Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 108/330 | < Previous Page | 104 105 106 107 108 109 110 111 112 113 114 115  | Next Page >

  • Unable to load type error in ASP.NET 4 application on Windows Server 2003 / IIS6 -- only happens after first worker process recycle

    - by Daniel Coffman
    I'm running an ASP.NET 4.0 web application on IIS6 (Windows Server 2003 x64). This app is one of many running on this server under the Default Web Site -- but is alone on it's own application pool because the other sites are all running ASP.NET 2.0 still. When I deploy my application, it works just fine until the application pool recycles or kills its worker process (by default 2 hours or 20 minutes with no activity). After this, I get the error: "Unable to load one or more of the requested types. Retrieve the LoaderExceptions property for more information. System.Reflection.ReflectionTypeLoadException: Unable to load one or more of the requested types. Retrieve the LoaderExceptions property for more information." Refreshing the page, recycling the application pool, and iisreset do nothing. But, I can bring the site back online again for a little while by simply redeploying it. The stack trace seems to start at an EntityDataSource -- see below: [ReflectionTypeLoadException: Unable to load one or more of the requested types. Retrieve the LoaderExceptions property for more information.] System.Reflection.RuntimeModule.GetTypes(RuntimeModule module) +0 System.Reflection.Assembly.GetTypes() +144 System.Data.Metadata.Edm.ObjectItemConventionAssemblyLoader.LoadTypesFromAssembly() +45 System.Data.Metadata.Edm.ObjectItemAssemblyLoader.Load() +34 System.Data.Metadata.Edm.AssemblyCache.LoadAssembly(Assembly assembly, Boolean loadReferencedAssemblies, ObjectItemLoadingSessionData loadingData) +130 System.Data.Metadata.Edm.AssemblyCache.LoadAssembly(Assembly assembly, Boolean loadReferencedAssemblies, KnownAssembliesSet knownAssemblies, EdmItemCollection edmItemCollection, Action`1 logLoadMessage, Object& loaderCookie, Dictionary`2& typesInLoading, List`1& errors) +248 System.Data.Metadata.Edm.ObjectItemCollection.LoadAssemblyFromCache(ObjectItemCollection objectItemCollection, Assembly assembly, Boolean loadReferencedAssemblies, EdmItemCollection edmItemCollection, Action`1 logLoadMessage) +580 System.Data.Metadata.Edm.ObjectItemCollection.ExplicitLoadFromAssembly(Assembly assembly, EdmItemCollection edmItemCollection, Action`1 logLoadMessage) +193 System.Data.Metadata.Edm.MetadataWorkspace.ExplicitLoadFromAssembly(Assembly assembly, ObjectItemCollection collection, Action`1 logLoadMessage) +140 System.Web.UI.WebControls.EntityDataSourceView.ConstructContext() +756 System.Web.UI.WebControls.EntityDataSourceView.ExecuteSelect(DataSourceSelectArguments arguments) +147 This is a bug filed for the same (or similar) problem: http://connect.microsoft.com/VisualStudio/feedback/details/541962/unable-to-load-one-or-more-of-the-requested-types-connected-with-entitydatasource Question: Has anyone seen this and have advice? I've tried copy-local on all the references... Works just fine on my dev machine. Works on the server until the application pool worker process recycles. I'm building in release mode, but experience the same result when I build for debug. I'm stumped.

    Read the article

  • Can't install Nuget or other extension to VS2012 on Win8

    - by VinnyG
    When I try to install any extension for visual studio ultimate 2012 on my new installation of Winodws 8 I get this exception : System.IO.FileNotFoundException: The system cannot find the file specified. (Exception from HRESULT: 0x80070002) at System.Runtime.InteropServices.Marshal.ThrowExceptionForHRInternal(Int32 errorCode, IntPtr errorInfo) at Microsoft.VisualStudio.Settings.ExternalSettingsManager.GetScopePaths(String applicationPath, String suffixOrName, String vsVersion, Boolean isLogged, Boolean isForIsolatedApplication) at Microsoft.VisualStudio.Settings.ExternalSettingsManager.CreateForApplication(String applicationPath) at VSIXInstaller.App.GetExtensionManager(SupportedVSSKU sku) at VSIXInstaller.App.GetExtensionManagerForApplicableSKU(SupportedVSSKU supportedSKU, IInstallableExtension installableExtension, List`1 applicableSKUs) at VSIXInstaller.App.InitializeInstall() at System.Threading.Tasks.Task.InnerInvoke() at System.Threading.Tasks.Task.Execute() I tryed to repair VS, did not work, and also try to uninstall/install and got the same problem. Anybody as an idea?

    Read the article

  • There is an error in XML document... When calling to web service

    - by Sigurjón Guðbergsson
    I have created a web service and a function in it that should return a list of 11thousand records retreived from a pervasive database Here is my function in the web service. [WebService(Namespace = "http://tempuri.org/")] [WebServiceBinding(ConformsTo = WsiProfiles.BasicProfile1_1)] [System.ComponentModel.ToolboxItem(false)] public class BBI : System.Web.Services.WebService { [WebMethod] public List<myObject> getAll() { List<myObject> result = new List<myObject>(); PsqlConnection conn = new PsqlConnection("Host=soemthing;Port=something;Database=something;Encoding=IBM861"); conn.Open(); string strSql = "select 0, 1, 2, 3, 4, 5 from something"; PsqlCommand DBCmd = new PsqlCommand(strSql, conn); PsqlDataReader myDataReader; myDataReader = DBCmd.ExecuteReader(); while (myDataReader.Read()) { myObject b = new myObject(); b.0 = Convert.ToInt32(myDataReader[0].ToString()); b.1 = myDataReader[1].ToString(); b.2 = myDataReader[2].ToString(); b.3 = myDataReader[3].ToString(); b.4 = myDataReader[4].ToString(); b.5 = myDataReader[5].ToString(); result.Add(b); } conn.Close(); myDataReader.Close(); return result; } } Then i add web reference to this web service in my client program and call the reference BBI. Then i call to the getAll function and get the error : There is an error in XML document (1, 63432). public List<BBI.myObject> getAll() { BBI.BBI bbi = new BBI.BBI(); List<BBI.myObject> allBooks = bbi.getAll().OfType<BBI.myObject>().ToList(); return allBooks; } Here is the total exception detail System.InvalidOperationException was unhandled by user code Message=There is an error in XML document (1, 71897). Source=System.Xml StackTrace: at System.Xml.Serialization.XmlSerializer.Deserialize(XmlReader xmlReader, String encodingStyle, XmlDeserializationEvents events) at System.Xml.Serialization.XmlSerializer.Deserialize(XmlReader xmlReader, String encodingStyle) at System.Web.Services.Protocols.SoapHttpClientProtocol.ReadResponse(SoapClientMessage message, WebResponse response, Stream responseStream, Boolean asyncCall) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at BBI.BBI.getAllBooks() in c:\WINDOWS\Microsoft.NET\Framework\v4.0.30319\Temporary ASP.NET Files\vefur\73db60db\a4ee31dd\App_WebReferences.jl1r8jv6.0.cs:line 252 at webServiceFuncions.getAllBooks() in c:\Documents and Settings\forritari\Desktop\Vefur - Nýr\BBI\trunk\Vefur\App_Code\webServiceFuncions.cs:line 59 InnerException: System.Xml.XmlException Message='', hexadecimal value 0x01, is an invalid character. Line 1, position 71897. Source=System.Xml LineNumber=1 LinePosition=71897 SourceUri="" StackTrace: at System.Xml.XmlTextReaderImpl.Throw(Exception e) at System.Xml.XmlTextReaderImpl.Throw(String res, String[] args) at System.Xml.XmlTextReaderImpl.Throw(Int32 pos, String res, String[] args) at System.Xml.XmlTextReaderImpl.ParseNumericCharRefInline(Int32 startPos, Boolean expand, StringBuilder internalSubsetBuilder, Int32& charCount, EntityType& entityType) at System.Xml.XmlTextReaderImpl.ParseCharRefInline(Int32 startPos, Int32& charCount, EntityType& entityType) at System.Xml.XmlTextReaderImpl.ParseText(Int32& startPos, Int32& endPos, Int32& outOrChars) at System.Xml.XmlTextReaderImpl.ParseText() at System.Xml.XmlTextReaderImpl.ParseElementContent() at System.Xml.XmlTextReaderImpl.Read() at System.Xml.XmlTextReader.Read() at System.Xml.XmlReader.ReadElementString() at Microsoft.Xml.Serialization.GeneratedAssembly.XmlSerializationReaderBBI.Read2_Book(Boolean isNullable, Boolean checkType) at Microsoft.Xml.Serialization.GeneratedAssembly.XmlSerializationReaderBBI.Read20_getAllBooksResponse() at Microsoft.Xml.Serialization.GeneratedAssembly.ArrayOfObjectSerializer35.Deserialize(XmlSerializationReader reader) at System.Xml.Serialization.XmlSerializer.Deserialize(XmlReader xmlReader, String encodingStyle, XmlDeserializationEvents events) InnerException: The database records are containing all kind of strange symbols, for example ¤rmann Kr. Einarsson and Tv” ‘fint˜ri Can someone see what im doing wrong here?

    Read the article

  • How to Reinstalling MSSQL Server 2008 with SP1? (Windows 7)

    - by user23884
    I am using Windows 7 Ultimate x64. I had earlier installed SQL server 2008 with SP1 with Visual Studio 2008 Team System with sp1. Now that VS2010 is out I wanted to install it so I uninstalled visual studio then MSSLQ Server 2008 SP1 and then SQL Server 2008 as suggested here: h**p://mark.michaelis.net/Blog/SQLServer2008InstallNightmare.aspx But now when I try to reinstall it I am unable to get it right I am getting the ERROR: “Attempted to perform an unauthorized operation.” (Following is part of the log file): 2010-04-16 04:54:57 Slp: Sco: Attempting to replace account with sid in security descriptor D:(A;CI;KR;;;S-1-5-21-2213424280-2581054173-1939225444-1027) 2010-04-16 04:54:57 Slp: ReplaceAccountWithSidInSddl -- SDDL to be processed: D:(A;CI;KR;;;S-1-5-21-2213424280-2581054173-1939225444-1027) 2010-04-16 04:54:57 Slp: ReplaceAccountWithSidInSddl -- SDDL to be returned: D:(A;CI;KR;;;S-1-5-21-2213424280-2581054173-1939225444-1027) 2010-04-16 04:54:57 Slp: Prompting user if they want to retry this action due to the following failure: 2010-04-16 04:54:57 Slp: ---------------------------------------- 2010-04-16 04:54:57 Slp: The following is an exception stack listing the exceptions in outermost to innermost order 2010-04-16 04:54:57 Slp: Inner exceptions are being indented 2010-04-16 04:54:57 Slp: 2010-04-16 04:54:57 Slp: Exception type: Microsoft.SqlServer.Configuration.Sco.ScoException 2010-04-16 04:54:57 Slp: Message: 2010-04-16 04:54:57 Slp: Attempted to perform an unauthorized operation. 2010-04-16 04:54:57 Slp: Data: 2010-04-16 04:54:57 Slp: WatsonData = Microsoft SQL Server 2010-04-16 04:54:57 Slp: DisableRetry = true 2010-04-16 04:54:57 Slp: Inner exception type: System.UnauthorizedAccessException 2010-04-16 04:54:57 Slp: Message: 2010-04-16 04:54:57 Slp: Attempted to perform an unauthorized operation. 2010-04-16 04:54:57 Slp: Stack: 2010-04-16 04:54:57 Slp: at System.Security.AccessControl.Win32.GetSecurityInfo(ResourceType resourceType, String name, SafeHandle handle, AccessControlSections accessControlSections, RawSecurityDescriptor& resultSd) 2010-04-16 04:54:57 Slp: at System.Security.AccessControl.NativeObjectSecurity.CreateInternal(ResourceType resourceType, Boolean isContainer, String name, SafeHandle handle, AccessControlSections includeSections, Boolean createByName, ExceptionFromErrorCode exceptionFromErrorCode, Object exceptionContext) 2010-04-16 04:54:57 Slp: at Microsoft.SqlServer.Configuration.Sco.SqlRegistrySecurity..ctor(ResourceType resourceType, SafeRegistryHandle handle, AccessControlSections includeSections) 2010-04-16 04:54:57 Slp: at Microsoft.SqlServer.Configuration.Sco.SqlRegistrySecurity.Create(InternalRegistryKey key) 2010-04-16 04:54:57 Slp: at Microsoft.SqlServer.Configuration.Sco.InternalRegistryKey.SetSecurityDescriptor(String sddl, Boolean overwrite) 2010-04-16 04:54:57 Slp: ---------------------------------------- 2010-04-16 10:37:19 Slp: User has chosen to cancel this action 2010-04-16 10:37:19 Slp: Watson Bucket 2 Original Parameter Values 2010-04-16 10:37:19 Slp: Parameter 0 : SQL2008@RTM@ 2010-04-16 10:37:19 Slp: Parameter 2 : System.Security.AccessControl.Win32.GetSecurityInfo 2010-04-16 10:37:19 Slp: Parameter 3 : Microsoft.SqlServer.Configuration.Sco.ScoException@1211@1 2010-04-16 10:37:19 Slp: Parameter 4 : System.UnauthorizedAccessException@-2147024891 2010-04-16 10:37:19 Slp: Parameter 5 : SqlBrowserConfigAction_install_ConfigNonRC 2010-04-16 10:37:19 Slp: Parameter 7 : Microsoft SQL Server 2010-04-16 10:37:19 Slp: Parameter 8 : Microsoft SQL Server 2010-04-16 10:37:19 Slp: Final Parameter Values I have googled around for the error given error but all I could find is to regedit and reset permissions on certain reg keys but I don’t see any reg keys with access problem in the log file the log file can be download here: http://www.mediafire.com/?dznizytjznn. Please guys help me out here I am a developer and I cannot afford an OS reinstallation! Thanks in advance…

    Read the article

  • Spring Security and the Synchronizer Token J2EE pattern, problem when authentication fails.

    - by dfuse
    Hey, we are using Spring Security 2.0.4. We have a TransactionTokenBean which generates a unique token each POST, the bean is session scoped. The token is used for the duplicate form submission problem (and security). The TransactionTokenBean is called from a Servlet filter. Our problem is the following, after a session timeout occured, when you do a POST in the application Spring Security redirects to the logon page, saving the original request. After logging on again the TransactionTokenBean is created again, since it is session scoped, but then Spring forwards to the originally accessed url, also sending the token that was generated at that time. Since the TransactionTokenBean is created again, the tokens do not match and our filter throws an Exception. I don't quite know how to handle this elegantly, (or for that matter, I can't even fix it with a hack), any ideas? This is the code of the TransactionTokenBean: public class TransactionTokenBean implements Serializable { public static final int TOKEN_LENGTH = 8; private RandomizerBean randomizer; private transient Logger logger; private String expectedToken; public String getUniqueToken() { return expectedToken; } public void init() { resetUniqueToken(); } public final void verifyAndResetUniqueToken(String actualToken) { verifyUniqueToken(actualToken); resetUniqueToken(); } public void resetUniqueToken() { expectedToken = randomizer.getRandomString(TOKEN_LENGTH, RandomizerBean.ALPHANUMERICS); getLogger().debug("reset token to: " + expectedToken); } public void verifyUniqueToken(String actualToken) { if (getLogger().isDebugEnabled()) { getLogger().debug("verifying token. expected=" + expectedToken + ", actual=" + actualToken); } if (expectedToken == null || actualToken == null || !isValidToken(actualToken)) { throw new IllegalArgumentException("missing or invalid transaction token"); } if (!expectedToken.equals(actualToken)) { throw new InvalidTokenException(); } } private boolean isValidToken(String actualToken) { return StringUtils.isAlphanumeric(actualToken); } public void setRandomizer(RandomizerBean randomizer) { this.randomizer = randomizer; } private Logger getLogger() { if (logger == null) { logger = Logger.getLogger(TransactionTokenBean.class); } return logger; } } and this is the Servlet filter (ignore the Ajax stuff): public class SecurityFilter implements Filter { static final String AJAX_TOKEN_PARAM = "ATXTOKEN"; static final String TOKEN_PARAM = "TXTOKEN"; private WebApplicationContext webApplicationContext; private Logger logger = Logger.getLogger(SecurityFilter.class); public void init(FilterConfig config) { setWebApplicationContext(WebApplicationContextUtils.getWebApplicationContext(config.getServletContext())); } public void destroy() { } public void doFilter(ServletRequest req, ServletResponse response, FilterChain chain) throws IOException, ServletException { HttpServletRequest request = (HttpServletRequest) req; if (isPostRequest(request)) { if (isAjaxRequest(request)) { log("verifying token for AJAX request " + request.getRequestURI()); getTransactionTokenBean(true).verifyUniqueToken(request.getParameter(AJAX_TOKEN_PARAM)); } else { log("verifying and resetting token for non-AJAX request " + request.getRequestURI()); getTransactionTokenBean(false).verifyAndResetUniqueToken(request.getParameter(TOKEN_PARAM)); } } chain.doFilter(request, response); } private void log(String line) { if (logger.isDebugEnabled()) { logger.debug(line); } } private boolean isPostRequest(HttpServletRequest request) { return "POST".equals(request.getMethod().toUpperCase()); } private boolean isAjaxRequest(HttpServletRequest request) { return request.getParameter("AJAXREQUEST") != null; } private TransactionTokenBean getTransactionTokenBean(boolean ajax) { return (TransactionTokenBean) webApplicationContext.getBean(ajax ? "ajaxTransactionTokenBean" : "transactionTokenBean"); } void setWebApplicationContext(WebApplicationContext context) { this.webApplicationContext = context; } }

    Read the article

  • Advanced Regex: Smart auto detect and replace URLs with anchor tags

    - by Robert Koritnik
    I've written a regular expression that automatically detects URLs in free text that users enter. This is not such a simple task as it may seem at first. Jeff Atwood writes about it in his post. His regular expression works, but needs extra code after detection is done. I've managed to write a regular expression that does everything in a single go. This is how it looks like (I've broken it down into separate lines to make it more understandable what it does): 1 (?<outer>\()? 2 (?<scheme>http(?<secure>s)?://)? 3 (?<url> 4 (?(scheme) 5 (?:www\.)? 6 | 7 www\. 8 ) 9 [a-z0-9] 10 (?(outer) 11 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\)) 12 | 13 [-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+ 14 ) 15 ) 16 (?<ending>(?(outer)\))) As you may see, I'm using named capture groups (used later in Regex.Replace()) and I've also included some local characters (cšžcd), that allow our localised URLs to be parsed as well. You can easily omit them if you'd like. Anyway. Here's what it does (referring to line numbers): 1 - detects if URL starts with open braces (is contained inside braces) and stores it in "outer" named capture group 2 - checks if it starts with URL scheme also detecting whether scheme is SSL or not 3 - start parsing URL itself (will store it in "url" named capture group) 4-8 - if statement that says: if "sheme" was present then www. part is optional, otherwise mandatory for a string to be a link (so this regular expression detects all strings that start with either http or www) 9 - first character after http:// or www. should be either a letter or a number (this can be extended if you'd like to cover even more links, but I've decided not to because I can't think of a link that would start with some obscure character) 10-14 - if statement that says: if "outer" (braces) was present capture everything up to the last closing braces otherwise capture all 15 - closes the named capture group for URL 16 - if open braces were present, capture closing braces as well and store it in "ending" named capture group First and last line used to have \s* in them as well, so user could also write open braces and put a space inside before pasting link. Anyway. My code that does link replacement with actual anchor HTML elements looks exactly like this: value = Regex.Replace( value, @"(?<outer>\()?(?<scheme>http(?<secure>s)?://)?(?<url>(?(scheme)(?:www\.)?|www\.)[a-z0-9](?(outer)[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+(?=\))|[-a-z0-9/+&@#/%?=~_()|!:,.;cšžcd]+))(?<ending>(?(outer)\)))", "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}", RegexOptions.Compiled | RegexOptions.CultureInvariant | RegexOptions.IgnoreCase); As you can see I'm using named capture groups to replace link with an Anchor tag: "${outer}<a href=\"http${secure}://${url}\">http${secure}://${url}</a>${ending}" I could as well omit the http(s) part in anchor display to make links look friendlier, but for now I decided not to. Question I would like my links to be replaced with shortenings as well. So when user copies a very long link (for instance if they would copy a link from google maps that usually generates long links) I would like to shorten the visible part of the anchor tag. Link would work, but visible part of an anchor tag would be shortened to some number of characters. I could as well append ellipsis at the end of at all possible (and make things even more perfect). Does Regex.Replace() method support replacement notations so that I can still use a single call? Something similar as string.Format() method does when you'd like to format values in string format (decimals, dates etc...).

    Read the article

  • exchange server 2010 Outlook Web Access - Exchange Control Panel WEB Interface

    - by Aceth
    from what i can gather the mailbox bit of the web interface works fine.. when any of the users go to options (top right) and try to use some of the features such as the Organise Mail Delivery Reports to find messages etc... it comes up with a message .. "An item with the same key has already been added" I've looked in the event viewer and i think its this error - Watson report about to be sent for process id: 7016, with parameters: E12IIS, c-RTL-AMD64, 14.00.0639.021, ECP, ECP.Powershell, https://x.x.x.x/ecp/PersonalSettings/Accounts.svc/GetList, UnexpectedCondition:ArgumentException, c09, 14.00.0639.021. ErrorReportingEnabled: False and Request for URL 'https://x.x.x.x/ecp/PersonalSettings/Accounts.svc/GetList' failed with the following error: System.ArgumentException: An item with the same key has already been added. at System.ServiceModel.AsyncResult.End[TAsyncResult](IAsyncResult result) at System.ServiceModel.Activation.HostedHttpRequestAsyncResult.End(IAsyncResult result) at System.ServiceModel.Activation.HostedHttpRequestAsyncResult.ExecuteSynchronous(HttpApplication context, Boolean flowContext) at Microsoft.Exchange.Management.ControlPanel.WebServiceHandler.ProcessRequest(HttpContext context) at System.Web.HttpApplication.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) I've tried googling but no luck that's relevant :(

    Read the article

  • Long string insertion with sed

    - by Luis Varca
    I am trying to use this expression to insert the contents of one text file into another after a give string. This is a simple bash script: TEXT=`cat file1.txt` sed -i "/teststring/a \ $TEXT" file2.txt This returns an error, "sed: -e expression #1, char 37: unknown command: `M'" The issue is in the fact that the contents of file1.txt are actually a private certificate so it's a large amount of text and unusual characters which seems to be causing an issue. If I replace $TEXT with a simple ASCII value it works but when it reads the large content of file1.txt it fails with that error. Is there some way to carry out this action? Is my syntax off with sed or my quote placement wrong?

    Read the article

  • trie reg exp parse step over char and continue

    - by forest.peterson
    Setup: 1) a string trie database formed from linked nodes and a vector array linking to the next node terminating in a leaf, 2) a recursive regular expression function that if A) char '*' continues down all paths until string length limit is reached, then continues down remaining string paths if valid, and B) char '?' continues down all paths for 1 char and then continues down remaining string paths if valid. 3) after reg expression the candidate strings are measured for edit distance against the 'try' string. Problem: the reg expression works fine for adding chars or swapping ? for a char but if the remaining string has an error then there is not a valid path to a terminating leaf; making the matching function redundant. I tried adding a 'step-over' ? char if the end of the node vector was reached and then followed every path of that node - allowing this step-over only once; resulted in a memory exception; I cannot find logically why it is accessing the vector out of range - bactracking? Questions: 1) how can the regular expression step over an invalid char and continue with the path? 2) why is swapping the 'sticking' char for '?' resulting in an overflow? Function: void Ontology::matchRegExpHelper(nodeT *w, string inWild, Set<string> &matchSet, string out, int level, int pos, int stepover) { if (inWild=="") { matchSet.add(out); } else { if (w->alpha.size() == pos) { int testLength = out.length() + inWild.length(); if (stepover == 0 && matchSet.size() == 0 && out.length() > 8 && testLength == tokenLength) {//candidate generator inWild[0] = '?'; matchRegExpHelper(w, inWild, matchSet, out, level, 0, stepover+1); } else return; //giveup on this path } if (inWild[0] == '?' || (inWild[0] == '*' && (out.length() + inWild.length() ) == level ) ) { //wild matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover);//follow path -> if ontology is full, treat '*' like a '?' } else if (inWild[0] == '*') matchRegExpHelper(w->alpha[pos].next, '*'+inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //keep adding chars if (inWild[0] == w->alpha[pos].letter) //follow self matchRegExpHelper(w->alpha[pos].next, inWild.substr(1), matchSet, out+w->alpha[pos].letter, level, 0, stepover); //follow char matchRegExpHelper(w, inWild, matchSet, out, level, pos+1, stepover);//check next path } } Error Message: +str "Attempt to access index 1 in a vector of size 1." std::basic_string<char,std::char_traits<char>,std::allocator<char> > +err {msg="Attempt to access index 1 in a vector of size 1." } ErrorException Note: this function works fine for hundreds of test strings with '*' wilds if the extra stepover gate is not used Semi-Solved: I place a pos < w->alpha.size() condition on each path that calls w->alpha[pos]... - this prevented the backtrack calls from attempting to access the vector with an out of bounds index value. Still have other issues to work out - it loops infinitely adding the ? and backtracking to remove it, then repeat. But, moving forward now. Revised question: why during backtracking is the position index accumulating and/or not deincrementing - so at somepoint it calls w->alpha[pos]... with an invalid position that is either remaining from the next node or somehow incremented pos+1 when passing upward?

    Read the article

  • How to hide/show a Process using c#?

    - by aF
    Hello, While executing my program, I want to hide/minimize Microsoft Speech Recognition Application: and at the end I want to show/maximize using c#! This process is not started by me so I can't give control the process startInfo. I've tried to use user32.dll methods such as: ShowWindow AnimatedWindows AnimatedWindows With all of them I have the same problem. I can hide the windows (althought I have to call one of the methods two times with SW_HIDE option), but when I call the method with a SW_SHOW flag, it simply doesn't shows.. How can I maximize/show after hiding the process? Thanks in advance! Here is some pieces of the code, now implemented to use SetWindowPlacement: { [DllImport("user32.dll")] [return: MarshalAs(UnmanagedType.Bool)] public static extern bool GetWindowPlacement(IntPtr hWnd, ref WINDOWPLACEMENT lpwndpl); [DllImport("user32.dll", SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] static extern bool SetWindowPlacement(IntPtr hWnd, [In] ref WINDOWPLACEMENT lpwndpl); [DllImport("user32.dll")] public static extern Boolean ShowWindowAsync(IntPtr hWnd, Int32 nCmdShow); [DllImport("user32.dll")] public static extern Boolean SetForegroundWindow(IntPtr hWnd); [DllImport("user32.dll")] public static extern Boolean ShowWindow(IntPtr hWnd, Int32 nCmdShow); [DllImport("user32.dll")] public static extern Boolean AnimateWindow(IntPtr hWnd, uint dwTime, uint dwFlags); [DllImport("dwmapi.dll")] public static extern int DwmSetWindowAttribute(IntPtr hwnd, uint dwAttribute, IntPtr pvAttribute, IntPtr lol); //Definitions For Different Window Placement Constants const UInt32 SW_HIDE = 0; const UInt32 SW_SHOWNORMAL = 1; const UInt32 SW_NORMAL = 1; const UInt32 SW_SHOWMINIMIZED = 2; const UInt32 SW_SHOWMAXIMIZED = 3; const UInt32 SW_MAXIMIZE = 3; const UInt32 SW_SHOWNOACTIVATE = 4; const UInt32 SW_SHOW = 5; const UInt32 SW_MINIMIZE = 6; const UInt32 SW_SHOWMINNOACTIVE = 7; const UInt32 SW_SHOWNA = 8; const UInt32 SW_RESTORE = 9; public sealed class AnimateWindowFlags { public const int AW_HOR_POSITIVE = 0x00000001; public const int AW_HOR_NEGATIVE = 0x00000002; public const int AW_VER_POSITIVE = 0x00000004; public const int AW_VER_NEGATIVE = 0x00000008; public const int AW_CENTER = 0x00000010; public const int AW_HIDE = 0x00010000; public const int AW_ACTIVATE = 0x00020000; public const int AW_SLIDE = 0x00040000; public const int AW_BLEND = 0x00080000; } public struct WINDOWPLACEMENT { public int length; public int flags; public int showCmd; public System.Drawing.Point ptMinPosition; public System.Drawing.Point ptMaxPosition; public System.Drawing.Rectangle rcNormalPosition; } //this works param = new WINDOWPLACEMENT(); param.length = Marshal.SizeOf(typeof(WINDOWPLACEMENT)); param.showCmd = (int)SW_HIDE; lol = SetWindowPlacement(theprocess.MainWindowHandle, ref param); // this doesn't work WINDOWPLACEMENT param = new WINDOWPLACEMENT(); param.length = Marshal.SizeOf(typeof(WINDOWPLACEMENT)); param.showCmd = SW_SHOW; lol = GetWindowPlacement(theprocess.MainWindowHandle, ref param);

    Read the article

  • Android fill ImageView from URL

    - by Luke Batley
    Hi i'm trying to add an image to an ImageView from a URL i have tried loading it as a bitmap but nothing is showing. so does anyone know what the best method to do this is or what i'm doing wrong? heres my code @Override protected void onCreate(Bundle savedInstanceState) { // TODO Auto-generated method stub super.onCreate(savedInstanceState); //Check Preferences which sets UI setContentView(R.layout.singlenews); TextView headerText = (TextView) findViewById(R.id.header_text); headerText.setText("Latest News"); PostTask posttask; posttask = new PostTask(); posttask.execute(); } public void loadNews(){ newsStr = getIntent().getStringExtra("singleNews"); try { JSONObject obj = new JSONObject(newsStr); content = obj.getString("content"); title = obj.getString("title"); fullName = obj.getString("fullname"); created = obj.getString("created"); NewsImageURL = obj.getString("image_primary"); tagline = obj.getString("tagline"); meta = "posted by: " + fullName + " " + created; URL aURL = new URL("NewsImageURL"); URLConnection conn = aURL.openConnection(); conn.connect(); InputStream is = conn.getInputStream(); /* Buffered is always good for a performance plus. */ BufferedInputStream bis = new BufferedInputStream(is); /* Decode url-data to a bitmap. */ bm = BitmapFactory.decodeStream(bis); bis.close(); is.close(); /* Apply the Bitmap to the ImageView that will be returned. */ Log.v("lc", "content=" + content); Log.v("lc", "title=" + title); Log.v("lc", "fullname=" + fullName); Log.v("lc", "created=" + created); Log.v("lc", "NewsImage=" + NewsImageURL); Log.v("lc", "Meta=" + meta); Log.v("lc", "tagline=" + tagline); } catch (JSONException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } public class PostTask extends AsyncTask<Void, String, Boolean> { @Override protected Boolean doInBackground(Void... params) { boolean result = false; loadNews(); publishProgress("progress"); return result; } protected void onProgressUpdate(String... progress) { StringBuilder str = new StringBuilder(); for (int i = 1; i < progress.length; i++) { str.append(progress[i] + " "); } } @Override protected void onPostExecute(Boolean result) { super.onPostExecute(result); Log.v("BGThread", "begin fillin data"); fillData(); } } public void fillData(){ NewsView = LayoutInflater.from(getBaseContext()).inflate(R.layout.newsdetailact, null); TextView Title = (TextView) NewsView.findViewById(R.id.NewsTitle); Title.setText(title); TextView Tagline = (TextView) NewsView.findViewById(R.id.subtitle); Tagline.setText(tagline); TextView MetaData = (TextView) NewsView.findViewById(R.id.meta); MetaData.setText(meta); ImageView NewsImage = (ImageView)NewsView.findViewById(R.id.imageView2); NewsImage.setImageBitmap(bm); TextView MainContent = (TextView) NewsView.findViewById(R.id.maintext); MainContent.setText(content); Log.v("BGThread", "Filled results"); adapter = new MergeAdapter(); adapter.addView(NewsView); setListAdapter(adapter); } }

    Read the article

  • Why is this MySQL FULLTEXT query returning 0 rows when matching rows are present?

    - by Don MacAskill
    I have a MySQL table with 200M rows which has a FULLTEXT index on two columns (Title,Body). When I do a simple FULLTEXT query in the default NATURAL LANGUAGE mode for some popular results (they'd return 2M+ rows), I'm getting zero rows back: SELECT COUNT(*) FROM itemsearch WHERE MATCH (Title, Body) AGAINST ('fubar'); But when I do a FULLTEXT query in BOOLEAN mode, I can see the rows in question do exist (I get 2M+ back, depending): SELECT COUNT(*) FROM itemsearch WHERE MATCH (Title, Body) AGAINST ('+fubar' IN BOOLEAN MODE); I have some queries which return ~500K rows which are working fine in either mode, so if it's result size related, it seems to crop up somewhere between 500K and a little north of 2M. I've tried playing with the various buffer size variables, to no avail. It's clearly not the 50% threshold, since we're not getting 100M rows back for any result. Any ideas?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • ActionScript MovieClip moves to the left, but not the right

    - by Defcon
    I have a stage with a movie clip with the instance name of "mc". Currently I have a code that is suppose to move the player left and right, and when the left or right key is released, the "mc" slides a little bit. The problem I'm having is that making the "mc" move to the left works, but the exact some code used for the right doesn't. All of this code is present on the Main Stage - Frame One //Variables var mcSpeed:Number = 0;//MC's Current Speed var mcJumping:Boolean = false;//if mc is Jumping var mcFalling:Boolean = false;//if mc is Falling var mcMoving:Boolean = false;//if mc is Moving var mcSliding:Boolean = false;//if mc is sliding var mcSlide:Number = 0;//Stored for use when creating slide var mcMaxSlide:Number = 1.6;//Max Distance the object will slide. //Player Move Function p1Move = new Object(); p1Move = function (dir:String, maxSpeed:Number) { if (dir == "left" && _root.mcSpeed<maxSpeed) { _root.mcSpeed += .2; _root.mc._x -= _root.mcSpeed; } else if (dir == "right" && _root.mcSpeed<maxSpeed) { _root.mcSpeed += .2; _root.mc._x += _root.mcSpeed; } else if (dir == "left" && speed>=maxSpeed) { _root.mc._x -= _root.mcSpeed; } else if (dir == "right" && _root.mcSpeed>=maxSpeed) { _root.mc._x += _root.mcSpeed; } } //onEnterFrame for MC mc.onEnterFrame = function():Void { if (Key.isDown(Key.LEFT)) { if (_root.mcMoving == false && _root.mcSliding == false) { _root.mcMoving = true; } else if (_root.mcMoving == true && _root.mcSliding == false) { _root.p1Move("left",5); } } else if (!Key.isDown(Key.LEFT)) { if (_root.mcMoving == true && _root.mcSliding == false) { _root.mcSliding = true; } else if (_root.mcMoving == true && _root.mcSliding == true && _root.mcSlide<_root.mcMaxSlide) { _root.mcSlide += .2; this._x -= .2; } else if (_root.mcMoving == true && _root.mcSliding == true && _root.mcSlide>=_root.mcMaxSlide) { _root.mcMoving = false; _root.mcSliding = false; _root.mcSlide = 0; _root.mcSpeed = 0; } } else if (Key.isDown(Key.RIGHT)) { if (_root.mcMoving == false && _root.mcSliding == false) { _root.mcMoving = true; } else if (_root.mcMoving == true && _root.mcSliding == false) { _root.p1Move("right",5); } } else if (!Key.isDown(Key.RIGHT)) { if (_root.mcMoving == true && _root.mcSliding == false) { _root.mcSliding = true; } else if (_root.mcMoving == true && _root.mcSliding == true && _root.mcSlide<_root.mcMaxSpeed) { _root.mcSlide += .2; this._x += .2; } else if (_root.mcMoving == true && _root.mcSliding == true && _root.mcSlide>=_root.mcMax) { _root.mcMoving = false; _root.mcSliding = false; _root.mcSlide = 0; _root.mcSpeed = 0; } } }; I just don't get why when you press the left arrow its works completely fine, but when you press the right arrow it doesn't respond. It is literally the same code.

    Read the article

  • Opening of the spWeb.ContentTypes gives SOAP Exception 0x80004004

    - by mdi
    Hi everybody! I have the code which going through the sharepoint contenttypes and changes needed field display names. On my local server everything works fine, but on the client side it gives me an error: Microsoft.SharePoint.SPException: Operation aborted (Exception from HRESULT: 0x80004004 (E_ABORT)) --- System.Runtime.InteropServices.COMException (0x80004004): Operation aborted (Exception from HRESULT: 0x80004004 (E_ABORT)) at Microsoft.SharePoint.Library.SPRequestInternalClass.OpenWebInternal(String bstrUrl, Guid& pguidID, String& pbstrRequestAccessEmail, UInt32& pwebVersion, String& pbstrServerRelativeUrl, UInt32& pnLanguage, UInt32& pnLocale, String& pbstrDefaultTheme, String& pbstrDefaultThemeCSSUrl, String& pbstrAlternateCSSUrl, String& pbstrCustomizedCssFileList, String& pbstrCustomJSUrl, String& pbstrAlternateHeaderUrl, String& pbstrMasterUrl, String& pbstrCustomMasterUrl, String& pbstrSiteLogoUrl, String& pbstrSiteLogoDescription, Object& pvarUser, Boolean& pvarIsAuditor, Int32& plSiteFlags) at Microsoft.SharePoint.Library.SPRequest.OpenWebInternal(String bstrUrl, Guid& pguidID, String& pbstrRequestAccessEmail, UInt32& pwebVersion, String& pbstrServerRelativeUrl, UInt32& pnLanguage, UInt32& pnLocale, String& pbstrDefaultTheme, String& pbstrDefaultThemeCSSUrl, String& pbstrAlternateCSSUrl, String& pbstrCustomizedCssFileList, String& pbstrCustomJSUrl, String& pbstrAlternateHeaderUrl, String& pbstrMasterUrl, String& pbstrCustomMasterUrl, String& pbstrSiteLogoUrl, String& pbstrSiteLogoDescription, Object& pvarUser, Boolean& pvarIsAuditor, Int32& plSiteFlags) --- End of inner exception stack trace --- at Microsoft.SharePoint.Library.SPRequest.OpenWebInternal(String bstrUrl, Guid& pguidID, String& pbstrRequestAccessEmail, UInt32& pwebVersion, String& pbstrServerRelativeUrl, UInt32& pnLanguage, UInt32& pnLocale, String& pbstrDefaultTheme, String& pbstrDefaultThemeCSSUrl, String& pbstrAlternateCSSUrl, String& pbstrCustomizedCssFileList, String& pbstrCustomJSUrl, String& pbstrAlternateHeaderUrl, String& pbstrMasterUrl, String& pbstrCustomMasterUrl, String& pbstrSiteLogoUrl, String& pbstrSiteLogoDescription, Object& pvarUser, Boolean& pvarIsAuditor, Int32& plSiteFlags) at Microsoft.SharePoint.SPWeb.InitWebPublic() at Microsoft.SharePoint.SPWeb.get_ServerRelativeUrl() at Microsoft.SharePoint.SPWeb.get_Url() at Microsoft.SharePoint.SPContentTypeCollection.FetchCollection() at Microsoft.SharePoint.SPContentTypeCollection..ctor(SPWeb web, Boolean bAll) at Microsoft.SharePoint.SPWeb.get_ContentTypes() the code is below: SPWebApplication webApp = SPWebService.ContentService.WebApplications[someGuid]; foreach (SPSite spSite in webApp.Sites) { using (SPWeb spWeb = spSite.RootWeb) { try { foreach (SPContentType spContentType in spWeb.ContentTypes) { ... }}}.. Could anybody provide me with workaround or with the reason of the problem.

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • ILMerge - Unresolved assembly reference not allowed: System.Core

    - by Steve Michelotti
    ILMerge is a utility which allows you the merge multiple .NET assemblies into a single binary assembly more for convenient distribution. Recently we ran into problems when attempting to use ILMerge on a .NET 4 project. We received the error message: An exception occurred during merging: Unresolved assembly reference not allowed: System.Core.     at System.Compiler.Ir2md.GetAssemblyRefIndex(AssemblyNode assembly)     at System.Compiler.Ir2md.GetTypeRefIndex(TypeNode type)     at System.Compiler.Ir2md.VisitReferencedType(TypeNode type)     at System.Compiler.Ir2md.GetMemberRefIndex(Member m)     at System.Compiler.Ir2md.PopulateCustomAttributeTable()     at System.Compiler.Ir2md.SetupMetadataWriter(String debugSymbolsLocation)     at System.Compiler.Ir2md.WritePE(Module module, String debugSymbolsLocation, BinaryWriter writer)     at System.Compiler.Writer.WritePE(String location, Boolean writeDebugSymbols, Module module, Boolean delaySign, String keyFileName, String keyName)     at System.Compiler.Writer.WritePE(CompilerParameters compilerParameters, Module module)     at ILMerging.ILMerge.Merge()     at ILMerging.ILMerge.Main(String[] args) It turns out that this issue is caused by ILMerge.exe not being able to find the .NET 4 framework by default. The answer was ultimately found here. You either have to use the /lib option to point to your .NET 4 framework directory (e.g., “C:\Windows\Microsoft.NET\Framework\v4.0.30319” or “C:\Windows\Microsoft.NET\Framework64\v4.0.30319”) or just use an ILMerge.exe.config file that looks like this: 1: <configuration> 2: <startup useLegacyV2RuntimeActivationPolicy="true"> 3: <requiredRuntime safemode="true" imageVersion="v4.0.30319" version="v4.0.30319"/> 4: </startup> 5: </configuration> This was able to successfully resolve my issue.

