Search Results

Search found 1052 results on 43 pages for 'sunil kumar'.

Page 10/43 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Facebook events api: Event member (FQL)

    - by sunil-khedar
    I am fetching the event members for facebook events. Till yesterday I was getting the proper counts of members of an event. But suddenly the counts have following issues: For lot of plans on every consecutive request, I am getting random number of members. Strange issue. Seems facebook servers are not synced properly or something similar. Earlier for the same query string (mentioned below), I was getting the correct counts. But now the count is much less. It seems that at least for a few events now they are sending only the members who are connected with our application (we are using facebook connect). Example: for the following query currently I am getting "31" members. But on event page members count is much more. FQL: FB.Facebook.apiClient.fql_query('SELECT uid, eid, rsvp_status FROM event_member WHERE eid=336671213618', function(result, error){alert(result.length);}); Event page: http://www.facebook.com/event.php?eid=109411842404023 Is there any recent change in facebook API or policies? Thanks in advance.

    Read the article

  • Random number Generator in C#

    - by Sunil
    Why do i need to create an instance of Random class, if i want to create a random number between 1 and 100 ....like Random rand = new Random(); rand.Next(1,100); Is there any static function of Random class to do the same? like... Random.Next(1,100); I don't want to create an instance unnecessarily

    Read the article

  • WCF Service in Azure with ClaimsIdentity over SSL

    - by Sunil Ramu
    Hello , Created a WCF service as a WebRole using Azure and a client windows application which refers to this service. The Cloud Service is refered to a certificate which is created using the "Hands On Lab" given in windows identity foundation. The Web Service is hosted in IIS and it works perfect when executed. I've created a client windows app which refers to this web service. Since WIF Claims identity is used, I have a claimsAuthorizationManager Class, and also a Policy class with set of defilned policies. The Claims is set in the web.config file. When I execute the windows app as the start up project, the app prompts for authentication, and when the account credentials are given as in the config file, it opens a new "Windows Card Space" Window and Says "Incoming Policy Failed". When I close the window the System throws and Exception The incoming policy could not be validated. For more information, please see the event log. Event Log Details Incoming policy failed validation. No valid claim elements were found in the policy XML. Additional Information: at System.Environment.get_StackTrace() at Microsoft.InfoCards.Diagnostics.InfoCardTrace.BuildMessage(InfoCardBaseException ie) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.TraceAndLogException(Exception e) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.ThrowHelperError(Exception e) at Microsoft.InfoCards.InfoCardPolicy.Validate() at Microsoft.InfoCards.Request.PreProcessRequest() at Microsoft.InfoCards.ClientUIRequest.PreProcessRequest() at Microsoft.InfoCards.Request.DoProcessRequest(String& extendedMessage) at Microsoft.InfoCards.RequestFactory.ProcessNewRequest(Int32 parentRequestHandle, IntPtr rpcHandle, IntPtr inArgs, IntPtr& outArgs) Details: System Provider [ Name] CardSpace 3.0.0.0 EventID 267 [ Qualifiers] 49157 Level 2 Task 1 Keywords 0x80000000000000 EventRecordID 6996 Channel Application EventData No valid claim elements were found in the policy XML. Additional Information: at System.Environment.get_StackTrace() at Microsoft.InfoCards.Diagnostics.InfoCardTrace.BuildMessage(InfoCardBaseException ie) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.TraceAndLogException(Exception e) at Microsoft.InfoCards.Diagnostics.InfoCardTrace.ThrowHelperError(Exception e) at Microsoft.InfoCards.InfoCardPolicy.Validate() at Microsoft.InfoCards.Request.PreProcessRequest() at Microsoft.InfoCards.ClientUIRequest.PreProcessRequest() at Microsoft.InfoCards.Request.DoProcessRequest(String& extendedMessage) at Microsoft.InfoCards.RequestFactory.ProcessNewRequest(Int32 parentRequestHandle, IntPtr rpcHandle, IntPtr inArgs, IntPtr& outArgs)

    Read the article

  • Iphone web application

    - by Sunil
    Hi All, I am developing a iphone web application. I already have a website designed using php and mysql. how I can convert this website to compatile for iphone. pls share your thoughts. Thanks

    Read the article

  • MySQLNonTransientConnectionException in jdbc program at run time

    - by Sunil Kumar Sahoo
    Hi I have created jdbc mysql connection. my program works fine for simple execution of query. But if i run the same program for more than 10 hour and execute query then i receives the following mysql exception. I have not used close() method anywhere. i created database connection and opened it forever and always execute query. there is no where that i explicitly mentioned timeout for connection. i am unable to identify the problem com.mysql.jdbc.exceptions.jdbc4.MySQLNonTransientConnectionException: Connection.close() has already been called. Invalid operation in this state. at sun.reflect.NativeConstructorAccessorImpl.newInstance0(Native Method) com.mysql.jdbc.exceptions.jdbc4.MySQLNonTransientConnectionException: No operations allowed after statement closed. at sun.reflect.NativeConstructorAccessorImpl.newInstance0(Native Method) sample code for database connection: String driver = PropertyReader.getDriver(); String url = dbURLPath; Class.forName(driver); connectToServerDB = DriverManager.getConnection(url); connectToServerDB.setAutoCommit(false);

    Read the article

  • END_TAG exception while calling WCF WebService from Android using KSOAP2?

    - by sunil
    Hi, I am trying to call a WCF Web Service from Android using KSOAP2 library. But I am getting this END_TAG exception. I have followed this thread to call WCF Web Service but still no result. I am passing "urn:TestingWcf/GetNames" as SOAP_ACTION, does this causes problem in Android since the error occurs at the statement "aht.call(SOAP_ACTION, envelope)" where aht is AndroidHttpTransport class object. Can someone let me know what the problem may be? import org.ksoap2.*; import org.ksoap2.serialization.*; import org.ksoap2.transport.*; import android.app.Activity; import android.os.Bundle; import android.widget.TextView; public class Ksoap2Test extends Activity { private static final String METHOD_NAME = "GetNamesJsonWithParam" private static final String NAMESPACE = "http://tempuri.org/"; private static final String URL = "http://192.168.3.61/BattleEmpire.Service/TestingWcf.svc/basic"; final String SOAP_ACTION = "urn:TestingWcf/GetNamesJsonWithParam"; TextView tv; StringBuilder sb; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); tv = new TextView(this); sb = new StringBuilder(); call(); tv.setText(sb.toString()); setContentView(tv); } public void call() { try { SoapObject request = new SoapObject(NAMESPACE, METHOD_NAME); request.addProperty("imran", "Qing"); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER11); envelope.dotNet = true; envelope.setOutputSoapObject(request); System.out.println("Request " + envelope.toString()); //HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); AndroidHttpTransport aht = new AndroidHttpTransport(URL); aht.call(SOAP_ACTION, envelope); //aht.debug = true; /*HttpTransportSE androidHttpTransport = new HttpTransportSE(URL); androidHttpTransport.call(SOAP_ACTION, envelope);*/ SoapPrimitive result = (SoapPrimitive)envelope.getResponse(); //to get the data String resultData = result.toString(); // 0 is the first object of data sb.append(resultData + "\n"); SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; System.out.println(resultsRequestSOAP.toString()); } catch (Exception e) { e.printStackTrace(); sb.append("Error:\n" + e.getMessage() + "\n"); } } } `

    Read the article

  • regex split problem

    - by sunil-mand99
    I have javascript string variable with var sttr="We prefer questions that can be answered --------------------- not just discussed --------------------- Provide details ---------------------------- Write clearly and simply --------------------------answer all the question" please suggest how to split the string into array of sentences on the basis of dashes(-----) using regex result should be array[0]=We prefer questions that can be answered array[1]=not just discussed array[2]=Provide details array[3]=rite clearly and simply array[4]=answer all the question Note: dash(-----) range after each sentence is between 10 to 50

    Read the article

  • Regular Expression in java

    - by Sunil
    I have a HTML page and I want to fetch the result between two tags <b> and <BR> <b>Defendants Name:</b>Donahue, Leah A <BR> What is the regular expression to fetch the words between these two tags

    Read the article

  • Machine restricted login access

    - by Sunil Shenoy
    I am working on a project that has a requirement such that login details can only be accessed from one machine at one time. For example, if I grant you access to my website and you login from your home machine, the system will store this settings in a cookie/database. Now if you try the same login details on your work machine or any other machine, the system will not let you log into the system. The login will now only work from home machine. Any suggestions on how to achieve this would be helpful. Any resources you can point me towards would also be appreciated.

    Read the article

  • lucene query issue

    - by Sunil
    I am using Lucene with Alfresco. Here is my query: ( TYPE:"{com.company.customised.content.model}test" && (@\{com.company.customised.content.model\}testNo:111 && (@\{com.company.customised.content.model\}skill:or)) I have to search documents which are having property skill of value "or". The above query is not giving any results (I am getting failed to parse query). If I use the query up until testNo (ignoring skill), I am getting proper results: ( TYPE:"{com.company.customised.content.model}test" && (@\{com.company.customised.content.model\}testNo:111)) Can you please help me? Thanks

    Read the article

  • What is best way to remove ProgressDialog

    - by Sunil Kumar Sahoo
    I have created a progress dialog by ProgressDialog progressDialog = null; // create instance variable of ProgressDialog int dialogID = 1; //to create progress dialog protected Dialog onCreateDialog(int id) { progressDialog = new ProgressDialog(context); progressDialog.setMessage(message); progressDialog.setIcon(android.R.id.icon); return progressDialog; } // to show progressdialog showDialog(dialogID); To remove the dialog I am able to use any of the following three approaches approach-1 if(progressDialog != null){ progressDialog.dismiss(); } approach-2 if(progressDialog != null){ progressDialog.cancel(); } approach-3 removeDialog(dialogID); I found second approach is more effective than first approach. and if I have to use with more than one progressdialog it is easier to use approach-3. But what is the best way to destroy a progressdialog and How?

    Read the article

  • URL rewriting to a common end point

    - by sunil
    I want to create an asp.net white-label site http://whitelabel.com, that could be styled for each of our clients according to their specific needs. So for example, client abc would see the site in their corporate colours and be accessed through their specific url http://abc.com. Likewise client xyz would see the site in their own styling and url http://xyz.com. Typing either url, in effect, takes the user to http://whitelabel.com where the styling is applied, and the client's url structure is retained. I was thinking of URL rewriting using URLRewriter.Net (http://urlrewriter.net/), or similar, mapping the incoming address to a client id and applying the theme accordingly. So, a url rewrite rule may be something like <rewrite url="http//abc.com/(.+)" to="~/$1?id=1" /> <rewrite url="http//xyz.com/(.+)" to="~/$1?id=2" /> I could then read the id, map it to the client, and with a bit of jiggery-pokery, apply the correct theme. I was wondering if: this is the right approach ? I've overlooked something ? there is a better way to do this ? Any suggestions would be appreciated.

    Read the article

  • How to Show detail section only with out any space in Active Report

    - by Sunil Naudiyal
    i have a active report without any Page Header , Report Header and no any Footer type section. for more detail see attached image. Now issue is that When we run this report we got space before report detail. for more detail see attached image Below is my code Assembly asm = Assembly.GetAssembly(this.GetType()); System.IO.Stream stre = asm.GetManifestResourceStream(asm.GetName().Name + ".CoverPage.rpx"); using (XmlTextReader xr = new XmlTextReader(stre)) { arCoverPage.LoadLayout(xr); } //Get detail for Cover Page AddingReportSection(report, HeaderType.CoverPage); arCoverPage.DataSource = lstCoverPage; arCoverPage.Run(); I want remove this space.so please give me any suggestion/idea I also tried to set height of page but i am not get sucess. arCoverPage.PageSettings.DefaultPaperSize = false; arCoverPage.PageSettings.Gutter = 3.0F; arCoverPage.PageSettings.Orientation = DataDynamics.ActiveReports.Document.PageOrientation.Portrait; arCoverPage.PageSettings.PaperHeight = 5.0F; this.viReport.Document = arCoverPage.Document;

    Read the article

  • List Item Sort Order - TFS Work Items

    - by Sunil Ramu
    Is there any way to display the vaule order as the same given below in the work item template. When I see the template the value display order is changed. It is sorted alphabetically. Is there any way to change the sort order ? <ALLOWEDVALUES> <LISTITEM value="Pass" /> <LISTITEM value="Fail" /> <LISTITEM value="Blocked" /> <LISTITEM value="N/A" /> <LISTITEM value="Not Completed" /> <LISTITEM value="Ready For Review" /> <LISTITEM value="Approved" /> </ALLOWEDVALUES>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Unable to change background colour for JOptionPane

    - by Sunil Kumar Sahoo
    Hi I have created sample progeam which will give same look and feel of a confirm dialog and set the background colour as red. But I donot know what is the problem that my background colour of option is displayed as the default colour but not red. also i need same look and feel of confirm dialog across all platforms. Here is the code that I have written. please help me to solve the issue public class JOptionPaneBackground { public static void main(String[] args) throws Exception { // UIManager.setLookAndFeel(UIManager.getCrossPlatformLookAndFeelClassName()); UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); UIDefaults uiDefaults = UIManager.getLookAndFeelDefaults(); List<Object> keys = new ArrayList<Object>(uiDefaults.keySet()); Collections.sort(keys, new Comparator<Object>() { public int compare(Object o1, Object o2) { return (o1.toString()).compareTo(o2.toString()); } }); for (Object key : keys) { System.out.println(String.format("%-40s = %s", key, uiDefaults.get(key))); } UIManager.put("OptionPane.background", Color.red); UIManager.put("Panel.background", Color.red); JOptionPane.showConfirmDialog(null, "Hello World!"); } }

    Read the article

  • java profiler in java

    - by Sunil
    Hello I want to run a java program on linux server in profiling mode means I want to profile a java program on linux server.Is there any java profiling software that can profile java program on linux server. please suggest me what can I do for profiling. Thanks in advance.

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >