Search Results

Search found 10244 results on 410 pages for 'space complexity'.

Page 107/410 | < Previous Page | 103 104 105 106 107 108 109 110 111 112 113 114  | Next Page >

  • Oracle 10g - JAXB unmarshalling is not working as expected

    - by Santhosh Reddy Mandadi
    We're using Oracle 10g application server and deployed the Web service and trying to deploy the web service client. Server is working fine i.e.; marshalling is working fine. We're getting the output from the service properly but the search client is not unmarshalling (parsing) the response received. We're using all the tags under same name space so there is no name space problem. Different collections would exists in the XSD. Has anyone faced similar kind of issue? Is there any solution for this? Thanks Santhosh

    Read the article

  • How to change handedness of coordinates?

    - by 742
    How to convert from Euler's coordinates E1 = (x1, y1, z1, yaw1, pitch1, roll1) to E2 = (x2, y2, z2, yaw2, pitch2, roll2) where x, y, z are the coordinates of a point and yaw, pitch, roll the direction/orientation of a vector which origin is the point. yaw is around y, pitch around x, roll around z. They are performed in that order. Yaw 0 is normal to the plan xy (opposite to z in E1 and equal to z in E2). E1 uses a right handed space and E2 a left handed space. Both have the same origin, the same direction for y (top) and z (into the screen). They differ by x which is to the left on E1 and to the right on E2. They also differ by their direction of positive rotations. I've a custom type to hold the scalar representation and to convert from and to the equivalent WPF Matrix3d representation.

    Read the article

  • DrawString with character wrapping

    - by Roy
    Hi all, I'm creating a fatal error dialog for a Windows Mobile Application using C#. The problem is when I try to draw the stacktrace using DrawString, half of my stacktrace is getting clipped off because DrawString uses word wrapping instead of character wrapping. For those who don't understand the explanation: When i draw the stacktrace, it comes out as this: at company.application.name.space.Funct at company.application.name.Function(St at etc. etc. And i want it to print like this: at company.application.name.space.Funct ion(String sometext, Int32 somenumbe r) at company.application.name.Function(St ring sometext, Int32 somenumber, Int 32 anothernumber) at etc. etc. Is this possible in Csharp?

    Read the article

  • Bibtex with no references title

    - by Bryan Ward
    I am working on writing a scientific poster in LaTeX, and I want to include a few references for my work. Because this is a poster, I have my own customized headers for different sections, and don't want my related works to have a separate title. Essentially I have something like this: \begin{textblock}{5.5}(19.5,11) \CHead{Related Work} %a newcommand header I wrote \bibliographystyle{acm} \bibliography{mybib} \end{textblock} And it comes out with a header called "Related Work" like I want, but it also under that says "References", which I don't want. I found a few websites that said that I could override this with something like \renewcommand\refname{} But all this does is take the word "References" out, but the space allotted for the title is still there. Is there a way to completely eliminate the title and any space it may take up?

    Read the article

  • Run length encoding

    - by Phoenix
    What is the best we can do with run length encoding. http://en.wikipedia.org/wiki/Run-length_encoding Page suggests the time complexity is O(m*n) where m is the number of time the number repeats .. Is the a more efficient algorithm to do RLE ??

