Search Results

Search found 1082 results on 44 pages for 'gaurav kumar'.

Page 11/44 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • display HTML content from database with formatting in it

    - by Gaurav Sharma
    Hi all, I have used wmd-editor in my cakephp v1.3 application. The config which I have written is as follows: wmd_options = { output: "HTML", lineLength: 40, buttons: "bold italic | link blockquote code image | ol ul heading hr", autostart: true }; When I submit the form the HTML in the wmd enabled textarea is saved in the database with htmlentities() done to the text then I am displaying it with html_entity_decode() method. but the text is displayed as it is including the HTML coding like this <p><strong>hello dear friends</strong></p>\n\n<pre><code>I want to make sure that everything that you type is visible clearly.\nadasfafas\n</code></pre>\n\n<blockquote>\n <p>sadgsagasdgxcbxcbxc</p>\n</blockquote>\n\n<p><em>sadfgsgasdsgasgs</em></p>\n\n<p><b><a href="http://kumu.in">this is the link</a></b></p> Please help me solve this problem Thanks

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • cahoots - zend framework application is not running

    - by Gaurav Sharma
    hello everyone, I downloaded cahoots from sourceforge.net. It is a zend framework application. Very nicely done and I must say that it should be a nice tutorial for everyone who is struggling to learn Zend framework. But my problem is that even after reading the instructions this application is still not running. The application just doesn't run at all giving an error message. I have tried my best. no success :( Also I wanted to execute the application as "http://localhost/cahoots" but it runs by this URL "http://localhost/cahoots/public". why is it so.? I am using XAMPP v 1.7.1 with mod-rewrite enabled. Please guide me through the process. Any good tutorials on zend framework with zend tool would be appreciable. I want to learn this framework. Thanks

    Read the article

  • reply to a comment via email and directly post it on the website commenting system

    - by Gaurav Sharma
    Hello Everybody, I have developed a website using PHP and MYSQL. The website has a commenting system through which registered users of the website can post comments on the feedback posted by different users. When a comment is posted for a feedback an email is sent to the user who posted that feedback notifying him of new comments on his feedback. Now what I want is that a feedback owner should be able to post a new comment in response to that comment by simply replying to the email that has been sent by the website. I hope I was able to explain my query properly. If it needs any improvement in explanation, I would be glad to know and make changes accordingly Thanks

    Read the article

  • present a static page url as different url which is SEO friendly

    - by Gaurav Sharma
    Hi, I have developed a site, which has some static pages. Like explore, home, feedback. The link for these goes as follows website.com/views/explore.php website.com/index.php website.com/views/feedback.php I want to write a different SEO URL for each of the URL mentioned above. Is it possible ? i.e. for example website.com/views/explore.php should be convereted/visible as website.com/explore website.com/views/feedback.php should be convereted/visible as website.com/give/feedback and so on

    Read the article

  • Extending the User model with custom fields in Django

    - by Gaurav
    I am trying to extend the User model so that I can add my own custom fields but I keep getting an error stating: 'NoneType' object has no attribute '_default_manager' whenever I try to use user.get_profile() to add values to the custom field i.e. whenever I use it like so: user = User.objects.create_user(username, email, password) user.first_name = fname user.last_name = lname user.save() uinfo = user.get_profile() uinfo.timezone = "Asia/Pune" uinfo.save() I have already followed the steps given at http://stackoverflow.com/questions/44109/extending-the-user-model-with-custom-fields-in-django/965883#965883 with no luck.

    Read the article

  • How to create temporary files on the client machine, from Web Application?

    - by Gaurav Srivastava
    I am creating a Web Application using JSP, Struts, EJB and Servlets. The Application is a combined CRM and Accounting Package so the Database size is very huge. So, in order to make Execution faster, I want prevent round trips to the Database. For that purpose, what I want to do is create some temporary XML files on the client Machine and use them whenever required. How can I do this, as Javascript do not permits me to do so. Is there any way of doing this? Or, is there any other solution which I can adopt in order to make my application Faster?

    Read the article

  • Is it safe to change the 'Security.salt' line to a more lengthy string {64 hex key}

    - by Gaurav Sharma
    Hi everyone, I have changed the Configure::write('Security.salt', '############'); value in the file config/core.php file to a '256-bit hex key'. Is it safe or a good practice to change these lines for every different installation of cakephp application or shall I revert back to the original ? I also changed the Configure::write('Security.cipherSeed','7927237598237592759727'); to a different one of more length. Please throw some light on this. Thanks

    Read the article

  • display microphone activity in flex

    - by Gaurav
    Hi, I want to display a real time activity bar for the microphone in flex. This is similar to the vertical bar one can see when flash settings dialog's microphone settings tab is displayed. Any built in component or link would help. Thanks

    Read the article

  • align an iframe

    - by Gaurav
    I have a html page and I want to align an iframe at the bottom of the page such that the iframe occupies all the width , I am unable to align the iframe at the bottom.Please find the iframe tag at the bottom of the page. <html> <body> <p>The rest of the code has not been mentioned to reduce code overflow.</p> <p>I want to align the iframe after a long page having no. of jquery , images etc.</p> <iframe src ="bottom.html" width="100%" height="200" style="float:bottom" scrolling="no" frameborder="0"> <p>Your browser does not support iframes.</p> </iframe> </body> </html>

    Read the article

  • Error appearing in application after updating cakePHP library files from 1.3.0 to 1.3.1

    - by Gaurav Sharma
    Hi everyone, I have just updated my cakephp library to latest version 1.3.1. Before this I was running v1.3.0 with no errors. After running the application I am given this error message. unserialize() [function.unserialize]: Error at offset 0 of 2574 bytes [CORE\cake\libs\cache\file.php, line 176] I updated the libraries simply by replacing the existing cake files with the new ones downloaded from the net. Is it the correct way of updating applications. I did'nt made any customizations to the core library of cakePHP. What is the problem ? Please help. Thanks

    Read the article

  • exception in thread "main" java.lang.NoclassDefFoundError: cal/class

    - by Gaurav
    enter import java.io.*; class eval { double add(double a,double b) { return (a+b); } double sub(double a,double b) { return (a-b); } double mul(double a,double b) { return (a*b); } double div(double a,double b) { return (a/b); } } class cal extends eval { public static void main(String args[])throws IOException { eval a1=new eval(); try{ System.out.println("1) Add"); System.out.println("2) Subtract"); System.out.println("3) Multiply"); System.out.println("4) Divide"); System.out.println("5) Enter your choice"); BufferedReader br=new BufferedReader(new InputStreamReader(System.in)); int ch;ch=Integer.parseInt(br.readLine()); System.out.println("Enter two number"); double a;a=Integer.parseInt(br.readLine()); double b;b=Integer.parseInt(br.readLine()); switch(ch) { case 1: a1.add(a,b); break; case 2: a1.sub(a,b); break; case 3: a1.mul(a,b); break; case 4: a1.div(a,b); break; } } catch (IOException e) { System.out.println("Error occured, please restart application."); } } }

    Read the article

  • How to build a Video Broadcaster, which can handle more than 20,000 viewers

    - by Gaurav Srivastava
    I want to broadcast Video from a web cam, over internet. The problem is, the Video will be viewed live by more than 20,000 people (expected). I have a very little experience with Red5 Broadcasting. I did some broadcasting using Red5 and Flash. It works fine for 1 or 2 viewers i.e. it is great for personal chatting/ video conferencing applications. But, when the number of viewers increases, the delay in Broadcasting also increases. I am experiencing a Delay addition of about 0.5 Seconds for every new user who joins the broadcast. Can any one suggest me some, better technologies on which I can work out this Live Broadcasting. I don't want to use http://www.ustream.com; I want to create one of my own, such tool. But thats always the last solution.

    Read the article

  • JPanel in JFrame in NetBeans

    - by Gaurav
    I have created a Java application (project) in NetBeans, in which I have designed a JFrame with menu bar, and different JPanels. I want these JPanels to appear inside the JFrame on action of different menu items, so that whenever the menu items are clicked different JPanels should appear inside the JFrame. I have designed both JFrame & JPanel separately, but I couldn't link them together. Please help me out friends.

    Read the article

  • Dynamically/recursively building hashes in Perl?

    - by Gaurav Dadhania
    I'm quite new to Perl and I'm trying to build a hash recursively and getting nowhere. I tried searching for tutorials to dynamically build hashes, but all I could find were introductory articles about hashes. I would be grateful if you point me towards the right direction or suggest a nice article/tutorial. I'm trying to read from a file which has paths in the form of one/two/three four five/six/seven/eight and I want to build a hash like VAR = { one : { two : { three : "" } } four : "" five : { six : { seven : { eight : "" } } } } The script I'm using currently is : my $finalhash = {}; my @input = <>; sub constructHash { my ($hashrf, $line) = @_; @elements = split(/\//, $line); if(@elements > 1) { $hashrf->{shift @elements} = constructHash($hashrf->{$elements[0]}, @elements ); } else { $hashrf->{shift @elements} = ""; } return $hashrf; } foreach $lines (@input) { $finalhash = constructHash($finalhash, $lines); }

    Read the article

  • How does Java pick which method to call?

    - by Gaurav
    Given the following code: public class Test { public void method(Object o){ System.out.println("object"); } public void method(String s) { System.out.println("String"); } public void method() { System.out.println("blank"); } /** * @param args */ public static void main(String[] args) { // TODO Auto-generated method stub Test test=new Test(); test.method(null); } } Java prints "String". Why is this the case?

    Read the article

  • flex air datagrid setfocus cell by cell

    - by gaurav flex
    Hi all, I have a datagrid with custom itemRenderer. Now I need to setfocus int the grid cell by cell. For that I Googled & got a way i.e var findrowindex:int = 0; //nextButton Click Handler var focusedCell: Object = new Object(); focusedCell. columnIndex = 3; focusedCell. rowIndex = findrowindex; dg.editedItemPosition = focusedCell; dg.validateNow( ); findrowindex++; Using this I am able to get focus in a cell but the focus is not moving from one cell to another. Pls suggest me where I am going wrong or suggest me any ther way to achieve this. Thanks.

    Read the article

  • Should we use a CSS frame work ? Are they worth it ?

    - by Gaurav M
    CSS frameworks have nice styles inbuilt and ask you to focuses on the grids but still there is a bit of dependency and lack of freedom it provide.. If I need to generate a webpage by looking on a PSD based mockup screen ..either i will use the classes provided by the framework but if that actual measurements does not exist I need to again specify my own rules that will add upto my CSS filesize and if performance is a constraint as always it is...you need not a big size file..though its in kb but every drop counts. Any comments and suggestions to use the framework in a best possible way.

    Read the article

  • Prevent unauthorised write access to a part of filesystem or partition

    - by gaurav
    Hello all I have some very important system files which I want to protect from accidental deletion even by root user. I can create a new partition for that and mount it with readonly access but the problem is that I want my application which handles those system files to have write access to that part and be able to modify them. Is that possible using VFS? As VFS handles access to the files I could have a module inserted in the VFS layer which can see if there is a write access to that part then see the authorization and allow it or otherwise reject it. If not please provide me suggestions regarding how can such a system be implemented what would I need in that case. If there exists a system like this please suggest about them also. I am using linux and want to implement this in C, I think it would be possible in C only. Edit: There are such kind of programs implemented in windows which can restrict access to administrator even, to some important folders, would that be possible in linux?

    Read the article

  • Getting below error when trying to register a generic class with a implementation using .net 2.0

    - by Gaurav Saxena
    Code: StructureMapConfiguration.BuildInstancesOf().AsSingletons().TheDefaultIsConcreteType(); Error: StructureMap Exception Code: 190 Can not create a Generic PluginFamily for PluginFamily MIGExcel.Service.IPersistenceService1[[MIGExcel.Model.Contact, WizardModel, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null]]. Check that the basic type MIGExcel.Service.IPersistenceService1 is configured as a PluginFamily. These Generic types are configured within StructureMap as PluginFamily's: MIGExcel.Service.IPersistenceService`1[[MIGExcel.Model.Contact, WizardModel, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null]],MIGExcel.Service;

    Read the article

  • Remove Action Bar icon but keep the UP button

    - by Gaurav
    I am developing an application which runs on both honeycomb and ice cream sandwich. I want my action bar not to have the icon but keep the "up/home" button. I used: getActionBar().setDisplayOptions(0, ActionBar.DISPLAY_SHOW_HOME); This removes the action bar icon but keeps the "up" button on ice cream sandwich. But on honeycomb, it removes the "up" button as well. Is there a way on honeycomb that allows me to keep the "up" button but get rid of the icon?

    Read the article

  • Running a Model::find in for loop in cakephp v1.3

    - by Gaurav Sharma
    Hi all, How can I achieve the following result in cakephp: In my application a Topic is related to category, category is related to city and city is finally related to state in other words: topic belongs to category, category belongs to city , city belongs to state.. Now in the Topic controller's index action I want to find out all the topics and it's city and state. How can I do this. I can easily do this using a custom query ($this-Model-query() function ) but then I will be facing pagination difficulties. I tried doing like this function index() { $this->Topic->recursive = 0; $topics = $this->paginate(); for($i=0; $i<count($topics);$i++) { $topics[$i]['City'] = $this->Topic->Category->City->find('all', array('conditions' => array('City.id' => $topics[$i]['Category']['city_id']))); } $this->set(compact('messages')); } The method that I have adopted is not a good one (running query in a loop) Using the recursive property and setting it to highest value (2) will degrade performance and is not going to yield me state information. How shall I solve this ? Please help Thanks

    Read the article

  • Detect activity level of microphone in flex

    - by Gaurav
    Hi, I have to detect avtivityLevel of microphone in Flex. I am using the activityLevel property of Microphone class but as I found out it always return -1 even if I have done Microphone.getMicrophone(). To detect activity level we have to set microphone.setLoopback = true; Does anybody know how to do this without using loop back as I do not want to hear my sound back just monitor the activity level Thanks

    Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >