.NoTitleBar.Fullscreen" android:launchMode="singleTop"> <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> <activity android:name=".ReTouch" android:screenOrientation="portrait" /> <activity android:name=".Preference" android:screenOrientation="portrait" android:theme="@android:style/Theme.NoTitleBar.Fullscreen" /> </application> My .ReTouch class is a class that extended from RokonActivity (I am using rokon engine for my game), this engine will create a GLSurefaceView to render my game in OpenGL ES You can get RokonAcitivity's source code here: http://code.google.com/p/rokon/source/browse/tags/release/1.1.1/src/com/stickycoding/Rokon/RokonActivity.java public class ReTouch extends RokonActivity { public static final int REPLAY_DELAY_INTERVAL = 1000; private ReTouchGameBoard reTouchGame; and .Menu, .Preference are two normal standard activity in an android application. I am using this method to start and switch between activities: playButton.setOnClickListener(new OnClickListener() { public void onClick(View v) { soundPool.play(soundId, 1, 1, 1, 0, 1); startActivity(new Intent(Menu.this, ReTouch.class)); } }); settingButton.setOnClickListener(new OnClickListener() { public void onClick(View v) { soundPool.play(soundId, 1, 1, 1, 0, 1); startActivity(new Intent(Menu.this, Preference.class)); } }); quitButton.setOnClickListener(new OnClickListener() { public void onClick(View v) { soundPool.play(soundId, 1, 1, 1, 0, 1); finish(); } });

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

  • Optimize date query for large child tables: GiST or GIN?

    - by Dave Jarvis
    Problem 72 child tables, each having a year index and a station index, are defined as follows: CREATE TABLE climate.measurement_12_013 ( -- Inherited from table climate.measurement_12_013: id bigint NOT NULL DEFAULT nextval('climate.measurement_id_seq'::regclass), -- Inherited from table climate.measurement_12_013: station_id integer NOT NULL, -- Inherited from table climate.measurement_12_013: taken date NOT NULL, -- Inherited from table climate.measurement_12_013: amount numeric(8,2) NOT NULL, -- Inherited from table climate.measurement_12_013: category_id smallint NOT NULL, -- Inherited from table climate.measurement_12_013: flag character varying(1) NOT NULL DEFAULT ' '::character varying, CONSTRAINT measurement_12_013_category_id_check CHECK (category_id = 7), CONSTRAINT measurement_12_013_taken_check CHECK (date_part('month'::text, taken)::integer = 12) ) INHERITS (climate.measurement) CREATE INDEX measurement_12_013_s_idx ON climate.measurement_12_013 USING btree (station_id); CREATE INDEX measurement_12_013_y_idx ON climate.measurement_12_013 USING btree (date_part('year'::text, taken)); (Foreign key constraints to be added later.) The following query runs abysmally slow due to a full table scan: SELECT count(1) AS measurements, avg(m.amount) AS amount FROM climate.measurement m WHERE m.station_id IN ( SELECT s.id FROM climate.station s, climate.city c WHERE -- For one city ... -- c.id = 5182 AND -- Where stations are within an elevation range ... -- s.elevation BETWEEN 0 AND 3000 AND 6371.009 * SQRT( POW(RADIANS(c.latitude_decimal - s.latitude_decimal), 2) + (COS(RADIANS(c.latitude_decimal + s.latitude_decimal) / 2) * POW(RADIANS(c.longitude_decimal - s.longitude_decimal), 2)) ) <= 50 ) AND -- -- Begin extracting the data from the database. -- -- The data before 1900 is shaky; insufficient after 2009. -- extract( YEAR FROM m.taken ) BETWEEN 1900 AND 2009 AND -- Whittled down by category ... -- m.category_id = 1 AND m.taken BETWEEN -- Start date. (extract( YEAR FROM m.taken )||'-01-01')::date AND -- End date. Calculated by checking to see if the end date wraps -- into the next year. If it does, then add 1 to the current year. -- (cast(extract( YEAR FROM m.taken ) + greatest( -1 * sign( (extract( YEAR FROM m.taken )||'-12-31')::date - (extract( YEAR FROM m.taken )||'-01-01')::date ), 0 ) AS text)||'-12-31')::date GROUP BY extract( YEAR FROM m.taken ) The sluggishness comes from this part of the query: m.taken BETWEEN /* Start date. */ (extract( YEAR FROM m.taken )||'-01-01')::date AND /* End date. Calculated by checking to see if the end date wraps into the next year. If it does, then add 1 to the current year. */ (cast(extract( YEAR FROM m.taken ) + greatest( -1 * sign( (extract( YEAR FROM m.taken )||'-12-31')::date - (extract( YEAR FROM m.taken )||'-01-01')::date ), 0 ) AS text)||'-12-31')::date The HashAggregate from the plan shows a cost of 10006220141.11, which is, I suspect, on the astronomically huge side. There is a full table scan on the measurement table (itself having neither data nor indexes) being performed. The table aggregates 237 million rows from its child tables. Question What is the proper way to index the dates to avoid full table scans? Options I have considered: GIN GiST Rewrite the WHERE clause Separate year_taken, month_taken, and day_taken columns to the tables What are your thoughts? Thank you!

    Read the article

  • How entity edit URL from within plug-in in MS Dyanmics CRM 4.0

    - by Greg McGuffey
    I would like to have a workflow create a task, then email the assigned user that they have a new task and include a link to the newly created task in the body of the email. I have client side code that will correctly create the edit URL, using the entities GUID and stores it in a custom attribute. However, when the task is created from within a workflow, the client script isn't run. So, I think a plug-in should work, but I can't figure out how to determine the URL of the CRM installation. I'm authoring this in a test environment and definitely don't want to have to change things when I move to production. I'm sure I could use a config file, but seems like the plug-in should be able to figure this out at runtime. Anyone have any ideas how to access the URL of the crm service from within a plug-in? Any other ideas? Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 445 446 447 448 449 450 451 452 453 454 455 456  | Next Page >