    Read the article

  • Strange error in SpringMVC Application Startup

    - by Euzel Villanueva
    I'm getting a very strange stack trace when trying to load a SpringMVC application and at a lost to why this is occurring. org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'org.springframework.web.servlet.mvc.annotation.AnnotationMethodHandlerAdapter#0': Cannot create inner bean '(inner bean)' of type [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter] while setting bean property 'messageConverters' with key [4]; nested exception is org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:281) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:125) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveManagedList(BeanDefinitionValueResolver.java:353) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveValueIfNecessary(BeanDefinitionValueResolver.java:153) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.applyPropertyValues(AbstractAutowireCapableBeanFactory.java:1325) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.populateBean(AbstractAutowireCapableBeanFactory.java:1086) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:517) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.AbstractBeanFactory$1.getObject(AbstractBeanFactory.java:291) at org.springframework.beans.factory.support.DefaultSingletonBeanRegistry.getSingleton(DefaultSingletonBeanRegistry.java:222) at org.springframework.beans.factory.support.AbstractBeanFactory.doGetBean(AbstractBeanFactory.java:288) at org.springframework.beans.factory.support.AbstractBeanFactory.getBean(AbstractBeanFactory.java:190) at org.springframework.beans.factory.support.DefaultListableBeanFactory.preInstantiateSingletons(DefaultListableBeanFactory.java:580) at org.springframework.context.support.AbstractApplicationContext.finishBeanFactoryInitialization(AbstractApplicationContext.java:895) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:425) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:442) at org.springframework.web.servlet.FrameworkServlet.createWebApplicationContext(FrameworkServlet.java:458) at org.springframework.web.servlet.FrameworkServlet.initWebApplicationContext(FrameworkServlet.java:339) at org.springframework.web.servlet.FrameworkServlet.initServletBean(FrameworkServlet.java:306) at org.springframework.web.servlet.HttpServletBean.init(HttpServletBean.java:127) at javax.servlet.GenericServlet.init(GenericServlet.java:160) at org.apache.catalina.core.StandardWrapper.initServlet(StandardWrapper.java:1133) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1087) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:996) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:4834) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5155) at org.apache.catalina.core.StandardContext$3.call(StandardContext.java:5150) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) Caused by: org.springframework.beans.factory.BeanCreationException: Error creating bean with name '(inner bean)#6': Instantiation of bean failed; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:965) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBeanInstance(AbstractAutowireCapableBeanFactory.java:911) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.doCreateBean(AbstractAutowireCapableBeanFactory.java:485) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.createBean(AbstractAutowireCapableBeanFactory.java:456) at org.springframework.beans.factory.support.BeanDefinitionValueResolver.resolveInnerBean(BeanDefinitionValueResolver.java:270) ... 31 more Caused by: org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.http.converter.xml.XmlAwareFormHttpMessageConverter]: Constructor threw exception; nested exception is java.lang.OutOfMemoryError: Java heap space at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:141) at org.springframework.beans.factory.support.SimpleInstantiationStrategy.instantiate(SimpleInstantiationStrategy.java:74) at org.springframework.beans.factory.support.AbstractAutowireCapableBeanFactory.instantiateBean(AbstractAutowireCapableBeanFactory.java:958) ... 35 more

    Read the article

  • using PHP for "Fluid" design(using viewport resolution)

    - by Jreeter
    I need some opinions on using PHP to make completely "scalable" websites.. For instance, using viewport resolution and resizing images, applying dynamic css styles..... In my mind doing this just add's to the complexity and should not be done, it should be fixed or fluid using strictly css and no server-side languages to generate layouts based on the device size.. I need some input and maybe some philosophy on why using this approach is not used at all..

    Read the article

  • submatrix from a matrix

    - by Grv
    A matrix is of size n*n and it consists only 0 and 1 find the largest submatrix that consists of 1's only eg 10010 11100 11001 11110 largest sub matrix will be of 3*2 from row 2 to row 4 please answer with best space and time complexity

    Read the article

  • Measurement conversion on the fly

    - by ikadewi
    Hi All I'd like to ask re: measurement conversion on the fly, here's the detail : Requirement: To display unit measurement with consider setting. Concerns: - Only basic (neutral) unit measurement is going to be stored in database, and it is decided one time. The grid control has direct binding to our business object therefore it has complexity to do conversion value. Problem: How to display different unit measurement (follow a setting), consider that controls are bind to business object? Your kind assistance will be appreciated. Thank you ikadewi

    Read the article

  • Sync GIT and ClearCase

    - by Senthil A Kumar
    I am currently working on ClearCase and now migrating to GIT. But we need this migration in a way that all work will be done in GIT and the data will be synced backed to ClearCase stream. We will have the same branch names and stream names in both GIT and CC, so scripting shouldn't be a problem. The problem here is, Can someone suggest which is the best model to sync CC and GIT Have all the Vobs in CC as single repo in GIT, and have the major stream in CC as various branches in GIT. - Single GIT repo (VOBS) and many branches (CC streams). - This takes up less space as VOBs are kept as single repo with many branches. Have important CC branches as independent GIT repositories and each repository having all the CC VOBs. - Many GIT repo for many CC branch - This will take up lots of space as VOBs will be replicated across. Which do you think is the best way to keep it in sync with ClearCase

    Read the article

  • Regex-expression with danish characters

    - by timkl
    I'm currently trying to wrap my head around regex, I have a validation snippet that tests an input box against a regex-expression: $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z]*$/).test(value); }, "Some text"); That works well, but when I try to add a space and some special danish characters, it doesn't filter the danish characters, only the space. $.validator.addMethod("customerName", function(value, element){ return (/^[a-zA-Z æøåÆØÅ]*$/).test(value); }, "Some text"); Any ideas to what could be wrong?

    Read the article

  • Enabling full documentation for J2EE in eclipse

    - by maayank
    I'm new to Eclipse and am using it currently to play with J2EE. When using Ctrl+Space for types/functions from the regular Java libraries I get a full description (i.e. general description of the type, what are the arguments of the method for, etc.). However I don't get the same for J2EE types. For example, when using Ctrl+Space on methods of the HttpSession class I get only names like "arg0" or "obj" and no description. Is there some kind of a package I can install to remedy this?

    Read the article

  • Doubts in System call mechanism in linux

    - by bala1486
    We transit from ring3 to ring0 using 'int' or the new 'syscall/sysenter' instruction. Does that mean that the page tables and other stuffs that needs to be modified for the kernel is automatically done by the 'int' instruction or the interrupt handler for the 'int 0x80' will do the required stuff and jump to the respective system call. Also when returning from a system call, we again need to go to user space. For this we need to know the instruction address in the user space to continue the user application. Where is that address stored. Does the 'ret' instruction automatically changes the ring from ring3 to ring0 or where/how this ring changing mechanism takes place? Then, i read that changing from ring3 to ring0 is not as costly as changing from ring0 to ring3. Why is this so?? Thanks, Bala

    Read the article

  • Pros and cons of ways of storing an unsigned int without an unsigned int data type

    - by fields
    I have values that are 64-bit unsigned ints, and I need to store them in mongodb, which has no unsigned int type. I see three main possibilities for storing them in other field types, and converting on going in and out: Using a signed int is probably easiest and most space efficient, but has the disadvantage that they're not human readable and if someone forgets to do the conversion, some of them will work, which may obscure errors. Raw binary is probably most difficult for inexperienced programmers to deal with, and also suffers from non-human-readability. A string representation is the least space efficient (~40 bytes in unicode vs 8 bytes per field), but then at least all of the possible values will map properly, and for querying only a conversion to string is required instead of a more complicated conversion. I need these values to be available from different platforms, so a single driver-specific solution isn't an option. Any major pros and cons I've missed? Which one would you use?

    Read the article

  • ffmpeg screen capture

    - by Mirai
    I wrote this script for some basic screen capture; it gets the window dimensions then uses the ffmpeg binary to record. I suspect there is a better way (maybe with the ffmpeg library), but scripting is what I know and ffmpeg generally works. Any software (other than recordmydesktop), or improvements to the script are welcome. info=`xwininfo -frame` H=`echo "$info" | grep Height | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` W=`echo "$info" | grep Width | sed -E "s/^.*: ([[:digit:]]+)$/\1/"` offset=:0.0+`echo "$info" | grep Corners | sed -E "s/^.*:[[:space:]]+\+([[:digit:]]+\+[[:digit:]]+)[[:space:]]+.+/\1/" | tr + ,` /usr/local/bin/ffmpeg -f x11grab -s ${W}x${H} -r 45 -i $offset -sameq -f avi ~/videos/`date +%Y-%m-%d-%H%M%s`_vid & echo $! > /tmp/$(basename $0)-$USER

    Read the article

  • Oracle Hash Cluster Overflow Blocks

    - by Andrew
    When inserting a large number of rows into a single table hash cluster in Oracle, it will fill up the block with any values that hash to that hash-value and then start using overflow blocks. These overflow blocks are listed as chained off the main block, but I can not find detailed information on the way in which they are allocated or chained. When an overflow block is allocated for a hash value, is that block exclusively allocated to that hash value, or are the overflow blocks used as a pool and different hash values can then start using the same overflow block. How is the free space of the chain monitored - in that, as data is continued to be inserted, does it have to traverse the entire chain to find out if it has some free space in the current overflow chain, and then if it finds none, it then chooses to allocate a new block?

    Read the article

  • parsing string off a configuration using strtok in C

    - by Jessica
    in the configuration file i have entries similar to this one: filepath = c:\Program Files\some value Where the path can contain spaces and there are no quotes on that string. I tried parsing this with strtok like: char *option; char *value; value = strtok(line, " ="); strcpy(option, value); value = strtok(NULL, " ="); where line is the line I am reading from the file, option will contain the left side of the equal (filepath) and value will contain the right side (c:\program files\some value). I know, it's poor coding, but I haven't found something better. sorry... In any case, for those options where there's no space in the right side it works great, but in those containing spaces it only return the string until the 1st space: c:\Program. Is there any other way to do this? Code is appreciated. Jessica

    Read the article

  • How to sort in-place using the merge sort algorithm?

    - by eSKay
    I know the question is too open. All I want is someone to tell me how to convert a normal merge sort into an in-place merge sort (or a merge sort with constant extra space overhead). All I can find (on the net) is pages saying "it is too complex" or "out of scope of this text". "The only known ways to merge in-place (without any extra space) are too complex to be reduced to practical program." (from here) Even if it is too complex, can somebody outline the basic concept of how to make the merge sort in-place?

    Read the article

  • Can you point me to current examples using NHibernate in an ASP.NET MVC2 app?

    - by alphadogg
    Can anyone point me to any self-contained, complete, current reference materials/projects using NHibernate in an ASP.NET MVC2 application? I have looked at Sharp Architecture, but I am not sure I need the complexity in that project. I certainly don't know enough about it to know if it is over-engineered for my purposes. I would like to see more types of implementations to gauge the various ways people have skinned this cat.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 103 104 105 106 107 108 109 110 111 112 113 114  | Next Page >