    Read the article

  • ASP.NET MVC Paging/Sorting/Filtering a list using ModelMetadata

    - by rajbk
    This post looks at how to control paging, sorting and filtering when displaying a list of data by specifying attributes in your Model using the ASP.NET MVC framework and the excellent MVCContrib library. It also shows how to hide/show columns and control the formatting of data using attributes.  This uses the Northwind database. A sample project is attached at the end of this post. Let’s start by looking at a class called ProductViewModel. The properties in the class are decorated with attributes. The OrderBy attribute tells the system that the Model can be sorted using that property. The SearchFilter attribute tells the system that filtering is allowed on that property. Filtering type is set by the  FilterType enum which currently supports Equals and Contains. The ScaffoldColumn property specifies if a column is hidden or not The DisplayFormat specifies how the data is formatted. public class ProductViewModel { [OrderBy(IsDefault = true)] [ScaffoldColumn(false)] public int? ProductID { get; set; }   [SearchFilter(FilterType.Contains)] [OrderBy] [DisplayName("Product Name")] public string ProductName { get; set; }   [OrderBy] [DisplayName("Unit Price")] [DisplayFormat(DataFormatString = "{0:c}")] public System.Nullable<decimal> UnitPrice { get; set; }   [DisplayName("Category Name")] public string CategoryName { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? CategoryID { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? SupplierID { get; set; }   [OrderBy] public bool Discontinued { get; set; } } Before we explore the code further, lets look at the UI.  The UI has a section for filtering the data. The column headers with links are sortable. Paging is also supported with the help of a pager row. The pager is rendered using the MVCContrib Pager component. The data is displayed using a customized version of the MVCContrib Grid component. The customization was done in order for the Grid to be aware of the attributes mentioned above. Now, let’s look at what happens when we perform actions on this page. The diagram below shows the process: The form on the page has its method set to “GET” therefore we see all the parameters in the query string. The query string is shown in blue above. This query gets routed to an action called Index with parameters of type ProductViewModel and PageSortOptions. The parameters in the query string get mapped to the input parameters using model binding. The ProductView object created has the information needed to filter data while the PageAndSorting object is used for paging and sorting the data. The last block in the figure above shows how the filtered and paged list is created. We receive a product list from our product repository (which is of type IQueryable) and first filter it by calliing the AsFiltered extension method passing in the productFilters object and then call the AsPagination extension method passing in the pageSort object. The AsFiltered extension method looks at the type of the filter instance passed in. It skips properties in the instance that do not have the SearchFilter attribute. For properties that have the SearchFilter attribute, it adds filter expression trees to filter against the IQueryable data. The AsPagination extension method looks at the type of the IQueryable and ensures that the column being sorted on has the OrderBy attribute. If it does not find one, it looks for the default sort field [OrderBy(IsDefault = true)]. It is required that at least one attribute in your model has the [OrderBy(IsDefault = true)]. This because a person could be performing paging without specifying an order by column. As you may recall the LINQ Skip method now requires that you call an OrderBy method before it. Therefore we need a default order by column to perform paging. The extension method adds a order expressoin tree to the IQueryable and calls the MVCContrib AsPagination extension method to page the data. Implementation Notes Auto Postback The search filter region auto performs a get request anytime the dropdown selection is changed. This is implemented using the following jQuery snippet $(document).ready(function () { $("#productSearch").change(function () { this.submit(); }); }); Strongly Typed View The code used in the Action method is shown below: public ActionResult Index(ProductViewModel productFilters, PageSortOptions pageSortOptions) { var productPagedList = productRepository.GetProductsProjected().AsFiltered(productFilters).AsPagination(pageSortOptions);   var productViewFilterContainer = new ProductViewFilterContainer(); productViewFilterContainer.Fill(productFilters.CategoryID, productFilters.SupplierID, productFilters.ProductName);   var gridSortOptions = new GridSortOptions { Column = pageSortOptions.Column, Direction = pageSortOptions.Direction };   var productListContainer = new ProductListContainerModel { ProductPagedList = productPagedList, ProductViewFilterContainer = productViewFilterContainer, GridSortOptions = gridSortOptions };   return View(productListContainer); } As you see above, the object that is returned to the view is of type ProductListContainerModel. This contains all the information need for the view to render the Search filter section (including dropdowns),  the Html.Pager (MVCContrib) and the Html.Grid (from MVCContrib). It also stores the state of the search filters so that they can recreate themselves when the page reloads (Viewstate, I miss you! :0)  The class diagram for the container class is shown below.   Custom MVCContrib Grid The MVCContrib grid default behavior was overridden so that it would auto generate the columns and format the columns based on the metadata and also make it aware of our custom attributes (see MetaDataGridModel in the sample code). The Grid ensures that the ShowForDisplay on the column is set to true This can also be set by the ScaffoldColumn attribute ref: http://bradwilson.typepad.com/blog/2009/10/aspnet-mvc-2-templates-part-2-modelmetadata.html) Column headers are set using the DisplayName attribute Column sorting is set using the OrderBy attribute. The data is formatted using the DisplayFormat attribute. Generic Extension methods for Sorting and Filtering The extension method AsFiltered takes in an IQueryable<T> and uses expression trees to query against the IQueryable data. The query is constructed using the Model metadata and the properties of the T filter (productFilters in our case). Properties in the Model that do not have the SearchFilter attribute are skipped when creating the filter expression tree.  It returns an IQueryable<T>. The extension method AsPagination takes in an IQuerable<T> and first ensures that the column being sorted on has the OrderBy attribute. If not, we look for the default OrderBy column ([OrderBy(IsDefault = true)]). We then build an expression tree to sort on this column. We finally hand off the call to the MVCContrib AsPagination which returns an IPagination<T>. This type as you can see in the class diagram above is passed to the view and used by the MVCContrib Grid and Pager components. Custom Provider To get the system to recognize our custom attributes, we create our MetadataProvider as mentioned in this article (http://bradwilson.typepad.com/blog/2010/01/why-you-dont-need-modelmetadataattributes.html) protected override ModelMetadata CreateMetadata(IEnumerable<Attribute> attributes, Type containerType, Func<object> modelAccessor, Type modelType, string propertyName) { ModelMetadata metadata = base.CreateMetadata(attributes, containerType, modelAccessor, modelType, propertyName);   SearchFilterAttribute searchFilterAttribute = attributes.OfType<SearchFilterAttribute>().FirstOrDefault(); if (searchFilterAttribute != null) { metadata.AdditionalValues.Add(Globals.SearchFilterAttributeKey, searchFilterAttribute); }   OrderByAttribute orderByAttribute = attributes.OfType<OrderByAttribute>().FirstOrDefault(); if (orderByAttribute != null) { metadata.AdditionalValues.Add(Globals.OrderByAttributeKey, orderByAttribute); }   return metadata; } We register our MetadataProvider in Global.asax.cs. protected void Application_Start() { AreaRegistration.RegisterAllAreas();   RegisterRoutes(RouteTable.Routes);   ModelMetadataProviders.Current = new MvcFlan.QueryModelMetaDataProvider(); } Bugs, Comments and Suggestions are welcome! You can download the sample code below. This code is purely experimental. Use at your own risk. Download Sample Code (VS 2010 RTM) MVCNorthwindSales.zip

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • Oracle HRMS API –Update Employee Fed Tax Rule

    - by PRajkumar
    API --  pay_federal_tax_rule_api.update_fed_tax_rule Example -- DECLARE    lb_correction                              BOOLEAN;    lb_update                                   BOOLEAN;    lb_update_override                 BOOLEAN;    lb_update_change_insert      BOOLEAN;    ld_effective_start_date            DATE;    ld_effective_end_date             DATE;    ln_assignment_id                     NUMBER                    := 33561;    lc_dt_ud_mode                          VARCHAR2(100)     := NULL;    ln_object_version_number     NUMBER                    := 0;    ln_supp_tax_override_rate    PAY_US_EMP_FED_TAX_RULES_F.SUPP_TAX_OVERRIDE_RATE%TYPE;    ln_emp_fed_tax_rule_id         PAY_US_EMP_FED_TAX_RULES_F.EMP_FED_TAX_RULE_ID%TYPE; BEGIN    -- Find Date Track Mode    -- -------------------------------    dt_api.find_dt_upd_modes    (   -- Input data elements        -- ------------------------------       p_effective_date                   => TO_DATE('12-JUN-2011'),       p_base_table_name            => 'PER_ALL_ASSIGNMENTS_F',       p_base_key_column           => 'ASSIGNMENT_ID',       p_base_key_value               => ln_assignment_id,       -- Output data elements       -- -------------------------------       p_correction                          => lb_correction,       p_update                                => lb_update,       p_update_override              => lb_update_override,       p_update_change_insert   => lb_update_change_insert   );    IF ( lb_update_override = TRUE OR lb_update_change_insert = TRUE )  THEN      -- UPDATE_OVERRIDE      -- --------------------------------      lc_dt_ud_mode := 'UPDATE_OVERRIDE';  END IF;    IF ( lb_correction = TRUE )  THEN     -- CORRECTION     -- ----------------------     lc_dt_ud_mode := 'CORRECTION';  END IF;    IF ( lb_update = TRUE )  THEN      -- UPDATE      -- -------------      lc_dt_ud_mode := 'UPDATE';  END IF;       -- Update Employee Fed Tax Rule   -- ----------------------------------------------   pay_federal_tax_rule_api.update_fed_tax_rule   (   -- Input data elements       -- -----------------------------       p_effective_date                        => TO_DATE('20-JUN-2011'),       p_datetrack_update_mode   => lc_dt_ud_mode,       p_emp_fed_tax_rule_id         => 7417,       p_withholding_allowances  => 100,       p_fit_additional_tax                => 10,       p_fit_exempt                               => 'N',       p_supp_tax_override_rate     => 5,       -- Output data elements       -- --------------------------------      p_object_version_number       => ln_object_version_number,      p_effective_start_date               => ld_effective_start_date,      p_effective_end_date                => ld_effective_end_date   );    COMMIT; EXCEPTION           WHEN OTHERS THEN                          ROLLBACK;                          dbms_output.put_line(SQLERRM); END; / SHOW ERR;  

    Read the article

  • Looking for good Regex book

    - by Cyberherbalist
    I've been trying to get a good grounding with Regular Expressions, and am looking for a single book to do so. I've been going through Amazon.com's listings on this subject, and I've identified a few possibilities, but am unsure which would be best for a C# developer who can write very simple Regexs, but wants to learn more. On a scale of 0-9 where 0 is knowing how to spell "Regex" but nothing else, and 9 where I could write a book on the subject out of my own head, I would place myself at 2. Which of the following would be your choice: Mastering Regular Expressions by Jeffrey E F Friedl Regular Expressions Cookbook by Jan Goyvaerts and Steven Levithan Sams Teach Yourself Regular Expressions in 10 Minutes by Ben Forta Beginning Regular Expressions (Programmer to Programmer) by Andrew Watt Regular Expression Recipes for Windows Developers: A Problem-Solution Approach by Nathan A. Good Regular Expression Recipes: A Problem-Solution Approach by Nathan A. Good Now, according to Amazon, "Regular Expressions Cookbook" (REC) above is rated the highest according to user ratings, but only based on 20 reviews. The first one, "Mastering Regular Expressions" (MRE) is rated second based on 140 reviews. This alone suggests that MRE might be by far the best one. But is it best for a relative beginner? Would I perhaps be better getting "Beginning Regular Expressions" (BRE) instead, to start with? Please help me resolve my confusion!

    Read the article

  • Loading a Template From a User Control

    - by Ricardo Peres
    What if you wanted to load a template (ITemplate property) from an external user control (.ascx) file? Yes, it is possible; there are a number of ways to do this, the one I'll talk about here is through a type converter. You need to apply a TypeConverterAttribute to your ITemplate property where you specify a custom type converter that does the job. This type converter relies on InstanceDescriptor. Here is the code for it: public class TemplateTypeConverter: TypeConverter { public override Boolean CanConvertFrom(ITypeDescriptorContext context, Type sourceType) { return ((sourceType == typeof(String)) || (base.CanConvertFrom(context, sourceType) == true)); } public override Boolean CanConvertTo(ITypeDescriptorContext context, Type destinationType) { return ((destinationType == typeof(InstanceDescriptor)) || (base.CanConvertTo(context, destinationType) == true)); } public override Object ConvertTo(ITypeDescriptorContext context, CultureInfo culture, Object value, Type destinationType) { if (destinationType == typeof(InstanceDescriptor)) { Object objectFactory = value.GetType().GetField("_objectFactory", BindingFlags.NonPublic | BindingFlags.Instance).GetValue(value); Object builtType = objectFactory.GetType().BaseType.GetField("_builtType", BindingFlags.NonPublic | BindingFlags.Instance).GetValue(objectFactory); MethodInfo loadTemplate = typeof(TemplateTypeConverter).GetMethod("LoadTemplate"); return (new InstanceDescriptor(loadTemplate, new Object [] { "~/" + (builtType as Type).Name.Replace('_', '/').Replace("/ascx", ".ascx") })); } return base.ConvertTo(context, culture, value, destinationType); } public static ITemplate LoadTemplate(String virtualPath) { using (Page page = new Page()) { return (page.LoadTemplate(virtualPath)); } } } And, on your control: public class MyControl: Control { [Browsable(false)] [TypeConverter(typeof(TemplateTypeConverter))] public ITemplate Template { get; set; } } This allows the following declaration: Hope this helps! SyntaxHighlighter.config.clipboardSwf = 'http://alexgorbatchev.com/pub/sh/2.0.320/scripts/clipboard.swf'; SyntaxHighlighter.brushes.CSharp.aliases = ['c#', 'c-sharp', 'csharp']; SyntaxHighlighter.brushes.Xml.aliases = ['xml']; SyntaxHighlighter.all();

    Read the article

  • Optimize SUMMARIZE with ADDCOLUMNS in Dax #ssas #tabular #dax #powerpivot

    - by Marco Russo (SQLBI)
    If you started using DAX as a query language, you might have encountered some performance issues by using SUMMARIZE. The problem is related to the calculation you put in the SUMMARIZE, by adding what are called extension columns, which compute their value within a filter context defined by the rows considered in the group that the SUMMARIZE uses to produce each row in the output. Most of the time, for simple table expressions used in the first parameter of SUMMARIZE, you can optimize performance by removing the extended columns from the SUMMARIZE and adding them by using an ADDCOLUMNS function. In practice, instead of writing SUMMARIZE( <table>, <group_by_column>, <column_name>, <expression> ) you can write: ADDCOLUMNS(     SUMMARIZE( <table>, <group by column> ),     <column_name>, CALCULATE( <expression> ) ) The performance difference might be huge (orders of magnitude) but this optimization might produce a different semantic and in these cases it should not be used. A longer discussion of this topic is included in my Best Practices Using SUMMARIZE and ADDCOLUMNS article on SQLBI, which also include several details about the DAX syntax with extended columns. For example, did you know that you can create an extended column in SUMMARIZE and ADDCOLUMNS with the same name of existing measures? It is *not* a good thing to do, and by reading the article you will discover why. Enjoy DAX!

    Read the article

  • Unable to uninstall maas completely

    - by user210844
    I'm not able to uninstall MAAS sudo apt-get purge maas ; sudo apt-get autoremove Reading package lists... Done Building dependency tree Reading state information... Done Package 'maas' is not installed, so not removed 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1) Reading package lists... Done Building dependency tree Reading state information... Done 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

< Previous Page | 104 105 106 107 108 109 110 111 112 113 114 115  | Next Page >