Search Results

Search found 37183 results on 1488 pages for 'string conversion'.

Page 108/1488 | < Previous Page | 104 105 106 107 108 109 110 111 112 113 114 115  | Next Page >

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • Connecting Samsung Note 3 to Hitachi CPX3030WN via Samsung MHL 2.0 HD kit , Will there be video output? [on hold]

    - by Monolord's Knight
    I need the video output to projector. but nobody can assure me this may work or not. some says yes some says no.But they have no real experience. Some says an special android app is required for this. Depending on this answer, I will purchase Samsung MHL 2.0 cable . If it wont work it will be no use for me. I don't have a way to change my phone or projector. Just want to know will it work or not. Thanks

    Read the article

  • how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

    - by user60065
    Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

    Read the article

  • DexFile.class error in eclipse

    - by ninjasense
    I get this weird error everytime I debug in eclipse. It just seemed to appear one day and I was wondering if anyone else was running int the same problem. It does not affect my app in anyway visibly and does not cause a crash but it is an annoyance while debugging. Here is the full error: // Compiled from DexFile.java (version 1.5 : 49.0, super bit) public final class dalvik.system.DexFile { // Method descriptor #8 (Ljava/io/File;)V // Stack: 3, Locals: 2 public DexFile(java.io.File file) throws java.io.IOException; 0 aload_0 [this] 1 invokespecial java.lang.Object() [1] 4 new java.lang.RuntimeException [2] 7 dup 8 ldc <String "Stub!"> [3] 10 invokespecial java.lang.RuntimeException(java.lang.String) [4] 13 athrow Line numbers: [pc: 0, line: 4] Local variable table: [pc: 0, pc: 14] local: this index: 0 type: dalvik.system.DexFile [pc: 0, pc: 14] local: file index: 1 type: java.io.File // Method descriptor #18 (Ljava/lang/String;)V // Stack: 3, Locals: 2 public DexFile(java.lang.String fileName) throws java.io.IOException; 0 aload_0 [this] 1 invokespecial java.lang.Object() [1] 4 new java.lang.RuntimeException [2] 7 dup 8 ldc <String "Stub!"> [3] 10 invokespecial java.lang.RuntimeException(java.lang.String) [4] 13 athrow Line numbers: [pc: 0, line: 5] Local variable table: [pc: 0, pc: 14] local: this index: 0 type: dalvik.system.DexFile [pc: 0, pc: 14] local: fileName index: 1 type: java.lang.String // Method descriptor #22 (Ljava/lang/String;Ljava/lang/String;I)Ldalvik/system/DexFile; // Stack: 3, Locals: 3 public static dalvik.system.DexFile loadDex(java.lang.String sourcePathName, java.lang.String outputPathName, int flags) throws java.io.IOException; 0 new java.lang.RuntimeException [2] 3 dup 4 ldc <String "Stub!"> [3] 6 invokespecial java.lang.RuntimeException(java.lang.String) [4] 9 athrow Line numbers: [pc: 0, line: 6] Local variable table: [pc: 0, pc: 10] local: sourcePathName index: 0 type: java.lang.String [pc: 0, pc: 10] local: outputPathName index: 1 type: java.lang.String [pc: 0, pc: 10] local: flags index: 2 type: int // Method descriptor #28 ()Ljava/lang/String; // Stack: 3, Locals: 1 public java.lang.String getName(); 0 new java.lang.RuntimeException [2] 3 dup 4 ldc <String "Stub!"> [3] 6 invokespecial java.lang.RuntimeException(java.lang.String) [4] 9 athrow Line numbers: [pc: 0, line: 7] Local variable table: [pc: 0, pc: 10] local: this index: 0 type: dalvik.system.DexFile // Method descriptor #30 ()V // Stack: 3, Locals: 1 public void close() throws java.io.IOException; 0 new java.lang.RuntimeException [2] 3 dup 4 ldc <String "Stub!"> [3] 6 invokespecial java.lang.RuntimeException(java.lang.String) [4] 9 athrow Line numbers: [pc: 0, line: 8] Local variable table: [pc: 0, pc: 10] local: this index: 0 type: dalvik.system.DexFile // Method descriptor #32 (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/lang/Class; // Stack: 3, Locals: 3 public java.lang.Class loadClass(java.lang.String name, java.lang.ClassLoader loader); 0 new java.lang.RuntimeException [2] 3 dup 4 ldc <String "Stub!"> [3] 6 invokespecial java.lang.RuntimeException(java.lang.String) [4] 9 athrow Line numbers: [pc: 0, line: 9] Local variable table: [pc: 0, pc: 10] local: this index: 0 type: dalvik.system.DexFile [pc: 0, pc: 10] local: name index: 1 type: java.lang.String [pc: 0, pc: 10] local: loader index: 2 type: java.lang.ClassLoader // Method descriptor #37 ()Ljava/util/Enumeration; // Signature: ()Ljava/util/Enumeration<Ljava/lang/String;>; // Stack: 3, Locals: 1 public java.util.Enumeration entries(); 0 new java.lang.RuntimeException [2] 3 dup 4 ldc <String "Stub!"> [3] 6 invokespecial java.lang.RuntimeException(java.lang.String) [4] 9 athrow Line numbers: [pc: 0, line: 10] Local variable table: [pc: 0, pc: 10] local: this index: 0 type: dalvik.system.DexFile // Method descriptor #30 ()V // Stack: 3, Locals: 1 protected void finalize() throws java.io.IOException; 0 new java.lang.RuntimeException [2] 3 dup 4 ldc <String "Stub!"> [3] 6 invokespecial java.lang.RuntimeException(java.lang.String) [4] 9 athrow Line numbers: [pc: 0, line: 11] Local variable table: [pc: 0, pc: 10] local: this index: 0 type: dalvik.system.DexFile // Method descriptor #42 (Ljava/lang/String;)Z public static native boolean isDexOptNeeded(java.lang.String arg0) throws java.io.FileNotFoundException, java.io.IOException; } Thanks

    Read the article

  • Parsing with BeautifulSoup, error message TypeError: coercing to Unicode: need string or buffer, NoneType found

    - by Samsun Knight
    so I'm trying to scrape an Amazon page for data, and I'm getting an error when I try to parse for where the seller is located. Here's my code: #getting the html request = urllib2.Request('http://www.amazon.com/gp/offer-listing/0393934241/') opener = urllib2.build_opener() #hiding that I'm a webscraper request.add_header('User-Agent', 'Mozilla/5 (Solaris 10) Gecko') #opening it up, putting into soup form html = opener.open(request).read() soup = BeautifulSoup(html, "html5lib") #parsing for the seller info sellers = soup.findAll('div', {'class' : 'a-row a-spacing-medium olpOffer'}) for eachseller in sellers: #parsing for price price = eachseller.find('span', {'class' : 'a-size-large a-color-price olpOfferPrice a-text-bold'}) #parsing for shipping costs shippingprice = eachseller.find('span' , {'class' : 'olpShippingPrice'}) #parsing for condition condition = eachseller.find('span', {'class' : 'a-size-medium'}) #parsing for seller name sellername = eachseller.find('b') #parsing for seller location location = eachseller.find('div', {'class' : 'olpAvailability'}) #printing it all out print "price, " + price.string + ", shipping price, " + shippingprice.string + ", condition," + condition.string + ", seller name, " + sellername.string + ", location, " + location.string I get the error message, pertaining to the 'print' command at the end, "TypeError: coercing to Unicode: need string or buffer, NoneType found" I know that it's coming from this line - location = eachseller.find('div', {'class' : 'olpAvailability'}) - because the code works fine without that line, and I know that I'm getting NoneType because the line isn't finding anything. Here's the html from the section I'm looking to parse: <*div class="olpAvailability"> In Stock. Ships from WI, United States. <*br/><*a href="/gp/aag/details/ref=olp_merch_ship_9/175-0430757-3801038?ie=UTF8&amp;asin=0393934241&amp;seller=A1W2IX7T37FAMZ&amp;sshmPath=shipping-rates#aag_shipping">Domestic shipping rates</a> and <*a href="/gp/aag/details/ref=olp_merch_return_9/175-0430757-3801038?ie=UTF8&amp;asin=0393934241&amp;seller=A1W2IX7T37FAMZ&amp;sshmPath=returns#aag_returns">return policy</a>. <*/div> (but without the stars - just making sure the HTML doesn't compile out of code form) I don't see what's the problem with the 'location' line of code, or why it's not pulling the data I want. Help?

    Read the article

  • Store comparison in variable (or execute comparison when it's given as an string)

    - by BorrajaX
    Hello everyone. I'd like to know if the super-powerful python allows to store a comparison in a variable or, if not, if it's possible calling/executing a comparison when given as an string ("==" or "!=") I want to allow the users of my program the chance of giving a comparison in an string. For instance, let's say I have a list of... "products" and the user wants to select the products whose manufacturer is "foo". He could would input something like: Product.manufacturer == "foo" and if the user wants the products whose manufacturer is not "bar" he would input Product.manufacturer != "bar" If the user inputs that line as an string, I create a tree with an structure like: != / \ manufacturer bar I'd like to allow that comparison to run properly, but I don't know how to make it happen if != is an string. The "manufacturer" field is a property, so I can properly get it from the Product class and store it (as a property) in the leaf, and well... "bar" is just an string. I'd like to know if I can something similar to what I do with "manufacturer": storing it with a 'callable" (kind of) thing: the property with the comparator: != I have tried with "eval" and it may work, but the comparisons are going to be actually used to query a MySQL database (using sqlalchemy) and I'm a bit concerned about the security of that... Any idea will be deeply appreciated. Thank you! PS: The idea of all this is being able to generate a sqlalchemy query, so if the user inputs the string: Product.manufacturer != "foo" || Product.manufacturer != "bar" ... my tree thing can generate the following: sqlalchemy.or_(Product.manufacturer !="foo", Product.manufacturer !="bar") Since sqlalchemy.or_ is callable, I can also store it in one of the leaves... I only see a problem with the "!="

    Read the article

  • Parsing and getting specific values from CSV string

    - by Amit Ranjan
    I am having a string in CSV format. Please see my earlier question http://stackoverflow.com/questions/2865861/parsing-csv-string-and-binding-it-to-listbox I can add new values to it by some mechanism. Everything will be same except the new values will have numeric part = 0. Take example I have this exsiting CSV string 1 , abc.txt , 2 , def.doc , 3 , flyaway.txt Now by some mechanism i added two more files Superman.txt and Spiderman.txt to the existing string. Now it became 1 , abc.txt , 2 , def.doc , 3 , flyaway.txt, 0, Superman.txt, 0 , Spiderman.txt What i am doing here is that this csv string is paased into SP where its splitted and inserted to db. So for inserting I have to take the files with numeric part 0 only rest will be omiited .Which will be further then converted into CSV string Array will look like this str[0]="1" str[1]="abc.txt" str[2]="2" str[3]="def.doc " str[4]="3" str[5]="flyaway.txt" str[6]="0" str[7]="Superman.txt" str[8]="0" str[9]="Spiderman.txt" So at last i want to say my input will be 1 , abc.txt , 2 , def.doc , 3 , flyaway.txt, 0, Superman.txt, 0 , Spiderman.txt Desired Output: 0, Superman.txt, 0 , Spiderman.txt

    Read the article

  • XamlReader.Parse throws exception on empty String

    - by sub-jp
    In our app, we need to save properties of objects to the same database table regardless of the type of object, in the form of propertyName, propertyValue, propertyType. We decided to use XamlWriter to save all of the given object's properties. We then use XamlReader to load up the XAML that was created, and turn it back into the value for the property. This works fine for the most part, except for empty strings. The XamlWriter will save an empty string as below. <String xmlns="clr-namespace:System;assembly=mscorlib" xml:space="preserve" /> The XamlReader sees this string and tries to create a string, but can't find an empty constructor in the String object to use, so it throws a ParserException. The only workaround that I can think of is to not actually save the property if it is an empty string. Then, as I load up the properties, I can check for which ones did not exist, which means they would have been empty strings. Is there some workaround for this, or is there even a better way of doing this?

    Read the article

  • Why is Collection<String>.class Illegal?

    - by Peter
    I am puzzled by generics. You can declare a field like: Class<Collection<String>> clazz = ... It seems logical that you could assign this field with: Class<Collection<String>> clazz = Collection<String>.class; However, this generates an error: Syntax error on token ">", void expected after this token So it looks like the .class operator does not work with generics. So I tried: class A<S> {} class B extends A<String> {} Class<A<String>> c = B.class; Also does not work, generates: Type mismatch: cannot convert from Class<Test.StringCollection> to Class<Collection<String>> Now, I really fail to see why this should not work. I know generic types are not reified but in both cases it seems to be fully type safe without having access to runtime generic types. Anybody an idea? Peter Kriens

    Read the article

  • How do I import and call unmanaged C dll with ansi string "char *" pointer string from VB.net?

    - by Warren P
    I have written my own function, which in C would be declared like this, using standard Win32 calling conventions: int Thing( char * command, char * buffer, int * BufSize); I have the following amount of VB figured out, which should import the dll and call this function, wrapping it up to make it easy to call Thing("CommandHere",GetDataBackHere): Imports Microsoft.VisualBasic Imports System.Runtime.InteropServices Imports System Imports System.Text Namespace dllInvocationSpace Public Class dllInvoker ' tried attributes but could not make it build: ' <DllImport("Thing1.dll", False, CallingConvention.Cdecl, CharSet.Ansi, "Baton", True, True, False, True)> Declare Ansi Function Thing Lib "Thing1.dll" (ByVal Command As String, ByRef Buffer As String, ByRef BufferLength As Integer) Shared Function dllCall(ByVal Command As String, ByRef Results As String) As Integer Dim Buffer As StringBuilder = New StringBuilder(65536) Dim retCode As Integer Dim bufsz As Integer bufsz = 65536 retCode = Thing(Command, Buffer, bufsz) Results = Buffer Return retCode End Function End Class End Namespace The current code doesn't build, because although I think I should be able to create a "buffer" that the C Dll can write data back into using a string builder, I haven't got it quite right. (Value of type System.Text.STringBuilder cannot be converted to 'String'). I have looked all over the newsgroups and forums and can not find an example where the C dll needs to pass between 1 and 64kbytes of data back (char *buffer, int bufferlen) to visual basic.net.

    Read the article

  • Problem in encoding and decoding the string in Iphone sdk

    - by monish
    HI Guys, Here I am having a problem In encoding/decoding the strings. Actually I had a string which I am encoding it using the base64.which was working fine. And now I need to decode the string that was encoded before and want to print it. I code I written as: I imported the base64.h and base64.m files into my application which contains the methods as: + (NSData *) dataWithBase64EncodedString:(NSString *) string; - (id) initWithBase64EncodedString:(NSString *) string; - (NSString *) base64EncodingWithLineLength:(unsigned int) lineLength; And the code in my view controller where I encode the String is: - (id)init { if (self = [super init]) { // Custom initialization userName = @"Sekhar"; password = @"Bethalam"; } return self; } -(void)reloadView { NSString *authStr = [NSString stringWithFormat:@"%@:%@",userName,password]; NSData *authData = [authStr dataUsingEncoding:NSASCIIStringEncoding]; NSString *authValue = [NSString stringWithFormat:@"%@", [authData base64EncodingWithLineLength:30]]; NSLog(authValue); //const char *str = authValue; //NSString *decStr = [StringEncryption DecryptString:authValue]; //NSLog(decStr); //NSData *decodeData = [NSData decode:authValue]; //NSString *decStr = [NSString stringWithFormat:@"%@",decodeData]; //NSStr //NSLog(decStr); } -(void)viewWillAppear:(BOOL)animated { [self reloadView]; } and now I want to decode the String that I encoded. But I dont know How to do that.can anyone suggest me with code how to get it. Anyone's help will be much appreciated. Thank you, Monish.

    Read the article

  • Capture data read from file into string stream Java

    - by halluc1nati0n
    I'm coming from a C++ background, so be kind on my n00bish queries... I'd like to read data from an input file and store it in a stringstream. I can accomplish this in an easy way in C++ using stringstreams. I'm a bit lost trying to do the same in Java. Following is a crude code/way I've developed where I'm storing the data read line-by-line in a string array. I need to use a string stream to capture my data into (rather than use a string array).. Any help? char dataCharArray[] = new char[2]; int marker=0; String inputLine; String temp_to_write_data[] = new String[100]; // Now, read from output_x into stringstream FileInputStream fstream = new FileInputStream("output_" + dataCharArray[0]); // Convert our input stream to a BufferedReader BufferedReader in = new BufferedReader (new InputStreamReader(fstream)); // Continue to read lines while there are still some left to read while ((inputLine = in.readLine()) != null ) { // Print file line to screen // System.out.println (inputLine); temp_to_write_data[marker] = inputLine; marker++; }

    Read the article

< Previous Page | 104 105 106 107 108 109 110 111 112 113 114 115  | Next Page >