Search Results

Search found 1225 results on 49 pages for 'amit kumar'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 11/49 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • No sigal showing on LCD TV when Conects Leptop via VGA Cable [migrated]

    - by Amit Prajapati
    I am trying to connect my laptop to Samsung LCD TV by VGA TO HDMI cable My Laptop find Samsung tv on display setting. But When I press fn+F7 key my TV display No Signal My laptop specifications are: "Lenovo R61 ThinkPad, Model: 8935AE7 Window7 Ultimate 32 bits 2GB RAM VGA Port available No HDMI Port My TV specification are: Samsung LCD 26 HDMI Port available VGA Port Available I want to know what is problem? When I connect Another Dell Laptop (Window7 32 bit) with HDMI to HDMI cable it work properly. Thanks in Advance!

    Read the article

  • people_dl_import shows millions of records

    - by amit lohogaonkar
    We have a situation now on prod in sharepoint 2007 based intranet platform and it shows thousands of records under people_dl_import category with format spsimport://?$$dl$$/domain1/domain2/domain3/ Also import was not stopping and added millions of records in database and was on verge of disk full. On other servers like dev we have very less data in this category and format is also like spsimport://doaminname?$$dl$$?... which is good and has only 6000 rows and in prod its 2 millions Crawled under people_dl_import category. I need to know the cause of this garbage data and how to fix it. I tried resetting content source and I will do full import in this weekend to see if this garbage data gets cleared. Any idea on cause for thiss issue?

    Read the article

  • C Drive Hard Disk Problem

    - by Amit
    I have Windows XP OS. C: Drive has 7 Gb disk space out of that I can see only 4 GB are occopied. Currently only 265 MB are free space showing. I am not sure how to retrive remaining 3 GB space. Can any one have any idea.

    Read the article

  • ATI Radeon Drivers works with which linux distribution and version? [closed]

    - by amit.codename13
    I have ATI Mobility Radeon HD 5850 graphics card. Almost every new linux distribution seems to have an issue with it, when i install the drivers. Working without utilizing the graphics card leaves me so unproductive. So i made a plan to use older versions of linux, any distribution suitable as a desktop distribution. The problems that i am facing are, 1) After installing drivers the system boots and hangs, 2) There are unusual lines over the screen 3) After upgrade system doesn't start properly(hangs the usual old way) The kind of answers i am looking for is, distribution X(the newer the version the better) doesn't have the above problem after installing drivers for ATI Mobility Radeon HD 5850 graphics card. UPDATE: The new drivers released by AMD seems to fix all the issues, although they are still beta

    Read the article

  • No sigal showing on LCD TV when Conects Leptop via VGA Cable

    - by Amit Prajapati
    I am trying to connect my laptop to Samsung LCD TV by VGA TO HDMI cable My Laptop find Samsung tv on display setting. But When I press fn+F7 key my TV display No Signal My laptop specifications are: "Lenovo R61 ThinkPad, Model: 8935AE7 Window7 Ultimate 32 bits 2GB RAM VGA Port available No HDMI Port My TV specification are: Samsung LCD 26 HDMI Port available VGA Port Available I want to know what is problem? When I connect Another Dell Laptop (Window7 32 bit) with HDMI to HDMI cable it work properly. Thanks in Advance!

    Read the article

  • Mix content warning on ASPX page

    - by Amit
    Hi, We have started receiving the mixed content warning on ASPX pages on our secured site. We do not have any mix content, we load all our JS, Images, CSS and ASPX files using HTTPS. I dont know why we have started receiving these warnings now. The latest thing which we have added is the third party control for Dialog boxes from Essential Object. We are previously using their Menu control but added dialog box recently. Also we have made our application browser compatible. I feel the reason is something between these two points. Can anyone suggest any solution or any workaround if they know any or have used Essential Object controls and faced simililar issue? Essential object is saying it is not their problem. The mix content warning appears any time and not specifically when the Essential Control dialog box popsup, thats why I am bit confused. Any help is highly appriciated. Thanks.

    Read the article

  • How Spanning Tree Protocol detects Loops

    - by AMIT
    For last few days I've been reading about Spanning Tree Protocol ,L2 protocol and understood how it prevents loop in network ,various steps in STP but one thing i wanted to know how STP actually detects the loops in network so that it can prevent it.Somewhere I read STP uses BPDU as probe and detects loops I mean how it happen is when switch send a BPDU with Destination Address as multicast and receive same BPDU again mean there is loop in network . But is it how STP detects loops in network?

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to set BackGround color to a divider in JSplitPane

    - by Sunil Kumar Sahoo
    I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Output of the following code

    - by terrific
    String s1 = "Amit"; //true String s2 = "Amit"; //true String s3 = new String("abcd"); //true String s4 = new String("abcd"); //false System.out.println(s1.equals(s2)); //true System.out.println((s1==s2)); //true System.out.println(s3.equals(s4)); //false System.out.println((s3==s4)); //false Assume it to be in main why the output of the above code is true true true false and not true true false false???

    Read the article

  • More New JDeveloper/ADF Blogs - Dec 2010 Edition

    - by shay.shmeltzer
    It's only been a month since my last new bloggers update, but over this month I came across several other new blogs so here is a few more to add to your RSS reader: JDev and ADF QA Team ADF Code Corner Code Harvest JDeveloper PMs Blog Don Kleppinger Amit Seth Kishore Amir Hossein Khanof Oracle ADF Notebook Gerry O'D Muhammed Soyer Thanks for all the developers who are sharing their experience and helping advance the ADF community. As always we are trying to keep tracking these blogs for entries and you can find those on the JDeveloper tweet, facebook and blog roll.Twitter , Facebook , Blogs

    Read the article

  • Oracle at Gartner IAM Summit Next Week

    - by Tanu Sood
    Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif"; mso-bidi-font-family:"Times New Roman";} Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif"; mso-bidi-font-family:"Times New Roman";} Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif"; mso-bidi-font-family:"Times New Roman";} Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif"; mso-bidi-font-family:"Times New Roman";} Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif"; mso-bidi-font-family:"Times New Roman";} Heading to Gartner Identity and Access Management Summit next week? As you know, one of the premier conferences for identity management specialists and security experts, the Gartner IAM Conference this year is in Las Vegas, Nevada from December 3 – 5. Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif"; mso-bidi-font-family:"Times New Roman";} As you pack your bags and plan your itinerary, do note that Oracle executives including Amit Jasuja, Senior Vice President, Security and Identity Management and Dave Profozich, Group Vice President along with product management and implementation experts would be in attendance. You are invited to meet with the Oracle team and mingle with our customers. We recommend you bookmark the following times and activities: Breakfast Keynote: Trends in Identity Management Tuesday, December 4, 2012 7:30 a.m. – 8:00 a.m., Octavius 16 Amit Jasuja, SVP, Security and Identity Management, Oracle Ranjan Jain, Enterprise Architect, Cisco Don’t miss the opportunity to hear from Amit Jasuja, SVP, Security and Identity Management as he discusses how mobile and social behavior are changing how organizations function, manage their workforce, and interact with their customers. Learn how these new trends are shaping the innovations in Oracle Identity Management solutions. And get a customer’s take on the new trends and their impact on the organization. Visit the Oracle Booth Mingle with peers, customers, product and implementation experts at the Oracle booth. While there, catch live demonstrations of the very latest best-in-class technologies and learn how Oracle Identity Management solutions are enabling the Social, Mobile and Cloud (SoMoClo) environments. And arm yourself with industry resources from our Virtual Collateral Rack. And don’t forget to enter for a chance to win a JAWBONE JAMBOX Wireless Speaker System while at our booth. So, see you there? Gartner Identity and Access Management Summit December 3 -5, 2012 Caesars Palace 3570 Las Vegas Blvd South Las Vegas, NV 89109

    Read the article

  • SIM to OIM Migration: A How-to Guide to Avoid Costly Mistakes (SDG Corporation)

    - by Darin Pendergraft
    In the fall of 2012, Oracle launched a major upgrade to its IDM portfolio: the 11gR2 release.  11gR2 had four major focus areas: More simplified and customizable user experience Support for cloud, mobile, and social applications Extreme scalability Clear upgrade path For SUN migration customers, it is critical to develop and execute a clearly defined plan prior to beginning this process.  The plan should include initiation and discovery, assessment and analysis, future state architecture, review and collaboration, and gap analysis.  To help better understand your upgrade choices, SDG, an Oracle partner has developed a series of three whitepapers focused on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration. In the second of this series on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration, Santosh Kumar Singh from SDG  discusses the proper steps that should be taken during the planning-to-post implementation phases to ensure a smooth transition from SIM to OIM. Read the whitepaper for Part 2: Download Part 2 from SDGC.com In the last of this series of white papers, Santosh will talk about Identity and Access Management best practices and how these need to be considered when going through with an OIM migration. If you have not taken the opportunity, please read the first in this series which discusses the Migration Approach, Methodology, and Tools for you to consider when planning a migration from SIM to OIM. Read the white paper for part 1: Download Part 1 from SDGC.com About the Author: Santosh Kumar Singh Identity and Access Management (IAM) Practice Leader Santosh, in his capacity as SDG Identity and Access Management (IAM) Practice Leader, has direct senior management responsibility for the firm's strategy, planning, competency building, and engagement deliverance for this Practice. He brings over 12+ years of extensive IT, business, and project management and delivery experience, primarily within enterprise directory, single sign-on (SSO) application, and federated identity services, provisioning solutions, role and password management, and security audit and enterprise blueprint. Santosh possesses strong architecture and implementation expertise in all areas within these technologies and has repeatedly lead teams in successfully deploying complex technical solutions. About SDG: SDG Corporation empowers forward thinking companies to strategize their future, realize their vision, and minimize their IT risk. SDG distinguishes itself by offering flexible business models to fit their clients’ needs; faster time-to-market with its pre-built solutions and frameworks; a broad-based foundation of domain experts, and deep program management expertise. (www.sdgc.com)

    Read the article

  • Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code »

    Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code » Runnable, qui a récemment été lancé par une startup du même nom basée à Palo Alto avec pour objectif la facilitation de la découverte et de la réutilisation de portions de code, a annoncé qu'elle a soulevé une levée de fonds de 2 millions de dollars grâce à la participation de Sierra Ventures, Resolute VC, AngelPad et 500 startups.Yash Kumar Directeur Général et co-fondateur de la start-up...

    Read the article

  • Type of Blobs

    - by kaleidoscope
    With the release of Windows Azure November 2009 CTP, now we have two types of blobs. Block Blob - This blob type is in place since PDC 2008 and is optimized for streaming workloads. [Max Size allowed : 200GB] Page Blob - With November 2009 CTP release, a new blob type is added which is optimized for random read / writes called Page Blob. [Max Size allowed : 1TB] More details can be found at: http://geekswithblogs.net/IUnknown/archive/2009/11/16/azure-november-ctp-announced.aspx Amit, S

    Read the article

  • Silverlight Cream for November 08, 2011 -- #1165

    - by Dave Campbell
    In this Issue: Brian Noyes, Michael Crump, WindowsPhoneGeek, Erno de Weerd, Jesse Liberty, Derik Whittaker, Sumit Dutta, Asim Sajjad, Dhananjay Kumar, Kunal Chowdhury, and Beth Massi. Above the Fold: Silverlight: "Working with Prism 4 Part 1: Getting Started" Brian Noyes WP7: "Getting Started with the Coding4Fun toolkit Tile Control" WindowsPhoneGeek LightSwitch: "How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch" Beth Massi Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up From SilverlightCream.com: Working with Prism 4 Part 1: Getting Started Brian Noyes has a series starting at SilverlightShow about Prism 4 ... this is the first one, so a good time to jump in and pick up on an intro and basic info about Prism plus building your first Prism app. 10 Laps around Silverlight 5 (Part 5 of 10) Michael Crump has Part 5 of his 10-part Silverlight 5 investigation up at SilverlightShow talking about all the various text features added in Silverlight 5 Beta: Text Tracking and Leading, Linked and MultiColumn, OpenType, etc. Getting Started with the Coding4Fun toolkit Tile Control WindowsPhoneGeek takes on the Tile control from the Coding4Fun toolkit... as usual, great tutorial... diagrams, code, explanation Using AppHarbor, Bitbucket and Mercurial with ASP.NET and Silverlight – Part 2 CouchDB, Cloudant and Hammock Erno de Weerd has Part 2 of his trilogy and he's trying to beat David Anson for the long title record :) ... in this episode, he's adding in cloud storage to the mix in a 35-step tutorial. Background Audio Jesse Liberty's talking about background Audio... and no not the Muzak in the elevator (do they still have that?) ... he's tlking about the WP7.1 BackgroundAudioPlayer Using the ToggleSwitch in WinRT/Metro (for C#) Derik Whittaker shows off the ToggleSwitch for WinRT/Metro... not a lot to be said about it, but he says it all :) Part 19 - Windows Phone 7 - Access Phone Contacts Sumit Dutta has Part 19! of his WP7 series up... talking today about getting a phone number from the directory using the PhoneNumberChooserTask ContextMenu using MVVM Asim Sajjad shows how to make the Context Menu ViewModel friendly in this short tutorial. Code to make call in Windows Phone 7 Dhananjay Kumar's latest WP7 post is explaining how to make a call programmatically using the PhoneCallTask launcher. Silverlight Page Navigation Framework - Basic Concept Kunal Chowdhury has a 3-part tutorial series on Silverlight Navigation up. This is the first in the series, and he hits the basics... what constitutes a Page, and how to get started with the navigation framework. How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch Beth Massi's latest LightSwitch post is on using the Data Designer to easily crete and model database tables... during development this is in SQL Express, but can be deployed to most SQL server db you like Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • SQLAuthority News – SQL Server 2012 Upgrade Technical Guide – A Comprehensive Whitepaper – (454 pages – 9 MB)

    - by pinaldave
    Microsoft has just released SQL Server 2012 Upgrade Technical Guide. This guide is very comprehensive and covers the subject of upgrade in-depth. This is indeed a helpful detailed white paper. Even writing a summary of this white paper would take over 100 pages. This further proves that SQL Server 2012 is quite an important release from Microsoft. This white paper discusses how to upgrade from SQL Server 2008/R2 to SQL Server 2012. I love how it starts with the most interesting and basic discussion of upgrade strategies: 1) In-place upgrades, 2) Side by side upgrade, 3) One-server, and 4) Two-server. This whitepaper is not just pure theory but is also an excellent source for some tips and tricks. Here is an example of a good tip from the paper: “If you want to upgrade just one database from a legacy instance of SQL Server and not upgrade the other databases on the server, use the side-by-side upgrade method instead of the in-place method.” There are so many trivia, tips and tricks that make creating the list seems humanly impossible given a short period of time. My friend Vinod Kumar, an SQL Server expert, wrote a very interesting article on SQL Server 2012 Upgrade before. In that article, Vinod addressed the most interesting and practical questions related to upgrades. He started with the fundamentals of how to start backup before upgrade and ended with fail-safe strategies after the upgrade is over. He covered end-to-end concepts in his blog posts in simple words in extremely precise statements. A successful upgrade uses a cycle of: planning, document process, testing, refine process, testing, planning upgrade window, execution, verifying of upgrade and opening for business. If you are at Vinod’s blog post, I suggest you go all the way down and collect the gold mine of most important links. I have bookmarked the blog by blogging about it and I suggest that you bookmark it as well with the way you prefer. Vinod Kumar’s blog post on SQL Server 2012 Upgrade Technical Guide SQL Server 2012 Upgrade Technical Guide is a detailed resource that’s also available online for free. Each chapter was carefully crafted and explained in detail. Here is a quick list of the chapters included in the whitepaper. Before downloading the guide, beware of its size of 9 MB and 454 pages. Here’s the list of chapters: Chapter 1: Upgrade Planning and Deployment Chapter 2: Management Tools Chapter 3: Relational Databases Chapter 4: High Availability Chapter 5: Database Security Chapter 6: Full-Text Search Chapter 7: Service Broker Chapter 8: SQL Server Express Chapter 9: SQL Server Data Tools Chapter 10: Transact-SQL Queries Chapter 11: Spatial Data Chapter 12: XML and XQuery Chapter 13: CLR Chapter 14: SQL Server Management Objects Chapter 15: Business Intelligence Tools Chapter 16: Analysis Services Chapter 17: Integration Services Chapter 18: Reporting Services Chapter 19: Data Mining Chapter 20: Other Microsoft Applications and Platforms Appendix 1: Version and Edition Upgrade Paths Appendix 2: SQL Server 2012: Upgrade Planning Checklist Download SQL Server 2012 Upgrade Technical Guide [454 pages and 9 MB] Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Database, DBA, PostADay, SQL, SQL Authority, SQL Documentation, SQL Download, SQL Query, SQL Server, SQL Tips and Tricks, SQL White Papers, SQLAuthority News, SQLServer, T SQL, Technology

    Read the article

  • Silverlight Cream for June 21, 2011 -- #1110

    - by Dave Campbell
    In this Issue: Colin Eberhardt, Kunal Chowdhury(-2-), Peter Kuhn(-2-, -3-), Mike Gold, WindowsPhoneGeek, Nigel Sampson, Paul Sheriff, Dhananjay Kumar, and Erno de Weerd. Above the Fold: Silverlight: "Silverlight Debug Helper" Peter Kuhn3 WP7: "Metro In Motion #8 – AutoCompleteBox Reveal Animation" Colin Eberhardt Shoutouts: Check out the Top 5 from my friends at SilverlightShow from last week: SilverlightShow for June 13 - 19, 2011 From SilverlightCream.com: Metro In Motion #8 – AutoCompleteBox Reveal Animation Colin Eberhardt found yet another 'Metro In Motion' to duplicate... this one is the auto-complete effect seen in the WP7 email client... check out the video on the post! Windows Phone 7 (Mango) Tutorial - 16 - How to Create a WP7 Alarm Application? Kunal Chowdhury has a couple more of his Mango tutorials up... number 16 (!) is on creating an Alarm app using scheduled tasks. Windows Phone 7 (Mango) Tutorial - 17 - How to Create a WP7 Reminder Application? Kunal Chowdhury's latest is number 17 in the Mango series and he's discussing the Reminder class which is part of the Scheduler namespace. Silverlight Debug Helper Peter Kuhn has deployed a new version of his "Silverlight Debug Helper"... this time he's added support for FireFox and Chrome. Getting ready for the Windows Phone 7 Exam 70-599 (Part 3) Peter Kuhn also has Part 3 of his series posted at SilverlightShow on getting ready for the WP7 exam. XNA for Silverlight developers: Part 13 - Mango (2) Finally, Peter Kuhn's latest XNA for Silverlight developers tutorial is up at SilverlightShow and is the 2nd Mango post for game devs. Detecting Altitude using the WP7 Phone WindowsPhoneGeek apparently turned the reigns of his blog over to Mike Gold for this post about Altitude detection on the WP7. Windows Phone Mango: Getting Started with MVVM in 10 Minutes If you're out there and still haven't gotten your head around MVVM, or want to take another look at why you're beating yourself up doing it [ :) ]... WindowsPhoneGeek has a quick write-up on MVVM and WP7.1 apps Creating app promotional videos Nigel Sampson details how he uses Expression Encoder to produce the app videos he has on his blog for his WP7* apps. Sort Data in Windows Phone using Collection View Source Paul Sheriff's latest post is up, and is another WP7 post. This time on how to sort the data you consume by using a CollectionViewSource object in XAML and not write any code! Viewing Flickr Images on Windows 7.1 Phone or Mango Phone Dhananjay Kumar has a tutorial up for WP7.1 showing how to use the Flickr REST service to display images on your device. Windows Phone 7: Drawing graphics for your application with Inkscape – Part II: Icons Part 2 of Erno de Weerd's Trilogy on Drawing graphics for your WP7* apps in Inkscape is up... this tutorial is all about icons... good stuff! Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • SQLAuthority News – Presented Soft Skill Session on Presentation Skills at SQL Bangalore on May 3, 2014

    - by Pinal Dave
    I have presented on various database technologies for almost 10 years now. SQL, Database and NoSQL have been part of my life. Earlier this month, I had the opportunity to present on the topic Performing an Effective Presentation. I must say it was blast to prepare as well as present this session. This event was part of the SQL Bangalore community. If you are in Bangalore, you must be part of this group. SQL Bangalore is a wonderful community and we always have a great response when we present on technology. It is SQL User Group and we discuss everything SQL there. This month we had SQL Server 2014 theme and we had a community launch of SQL Server. We have the best of the best speakers presenting on SQL Server 2014 technology. The event had amazing speakers and each of them did justice to the subject. You can read about this over here. In this session I told a story from my life. I talked about who inspired me and how I learned to speak in public. I told stories about two legends  who have inspired me. There is no video recording of this session. If you want to get resources from this session, please sign up my newsletter at http://bit.ly/sqllearn. Well, I had a great time at this event. We had over 250 people showed up at this event and had a grand  time together. I personally enjoyed a session of Amit Benerjee, Balmukund Lakhani and Vinod Kumar. Ken and Surabh also entertained the audience. Overall, this was a grand event and if you were in Bangalore and did not make it to this event. You did miss out on a few things. Here are a few photos of this event. SQL Bangalore UG Nupur, Chandra, Shaivi, Balmukund, Amit, Vinod [captions This] SQL Bangalore UG Audience Pinal Dave presenting at SQL UG in Bangalore Here are few of the slides from this presentation: Reference: Pinal Dave (http://blog.sqlauthority.com)Filed under: PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, T SQL

    Read the article

  • T-SQL in SQL Azure

    - by kaleidoscope
    The following table summarizes the Transact-SQL support provided by SQL Azure Database at PDC 2009: Transact-SQL Features Supported Transact-SQL Features Unsupported Constants Constraints Cursors Index management and rebuilding indexes Local temporary tables Reserved keywords Stored procedures Statistics management Transactions Triggers Tables, joins, and table variables Transact-SQL language elements such as Create/drop databases Create/alter/drop tables Create/alter/drop users and logins User-defined functions Views, including sys.synonyms view Common Language Runtime (CLR) Database file placement Database mirroring Distributed queries Distributed transactions Filegroup management Global temporary tables Spatial data and indexes SQL Server configuration options SQL Server Service Broker System tables Trace Flags   Amit, S

    Read the article

  • Silverlight Cream for March 13, 2011 -- #1059

    - by Dave Campbell
    In this Issue: András Velvárt, WIndowsPhoneGeek(-2-), Jesse Liberty(-2-), Victor Gaudioso, Kunal Chowdhury, Jeremy Likness, Michael Crump, and Dhananjay Kumar. Above the Fold: Silverlight: "Application Library Caching in Silverlight 4" Kunal Chowdhury WP7: "Handling WP7 orientation changes via Visual States" András Velvárt Shoutouts: Joe McBride gave a MEF Head User Group presentation and has posted How to Become a MEF Head – Slides & Code From SilverlightCream.com: Handling WP7 orientation changes via Visual States András Velvárt has an Expression Blend/WP7 post up discussing WP7 orientation changes and handling them via Visual States ... see an example from his SurfCube app, and a behavior to handle the control... with source. WP7 PerformanceProgressBar in depth WIndowsPhoneGeek has a post up discussing the WP7 Performance bar from the Windows Phone Toolkit. This is an update on the Toolkit based on the Feb 2011 release. Great explanation of the PerformanceProgressBar, external links, and sample code. Getting data out of WP7 WMAppManifest is easy with Coding4Fun PhoneHelper Next WindowsPhoneGeek has a post up about the PhoneHelper in the Coding4Fun TOolkit, and using it to get data out of the WMAppManifest easily. Good discussion, Links, and code as always Silverlight Unit Test For Phone In Jesse Liberty's "Windows Phone From Scratch" number 41, he's discussing Unit Testing for WP7... he gives some good external links and some good examples. Yet Another Podcast #27–Paul Betts Jesse Liberty's next post is his "Yet Another Podcast" number 27, and an interview with Paul Betts, the creator of Reactive UI... check out the podcast and also the good links listed. New Silverlight Video Tutorial: How to use the Fluid Move Behavior Victor Gaudioso has a new video tutorial up on using the Fluid Move Behavior... making a selected item animate from a ListBox to a Master Details Grid. Application Library Caching in Silverlight 4 Kunal Chowdhury takes a break from SilverlightZone long enough to write a post about Application Library Caching... for example on-demand loading of a 3rd-party XAP. Jounce Part 13: Navigation Parameters Jeremy Likness has his 13th post of a series in understanding his Jounce MVVM framework up. This episode surrounds a new release and what it contains, the primary focus being navigation parameters... that is you can raise a navigation event with a payload. Profiling Silverlight Applications after installing Visual Studio 2010 Service Pack 1 Michael Crump digs into the performance wizard for Silverlight that we get with VS2010 SP1. He shows how to get and read a profile... great intro to a new tool. Binding XML File to Data Grid in Silverlight Dhananjay Kumar demonstrates reading an XML file using LINQ to XML and binding the result to a Silverlight DataGrid Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Silverlight Cream for March 07, 2011 -- #1055

    - by Dave Campbell
    In this Issue: Max Paulousky, Chris Rouw, David Anson, Jesse Liberty, Shawn Wildermuth, Simon Guindon, and Dhananjay Kumar. Above the Fold: Silverlight: "Faster Databinding in WPF and Silverlight using OptimizedObservableCollection" Simon Guindon WP7: "Phoney Tools Updated (WP7 Open Source Library)" Shawn Wildermuth From SilverlightCream.com: Problems With Sharing Windows Phone 7 Applications Within A Large Group Of Beta Testers Max Paulousky has a post up discussing the issues surrounding beta testing a WP7 app with a large group of testers... and how to pull it all off. WP7 Insights #1: Consuming REST APIs within a WP7 app Chris Rouw is beginning a WP7 series based on his recent experience of getting a client's app into the marketplace. This first in his series is on consuming REST APIs ... lots of good code and explanations. Improving Windows Phone 7 application performance is even easier with these LowProfileImageLoader and DeferredLoadListBox updates David Anson has an update to his LowProfileImageLoader and DeferredLoadListBox after issues brought up by readers... so we all win with the great feedback from alert devs. When Isolated Storage Isn’t Enough Jesse Liberty started looking at Jeremy Likness' Sterling with this post in the WP7 From Scratch series. He starts with downloading it from CodePlex ... great way to get into Sterling if you haven't already. Phoney Tools Updated (WP7 Open Source Library) Shawn Wildermuth has the latest drop of his Phoney Tools up... this is the last Alpha. I've added a tag for it as well. He's fixed some things, added others... check out the post and go grab the code. Faster Databinding in WPF and Silverlight using OptimizedObservableCollection Simon Guindon is a blogger I've not been following, but this post on an OptimizedObservableCollection caught my eye. He added an AddRange() to the ObservableCollection to get a speed enhancement when adding items... and a pretty good speed enhancement it is. Reading files asynchronously using WebClient class in Silverlight Dhananjay Kumar is another prolific blogger that I've not been following, so we'll start with his latest... a step-by-step guide to reading an XML file asynchronously. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >