Search Results

Search found 1119 results on 45 pages for 'jitendra kumar'.

Page 10/45 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • em vs px... for mobile browsers...

    - by jitendra
    For desktop browser all modern browser uses Zoom functionality so we can use PX but if same site can be seen on mobile then would px not be good for zooming in mobile browsers. or use of px is also fine for mobile browsers. even if we don't care for IE 6 , should we use em in place of px still if we are not making different site for mobile, same site will be seen on both desktop and mobile phones (iphone, blackberry, windows mobile, opera mini, android etc?

    Read the article

  • How to show linked file size and type in title attributes using jquery?

    - by jitendra
    For example: Before <a target="_blank" href="http://www.adobe.com/devnet/acrobat/pdfs/reader_overview.pdf"> Adobe Reader JavaScript specification </a> Bcoz file is PDF so title should be title="PDF, 93KB, opens in a new window" <a title="PDF, 93KB, opens in a new window" target="_blank" href="http://www.adobe.com/devnet/acrobat/pdfs/reader_overview.pdf" > Adobe Reader JavaScript specification </a>

    Read the article

  • Why browser vendors make their own css properties?

    - by jitendra
    Why browser vendors make their own css properties, even they know these will not pass the w3c validation? What is the purpose? is for their own testing, or for web developers, ot to demonstrate browser capabilities to the world and to the W3C organizations and to CSS development team of W3C? is it like a beta version of demonstration? if i use any browser specific for now can they remove that property's support from future versions.will i have to edit my css in future for example: https://developer.mozilla.org/en/CSS_Reference/Mozilla_Extensions

    Read the article

  • Which alt text is best for screen readers for example "smiling kid"?

    - by jitendra
    Which would be good write ALT text for a photo of kid which is smiling and sitting in garden? This alt="Photo of smiling kid sitting in the garden" or this alt="Photo of smiling kid" or this alt="Smiling kid sitting in the garden" or this alt="Smiling kid" my purpose is to ask this question, I want to know should we include "Photo of..." in every alt text and And how much we should describe the photo in alt text.

    Read the article

  • How to upgrade self-hosted wordpress and it's plugins of live site without facing any trouble?

    - by jitendra
    I have to upgrade a running wordpress site's wordpress CMS and some installed plugins.and some plugins which i want to upgrade has been modified before to achieve something. http://is.gd/b5j9h How to upgrade Wordpress to latest without loosing anything, any post, comments? What precautions should i take? How should i take backup of all things? Should i take backup of database also? How to upgraded modified plugins without loosing functionality?

    Read the article

  • How to show title attributes onfocus using jquery?

    - by jitendra
    By default in all browser title attributes only shows on mouse over. I want to show on keyboard focus also. I know this is not possible through only HTML and CSS. JavaScript will be need. so i jquery in almost all projects. so i need a jquery solution to show title on onfocus. <a title="this is title" href="#">Websites</a>

    Read the article

  • Is there any project estimation tool to give estimate for web design/ development work?

    - by jitendra
    Is there any project estimation tool which gives estimates for web design/ development work? I don't have to calculate Price just want to calculate estimated time. Just for example, for things like: Page creation (layout in XHTML) CSS creation Content creation (Word to HTML, including images in some pages) Bulk PDF upload PHP Script for Form Testing all pages I need like Items Quantity Time for each task(min) Estimated total (in hour) PDF upload x 30 = 2 min = 60 Min pages with images x 30 = 15 min for each = 60 Min Is there any simple JQuery calculator power with JQuery? Where we can add add/remove custom thing to calculate time? Or any other free online/offline tool ?

    Read the article

  • Why WCAG made 3 level "A", "AA" and "AAA"?

    - by jitendra
    What is the purpose of making 3 priority level by WCAG? is it like? If client not paying extra or if we don't have much time then go for A If client paying then or if we have time to make site compatible go for at least AA If client paying and needed according to govt. rules then go for AAA If we are making site then which level we should we try to achieve, or we should do only on client request? Although i found these definitions on this site but these are confusing for me • Priority 1: For all users to access the Web content and for Web developers to attain Conformance level “A”, these requirements must be satisfied. • Priority 2: These requirements should be satisfied by the Web developers so that no group finds it difficult to access the Web content and so as to attain Conformance level “AA”. • Priority 3: These requirements may be satisfied by the Web developers to facilitate access to Web content for some groups and attain Conformance level “AAA”.

    Read the article

  • Which CSS editor can give formatting like this in one shot automatically?

    - by jitendra
    Which free (offline) CSS tool can give formatting like this in one shot automatically? using any keyboard shortcut of from any command of IDE example This (it can be any type of formatting) #proceed_form ol, #demo_form ol { list-style:none; margin:0; padding:0} #proceed_form ol li, #demo_form ol li { padding:2px 0; margin:0; line-height:normal; height:18px} #proceed_form ol li label, #demo_form ol li label { display:inline-block; width:195px;} into like this #proceed_form ol, #demo_form ol { list-style: none; margin: 0; padding: 0 } #proceed_form ol li, #demo_form ol li { padding: 2px 0; margin: 0; line-height: normal; height: 18px } #proceed_form ol li label, #demo_form ol li label { display: inline-block; width: 195px; } Can we achieve this type of formatting in Dreamweaver? or it not possible in dreamweaver then in any other tool?

    Read the article

  • How to get cross browser <sup> without intrerupting line height?

    - by jitendra
    How to get cross browser <sup> without interrupting line height? I tried vertical-align:top but it looks ok in FF 3.6 and IE but not in FF 3.0. How to get consistent in size (size of superlative text) and position of <sup> identical in all browsers without interrupting line height. I'm using <sup> to indicate footnote? not to show power Stackoverflow is killing10 experts-exchange

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Which CSS editor can give nested formatting like this in one shot automatically?

    - by jitendra
    Which free (offline) CSS tool can give formatting like this in one shot automatically? using any keyboard shortcut of from any command of IDE example This (it can be any type of formatting) #proceed_form ol, #demo_form ol { list-style:none; margin:0; padding:0} #proceed_form ol li, #demo_form ol li { padding:2px 0; margin:0; line-height:normal; height:18px} #proceed_form ol li label, #demo_form ol li label { display:inline-block; width:195px;} into like this #proceed_form ol, #demo_form ol { list-style: none; margin: 0; padding: 0 } #proceed_form ol li, #demo_form ol li { padding: 2px 0; margin: 0; line-height: normal; height: 18px } #proceed_form ol li label, #demo_form ol li label { display: inline-block; width: 195px; } Can we achieve this type of formatting in Dreamweaver? or it not possible in dreamweaver then in any other tool?

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >