Search Results

Search found 14260 results on 571 pages for 'regex group'.

Page 108/571 | < Previous Page | 104 105 106 107 108 109 110 111 112 113 114 115  | Next Page >

  • Search for specific call in asterisk log files

    - by chiborg
    In my Asterisk log file, I have a line like this (truncated): Executing [123@mycontext:1] Set("SIP/myhost-b7111840", "__INCOMINGCLI=4711") Now I want to do the following filtering while looking at the log file with tail -f: Match lines with a specific value for "INCOMINGCLI", storing the call ID (the "SIP/myhost-b7111840" part) Output all subsequent lines that contain the call ID. As a bonus, having a grep-like option like -A would be nice. I could do that easily in various programming languages, but how would I do it with standard UNIX commands like sed or awk? Can it be done with these commands?

    Read the article

  • Default user logon on Windows Server system

    - by Robert Koritnik
    I installed Remote Desktop Services role (ex Terminal Services) on my Windows Server 2008 R2 machine. After installation when I try to logon locally, there's no default user as it used to be. Can I tweak group policy to have my default user back? I did enable to remember last logon user, but it didn't work... Obviously RDS (ex TS) ignores this policy setting. Additional note: I'm not connected to a domain. It's a standalone development machine running server OS. No domain needed for it.

    Read the article

  • Zabbix doesn't update value from file neither with log[] nor with vfs.file.regexp[] item

    - by tymik
    I am using Zabbix 2.2. I have a very specific environment, where I have to generate desired data to file via script, then upload that file to ftp from host and download it to Zabbix server from ftp. After file is downloaded, I check it with log[] and vfs.file.regexp[] items. I use these items as below: log[/path/to/file.txt,"C.*\s([0-9]+\.[0-9])$",Windows-1250,,"all",\1] vfs.file.regexp[/path/to/file.txt,"C.*\s([0-9]+\.[0-9])$",Windows-1250,,,\1] The line I am parsing looks like below: C: 8195Mb 5879Mb 2316Mb 28.2 The value I want to extract is 28.2 at the end of file. The problem I am currently trying to solve is that when I update the file (upload from host to ftp, then download from ftp to Zabbix server), the value does not update. I was trying only log[] at start, but I suspect, that log[] treat the file as real log file and doesn't check the same lines (althought, following the documentation, it should with "all" value), so I added vfs.file.regexp[] item too. The log[] has received a value in past, but it doesn't update. The vfs.file.regexp[] hasn't received any value so far. file.txt has got reuploaded and redownloaded several times and situation doesn't change. It seems that log[] reads only new lines in the file, it doesn't check lines already caught if there are any changes. The zabbix_agentd.log file doesn't report any problem with access to file, nor with regexp construction (it did report "unsupported" for log[] key, when I had something set up wrong). I use debug logging level for agent - I haven't found any interesting info about that problem. I have no idea what I might be doing wrong or what I do not know about how Zabbix is performing these checks. I see 2 solutions for that: adding more lines to the file instead of making new one or making new files and check them with logrt[], but those doesn't satisfy my desires. Any help is greatly appreciated. Of course I will provide additional information, if requested - for now I don't know what else might be useful.

    Read the article

  • Volume expanded in Volume Group, old disk reduced but still in use in system

    - by Yurij73
    Tryed to add a new hard sdb (not formated) to my virtualbox Centos. Successfully extended an existing vg_localhost to /dev/sdb/ # lvdisplay --- Logical volume --- LV Path /dev/vg_localhost/lv_root LV Name lv_root VG Name vg_localhost LV UUID DkYX7D-DMud-vLaI-tfnz-xIJJ-VzHz-bRp3tO LV Write Access read/write LV Creation host, time localhost.centos, 2012-12-17 LV Status available # open 1 LV Size 18,03 GiB Current LE 4615 Segments 2 Allocation inherit Read ahead sectors auto - currently set to 256 Block device 253:0 lsblk NAME MAJ:MIN RM SIZE RO TYPE MOUNTPOINT sdb 8:16 0 20G 0 disk +-vg_localhost-lv_root (dm-0) 253:0 0 18G 0 lvm / +-vg_localhost-lv_swap (dm-1) 253:1 0 2G 0 lvm [SWAP] sda 8:0 0 9G 0 disk +-sda1 8:1 0 500M 0 part /boot +-sda2 8:2 0 8,5G 0 part sr0 11:0 1 1024M 0 rom df -h /dev/mapper/vg_localhost-lv_root 6,5G 6,2G 256M 97% / tmpfs 499M 200K 499M 1% /dev/shm /dev/sda1 485M 78M 382M 17% /boot it still old sda in use, what i have to do further?

    Read the article

  • Custom layout/group switching keys in Linux

    - by abyx
    I'm using Ubuntu (Karmic) and 2 keyboard layouts. Using the gnome settings, I managed to set it to switch with Alt+Shift (windows style), but I really want to limit it to Right Alt + Right Shift, but that option isn't available in the gnome wizard. I've opened gconf-editor and found the kbd configuration, but trying to add 'r' or 'right_' prefixes to the keys didn't help. Is this possible?

    Read the article

  • Change number in last row in data seperated with commas in NotePad++

    - by user329311
    I have rows of data all separated with commas. How can I replace the last numbers after the last commas with the number 5 in NotePad++? For example: How do I replace 9, 17 and 124 with 5 in the below data? I have millions of rows though of data and Excel doesn't have enough rows for all the data. Sample data: 2009.10.21,05:31,1.49312,1.49312,1.49306,1.49306,9 2009.10.21,05:32,1.49306,1.49308,1.49303,1.49305,17 2009.10.21,05:33,1.49305,1.4931,1.49305,1.49309,124 Thank you for your help.

    Read the article

  • Multiple redirects / rewrites within one VirtualHost group

    - by Benjamin Dell
    Hi, I have a client that now wants to point a couple of dozen urls to their main site. I have added them as serveralias's in the sites apache config file... so now all of these urls point to the primary one... excellent. The problem i have is that if ANY of these alias's are accessed at the root (i.e. www.domain.com rather than www.domain.com/some-page/) then i need to redirect them to a specific page within the site (i.e. anyone accessing domain.com might need to be sent to domain.com/special-landing-page/). However, any visit to anything other than the landing page should just continue as normal without any re-directs. I've been battling with this for a few hours and can't seem to find the best solution. Does anyone have any suggestions?

    Read the article

  • sed: replace only the first range of numbers

    - by Marit Hoen
    Imagine I have an input file like this: INSERT INTO video_item_theme VALUES('9', '29'); INSERT INTO video_item_theme VALUES('19', '312'); INSERT INTO video_item_theme VALUES('414', '1'); And I wish to add 10000 to only the first range of numbers, so I end up with something like this: INSERT INTO video_item_theme VALUES('10009', '29'); INSERT INTO video_item_theme VALUES('10019', '312'); INSERT INTO video_item_theme VALUES('10414', '1'); My approach would be to prefix "1000" to one digit numbers, "100" Something like...: sed 's/[0-9]\{2\}/10&/g' ... isn't very helpful, since it changes each occurance of two numbers, not only in the first occurance of numbers: INSERT INTO video_item_theme VALUES('9', '10029'); INSERT INTO video_item_theme VALUES('10019', '100312'); INSERT INTO video_item_theme VALUES('100414', '1');

    Read the article

  • nginx rewrite base url

    - by ptn777
    I would like the root url http://www.example.com to redirect to http://www.example.com/something/else This is because some weird WP plugin always sets a cookie on the base url, which doesn't let me cache it. I tried this directive: location / { rewrite ^ /something/else break; } But 1) there is no redirect and 2) pages start shooting more than 1,000 requests to my server. With this one: location / { rewrite ^ http://www.example.com/something/else break; } Chrome reports a redirect loop. What's the correct regexp to use?

    Read the article

  • set chars to uppercase between parenthesis

    - by emzap79
    let's assume in vim I have following lines: all what (strong) people have to do is pushing (heavy) weights over (and over) again in order to gain muscles and I need to convert words inside parenthesis to uppercase, what is the most convenient way to do so? How do I tell vim it needs to select everything to the first (!) closing parenthesis? So far I came up with :%s/\s(.*)\s/\U&/g unfortunately this will uppercase everything between 'strong' and 'heavy' which is not what I want. Any chance to tell vim it should select the chars to the next closing bracket only? (sorry for the silly example, couldn't think of something more sophisticated... or at least vim related... huh)

    Read the article

  • How can I delete everything after the first column in Notepad++?

    - by Bob J
    I'm trying to get rid of everything after a column in Notepad++. Column mode is not an option. Is it possible? What I have 70.97.110.40 159 ms [n/a] 21 70.97.117.177 134 ms [n/a] 21 70.97.120.10 75 ms [n/a] 21 70.97.122.105 87 ms www.portless.net 21 70.97.122.106 89 ms www.popovetsky.org 21 70.97.122.107 95 ms www.psmythe.net 21 70.97.122.104 98 ms wasabi.prostructure.com 21 70.97.122.108 89 ms crm.prostructure.com 21 70.97.122.109 87 ms internal.prostructure.com21 What I want 70.97.110.40 70.97.117.177 70.97.120.10 70.97.122.105 70.97.122.106 70.97.122.107 70.97.122.104 70.97.122.108 70.97.122.109 Thanks

    Read the article

  • Convert from apache rewrite to nginx

    - by Linux Intel
    I want to convert from apache rewrite modules to nginx RewriteCond %{QUERY_STRING} mosConfig_[a-zA-Z_]{1,21}(=|\%3D) [OR] RewriteCond %{QUERY_STRING} base64_encode.*\(.*\) [OR] RewriteCond %{QUERY_STRING} (\<|%3C).*script.*(\>|%3E) [NC,OR] RewriteCond %{QUERY_STRING} GLOBALS(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} _REQUEST(=|\[|\%[0-9A-Z]{0,2}) RewriteCond %{QUERY_STRING} SELECT(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} UNION(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} UPDATE(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteRule ^([^.]*)/?$ index.php [L] RewriteRule ^domain/trial/cms$ index/index.php?%{QUERY_STRING} [L] RewriteCond %{HTTP:Range} ([a-z]+) [NC] RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteCond %{ENV:byte-ranges-specifier} !^$ RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteCond %{HTTP_USER_AGENT} !^Mozilla/5 [NC] RewriteCond %{HTTP_USER_AGENT} !^Mozilla/4 [NC] RewriteCond %{HTTP_USER_AGENT} !^Opera [NC] RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteRule ^$ index/index.php?%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)$ sss.php?encrypted=$1&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)/([^/^.]*)$ sss.php?tab=$1&page=$2&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)/([^/^.]*)/([^.]*)$ sss.php?tab=$1&page=$2&queryString=$3&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !security.php [NC] RewriteRule ^([^/]*)$ index/$1?%{QUERY_STRING} [L] I tried to convert it by online tools such as : http://www.anilcetin.com/convert-apache-htaccess-to-nginx/ but it didn't convert it correctly. The conversion output is : if ($args ~ "mosConfig_[a-zA-Z_]{1,21}(=|%3D)"){ set $rule_0 1; } if ($args ~ "base64_encode.*(.*)"){ set $rule_0 1; } if ($args ~* "(<|%3C).*script.*(>|%3E)"){ set $rule_0 1; } if ($args ~ "GLOBALS(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "_REQUEST(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "SELECT(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "UNION(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "UPDATE(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($rule_0 = "1"){ rewrite ^/([^.]*)/?$ /index.php last; } if ($rule_1 = ""){ rewrite ^/domain/trial/cms$ /index/index.php?$args last; } if ($http_range ~* "([a-z]+)"){ set $rule_2 1$rule_2; } if ($rule_2 = "1"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } #ignored: condition 0 if ($rule_3 = "1"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } if ($http_user_agent !~* "^Mozilla/5"){ set $rule_4 1$rule_4; } if ($http_user_agent !~* "^Mozilla/4"){ set $rule_4 2$rule_4; } if ($http_user_agent !~* "^Opera"){ set $rule_4 3$rule_4; } if ($rule_4 = "321"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } if ($rule_5 = ""){ rewrite ^/$ /index/index.php?$args last; } if ($uri !~* "sss.php"){ set $rule_6 1$rule_6; } if ($uri !~* "m-administrator"){ set $rule_6 2$rule_6; } if ($rule_6 = "21"){ rewrite ^/([^/^.]*)$ /sss.php?encrypted=$1&$args last; } if ($uri !~* "sss.php"){ set $rule_7 1$rule_7; } if ($uri !~* "m-administrator"){ set $rule_7 2$rule_7; } if ($rule_7 = "21"){ rewrite ^/([^/^.]*)/([^/^.]*)$ /sss.php?tab=$1&page=$2&$args last; } if ($uri !~* "sss.php"){ set $rule_8 1$rule_8; } if ($uri !~* "m-administrator"){ set $rule_8 2$rule_8; } if ($rule_8 = "21"){ rewrite ^/([^/^.]*)/([^/^.]*)/([^.]*)$ /sss.php?tab=$1&page=$2&queryString=$3&$args last; } if ($uri !~* "sss.php"){ set $rule_9 1$rule_9; } if ($uri !~* "security.php"){ set $rule_9 2$rule_9; } if ($rule_9 = "21"){ rewrite ^/([^/]*)$ /index/$1?$args last; } Please help me with the proper conversion result for nginx in order to work perfectly.

    Read the article

  • Textmate: Find and replace across project with contents of one file from said project

    - by griotspeak
    I have a regular expression to find the text I want (I wrapped the relevant section in custom tags), and I can do it by hand without much issue, but what I want is a way to automatically find and replace throughout the entire project. A macro seems like an OK idea, but it would be nice to have a command (to edit and tweak). sed seems like a good bet, but I am pretty unfamiliar with it. I am not so much asking for a complete solution as I am asking for an example that does something close to what I want. I don't really know of a good way to start.

    Read the article

  • How do I make sdiff ignore the * character?

    - by Runcible
    Here's what I'm sure is an easy one, but I can't figure it out. I have two files: file1: You are in a maze of twisty little passages, all alike file2: You are in a maze of twisty little* passages, all alike I want to perform sdiff on these files, but I want to ignore the * character. How do I do this?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Regular expression in mySQL [migrated]

    - by Rayne
    I have a mysql table that has 2 columns - Column 1 contains a string value, and Column 2 contains the number of times that string value occurred. I'm trying to find the string abc.X.def, where the beginning of the string is "abc.", followed by one or more characters, then the string ".def". There could be more characters following ".def". How can I find such strings, then add the occurrence of such strings and display the results? For example, if I have abc.111.def23 1 abc.111.def 2 abc.22.def444 1 abc.111.def 1 Then I will get abc.111.def23 1 abc.111.def 3 abc.22.def444 1 Thank you.

    Read the article

  • Regex working in RedHat is not giving any result in Ubuntu

    - by Supratik
    My goal is to match specific files from specific sub directories. I have the following folder structure `-- data |-- a |-- a.txt |-- b |-- b.txt |-- c |-- c.txt |-- d |-- d.txt |-- e |-- e.txt |-- org-1 | |-- a.org | |-- b.org | |-- org.txt | |-- user-0 | | |-- a.txt | | |-- b.txt I am trying to list the files only inside the data directory. I am able to get the correct result using the following command in RHEL find ./testdir/ -iwholename "*/data/[!/].txt" a.txt b.txt c.txt d.txt e.txt If I run the same command in Ubuntu it is not working. Can anyone please tell me why it is not working in Ubuntu ?

    Read the article

  • Regular Expression for "AND"?

    - by Kevin
    Let's say I gave you the following text: allow_httpd_anon_write --> off allow_httpd_mod_auth_ntlm_winbind --> off allow_httpd_mod_auth_pam --> off allow_httpd_sys_script_anon_write --> off httpd_builtin_scripting --> on httpd_can_check_spam --> off httpd_can_network_connect --> off httpd_can_network_connect_cobbler --> off httpd_can_network_connect_db --> off httpd_can_network_memcache --> off httpd_can_network_relay --> off httpd_can_sendmail --> off httpd_dbus_avahi --> on httpd_enable_cgi --> on httpd_enable_ftp_server --> off httpd_enable_homedirs --> on httpd_execmem --> off httpd_read_user_content --> off httpd_setrlimit --> off httpd_ssi_exec --> off httpd_tmp_exec --> off httpd_tty_comm --> on httpd_unified --> on httpd_use_cifs --> off httpd_use_gpg --> off httpd_use_nfs --> off What I want to do is create a regular expression that can parse text like this looking for two or more words on the same line. For example, if I was looking for a SELinux boolean that covered "ftp" AND "home" on the same line, I would currently do the following: getsebool -a | grep -i ftp | grep -i home However, I am looking for a regular expression that does the same thing. Specifically, find all of the words in any order on a line...

    Read the article

  • Misbehavior in regular expression in VIM

    - by poissonbreaker
    I am having a problem with a regular expression on vim. I have a pattern as follows: http:\/\/\(\w\+\.\?\)\+ [matches http://(AS MANY WORDS FOLLOWED BY DOT OR NOT ENCOUNTERS) e.g. http://wd1.wd2.com] I have a text as follows: http://wd1.wd2.com/wd3 I am trying to make this substitution on it: s/\(http:\/\/\)\(\w\+\.\?\)\+/\1wd4.wd5.com and the result is http://wd4.wd5.com /wd3 (Notice the white space inserted at the end of the replacement) How can I avoid having this inserted space? I am afraid is a bug in the regexp engine but I am not sure.

    Read the article

  • NotePad++ - Why Does Finding ^ Not Work

    - by ChloeRadshaw
    I am trying to move away from TextPad and I just cant get reg expressions like ^ and $ to be replaced. I have definitely ticked the regular expression box What am I doing wrong EDIT: I am trying to find the start of a new line - In textpad it is find '^' and ensure reg ex is enabled. With notepad++ it does not do that. It just says not found

    Read the article

  • use correct-resolution background desktop image

    - by Rob Bos
    I have a desktop background image (a picture) in a half-dozen different resolutions, that I'd like to deploy to a disparate collection of computers with different monitors and video cards and whatnot. Laptops, netbooks, desktops, widescreen, and even a couple of "tall" screens. I have images to cover most of the cases. I would like Windows 7 to correctly pick the correct desktop background image via group policy. Now, the logon screen is already done. The OEMBackground method is rather clever, and lets you copy files of different resolutions to the machine, and the logon app will calculate the aspect ratio of the monitor and match it to a file as closely as possible. Is there any way to have that functionality on the desktop background as well?

    Read the article

  • Nginx HTTPS when only matching admin subfolder

    - by sebastyuiop
    I have managed to get all /admin requests redirected to https by: server { listen 80; location /admin { rewrite ^ https://$server_name$request_uri?$args permanent; } } But can't figure out how to get all https requests that are not within /admin redirected to http, so far I have: server { listen 443; location ~ /admin { rewrite ^ http://$server_name$request_uri?$args permanent; } } EDIT: I have got the redirects working as required but can't stop the /admin url going to 404. It feels like I need to put something in the empty block. server { listen 443; location /admin { } location / { rewrite ^ http://$server_name$request_uri?$args permanent; } } Thanks

    Read the article

  • Request exceeded the limit of 10

    - by Webnet
    My logs are FULL of [Tue Jan 11 10:20:45 2011] [error] [client 99.162.115.123] Request exceeded the limit of 10 internal redirects due to probable configuration error. Use 'LimitInternalRecursion' to increase the limit if necessary. Use 'LogLevel debug' to get a backtrace., referer: https://www.domain.com/vehicles/Chevrolet/Uplander/2006 The problem is when I enable LogLevel debug we get HUGE error logs because all of our traffic is SSL. From what I can tell the file doesn't record these errors anymore, either that or it's so buried in SSL logs that I just can't find them. Here's my .htaccess Options -indexes RewriteEngine On RewriteRule ^battery/([^/]+)$ /browser/product?sku=BATTERY+$1&type=battery RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)/product([0-9]+)$ /browser/index.php?make=$1&model=$2&id=$3&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)/([0-9]+)$ /browser/product.php?make=$1&model=$2&year=$3&id=$4&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)$ /store/product/list.php?make=$1&model=$2&year=$3&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)$ /vehicle/make/model/year/list.php?make=$1&model=$2&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)$ /vehicle/make/model/list.php?make=$1&%{QUERY_STRING} [L,NC]

    Read the article

  • Users own mapped network drives disappear when I set a GPP mapped drive

    - by Kim
    All the clients use Windows 7 SP1 x64 Enterprise. The domain controllers are Windows Server 2008 R2. I have configured the GPP to map "\server\data" to first available drive letter starting with I:. The action is replace and I have set the Hide/Show this drive and Hide/Show all drives to "Show". I have set targeting to a specified security group. This works as expected and the drive is mapped to the correct users. The problem is that if the user has created their own mapped drives these mappings will disappear when the GPP mapping is applied. Only the mapped drives from the GPP is shown in Explorer. I have not found any other mention of this particular problem when I search the Internet and on TechNet there is no mention of what happens to drives already mapped.

    Read the article

< Previous Page | 104 105 106 107 108 109 110 111 112 113 114 115  | Next Page >