Search Results

Search found 73266 results on 2931 pages for 'django file upload'.

Page 114/2931 | < Previous Page | 110 111 112 113 114 115 116 117 118 119 120 121  | Next Page >

  • Uploading images from Flex to Rails using Paperclip

    - by 23tux
    Hi everyone, I'm looking for a way to upload images that were created in my flex app to rails. I've tried to use paperclip, but it don't seem to work. I've got this tutorial here: http://blog.alexonrails.net/?p=218 The problem is, that they are using a FileReference to browse for files on the clients computer. They call the .upload(...) function and send the data to the upload controller. But I'm using a URLLoader to upload a image, that is modified in my Flex-App. First, here is the code from the tutorial: private function selectHandler(event:Event):void { var vars:URLVariables = new URLVariables(); var request:URLRequest = new URLRequest(uri); request.method = URLRequestMethod.POST; vars.description = "My Description"; request.data = vars; var uploadDataFieldName:String = 'filemanager[file]'; fileReference.upload(request, uploadDataFieldName); } I don't know how to set that var uploadDataFieldName:String = 'filemanager[file]'; in a URLLoader. I've got the image data compressed as a JPEG in a ByteArray. It looks like this: public function savePicture():void { var filename:String = "blubblub.jpg"; var vars:URLVariables = new URLVariables(); vars.position = layoutView.currentPicPosition; vars.url = filename; vars.user_id = 1; vars.comic_id = 1; vars.file_content_type = "image/jpeg"; vars.file_file_name = filename; var rawBytes:ByteArray = new JPGEncoder(75).encode(bitmapdata); vars.picture = rawBytes; var request:URLRequest = new URLRequest(Data.SERVER_ADDR + "pictures/upload"); request.method = URLRequestMethod.POST; request.data = vars; var loader:URLLoader = new URLLoader(request); loader.addEventListener(Event.COMPLETE, savePictureHandler); loader.addEventListener(IOErrorEvent.IO_ERROR, errorHandlerUpload); loader.load(request); } If I set the var.picture URLVariable to the bytearray, then I get the error, that the upload is nil. Here is the Rails part: Picture-Model: require 'paperclip' class Picture < ActiveRecord::Base # relations from picture belongs_to :comic belongs_to :user has_many :picture_bubbles has_many :bubbles, :through => :picture_bubbles # attached file for picture upload -> with paperclip plugin has_attached_file :file, :path => "public/system/pictures/:basename.:extension" end and the picture controller with the upload function: class PicturesController < ApplicationController protect_from_forgery :except => :upload def upload @picture = Picture.new(params[:picture]) @picture.position = params[:position] @picture.comic_id = params[:comic_id] @picture.url = params[:url] @picture.user_id = params[:user_id] if @picture.save render(:nothing => true, :status => 200) else render(:nothing => true, :status => 500) end end end Does anyone know how to solve this problem? thx, tux

    Read the article

  • Google App Engine (python): TemplateSyntaxError: 'for' statements with five words should end in 'rev

    - by Phil
    This is using the web app framework, not Django. The following template code is giving me an TemplateSyntaxError: 'for' statements with five words should end in 'reversed' error when I try to render a dictionary. I don't understand what's causing this error. Could somebody shed some light on it for me? {% for code, name in charts.items %} <option value="{{code}}">{{name}}</option> {% endfor %} I'm rendering it using the following: class GenerateChart(basewebview): def get(self): values = {"datepicker":True} values["charts"] = {"p3": "3D Pie Chart", "p": "Segmented Pied Chart"} self.render_page("generatechart.html", values) class basewebview(webapp.RequestHandler): ''' Base class for all webapp.RequestHandler type classes ''' def render_page(self, filename, template_values=dict()): filename = "%s/%s" % (_template_dir, filename) path = os.path.join(os.path.dirname(__file__), filename) self.response.out.write(template.render(path, template_values))

    Read the article

  • Hooking up Sproutcore frontend and custom Python backend

    - by Suvir
    Hello everyone, I am building a web-based application. The frontend has been designed in Sproutcore. For the backend, we have our own python API which handles all transactions with multiple databases. What is the best way to hook up the front-end with the back-end. AFAIK django is pretty monolithic (correct me if i am wrong) and it would be cumbersome if I dont use its native ORM...I would prefer a python-based solution..any ideas? thanks! Suvir

    Read the article

  • Why don't these class attributes register?

    - by slypete
    I have a factory method that generates django form classes like so: def get_indicator_form(indicator, patient): class IndicatorForm(forms.Form): #These don't work! indicator_id = forms.IntegerField(initial=indicator.id, widget=forms.HiddenInput()) patient_id = forms.IntegerField(initial=patient.id, widget=forms.HiddenInput()) def __init__(self, *args, **kwargs): forms.Form.__init__(self, *args, **kwargs) self.indicator = indicator self.patient = patient #These do! setattr(IndicatorForm, 'indicator_id', forms.IntegerField(initial=indicator.id, widget=forms.HiddenInput())) setattr(IndicatorForm, 'patient_id', forms.IntegerField(initial=patient.id, widget=forms.HiddenInput())) for field in indicator.indicatorfield_set.all(): setattr(IndicatorForm, field.name, copy(field.get_field_type())) return type('IndicatorForm', (forms.Form,), dict(IndicatorForm.__dict__)) I'm trying to understand why the top form field declarations don't work, but the setattr method below does work. I'm fairly new to python, so I suspect it's some language feature that I'm misunderstanding. Can you help me understand why the field declarations at the top of the class don't add the fields to the class? In a possibly related note, when these classes are instantiated, instance.media returns nothing even though some fields have widgets with associated media. Thanks, Pete

    Read the article

  • Search over multiple fields

    - by schneck
    Hi there, I think I don't unterstand django-haystack properly: I have a data model containing several fields, and I would to have two of them searched: class UserProfile(models.Model): user = models.ForeignKey(User, unique=True, default=None) twitter_account = models.CharField(max_length=50, blank=False) My search index settings: class UserProfileIndex(SearchIndex): text = CharField(document=True, model_attr='user') twitter_account = CharField(model_attr='twitter_account') def get_queryset(self): """Used when the entire index for model is updated.""" return UserProfile.objects.all() But when I perform a search, only the field "username" is searched; "twitter_account" is ignored. When I select the Searchresults via dbshell, the objects contain the correct values for "user" and "twitter_account", but the result page shows a "no results": {% if query %} <h3>Results</h3> {% for result in page.object_list %} <p> <a href="{{ result.object.get_absolute_url }}">{{ result.object.id }}</a> </p> {% empty %} <p>No results</p> {% endfor %} {% endif %} Any ideas?

    Read the article

  • How do I prevent a ManyToManyField('self') from linked an object to itself?

    - by dyve
    Consider this model (simplified for this question): class SecretAgentName(models.Model): name = models.CharField(max_length=100) aliases = ManyToManyField('self') I have three names, "James Bond", "007" and "Jason Bourne". "James Bond" and "007" are aliases of each other. This works exactly like I want it to, except for the fact that every instance can also be an alias of itself. This I want to prevent. So, there can be many SecretAgentNames, all can be aliases of each other as long as "James Bond" does not show up as an alias for "James Bond". Can I prevent this in the model definition? If not, can I prevent it anywhere else, preferably so that the Django Admin understands it?

    Read the article

  • ASP.net file operations delay

    - by mtranda
    Ok, so here's the problem: I'm reading the stream from a FileUpload control, reading in chunks of n bytes and writing the array in a loop until I reach the stream's end. Now the reason I do this is because I need to check several things while the upload is still going on (rather than doing a Save(); which does the whole thing in one go). Here's the problem: when doing this from the local machine, I can see the file just fine as it's uploading and its size increases (had to add a Sleep(); clause in the loop to actually get to see the file being written). However, when I upload the file from a remote machine, I don't get to see it until the the file has completed uploading. Also, I've added another call to write the progress to a text file as the progress is going on, and I get the same thing. Local: the file updates as the upload goes on, remote: the token file only appears after the upload's done (which is somewhat useless since I need it while the upload's still happening). Is there some sort of security setting in (or ASP.net) that maybe saves files in a temporary location for remote machines as opposed to the local machine and then moves them to the specified destination? I would liken this with ASP.net displaying error messages when browsing from the local machine (even on the public hostname) as opposed to the generic compilation error page/generic exception page that is shown when browsing from a remote machine (and customErrors are not off) Any clues on this? Thanks in advance.

    Read the article

  • Cache for everybody except staff members.

    - by Oli
    I have a django site where I want to stick an "admin bar" along the top of every non-admin page for staff members. It would contain useful things like page editing tools, etc. The problem comes from me using the @cache_page decorator on lots of pages. If a normal user hits a page, the cached version comes up without the admin bar (even for admin users) and if an admin hits the page first, normal users see the admin bar. I could tediously step through the templates, adding regional cache blocks but there are a lot of templates, and life is altogether too short. Ideally, there would be a way of telling the caching to ignore cache get/set requests from admin users... But I don't know how to best implement that. How would you tackle this problem?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Removing a result from Queryset

    - by Enrico
    Is there a simple way to discard/remove the last result in a queryset without affecting the db? I am trying to paginate results in Django, but don't know the total number of objects for a given query. I was planning on using next/previous or older/newer links, so I only need to know if this is the first and/or last page. First is easy to check. To check for the last page I can compare the number of results with the pagesize or make a second query. The first method fails to detect the last page when the number of results in the last set equals the pagesize (ie 100 records get broken into 10 pages with the last page containing exactly 10 results) and I would like to avoid making a second query. My current thought is that I should fetch pagesize + 1 results from the db. If the queryset length equals 11, I know this is not the last page and I want to discard the last result in the queryset before passing the queryset to the template.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Quering distinct values throught related model

    - by matheus.emm
    Hi! I have a simple one-to-many (models.ForeignKey) relationship between two of my model classes: class TeacherAssignment(models.Model): # ... some fields year = models.CharField(max_length=4) class LessonPlan(models.Model): teacher_assignment = models.ForeignKey(TeacherAssignment) # ... other fields I'd like to query my database to get the set of distinct years of TeacherAssignments related to at least one LessonPlan. I'm able to get this set using Django query API if I ignore the relation to LessonPlan: class TeacherAssignment(models.Model): # ... model's fields def get_years(self): year_values = self.objects.all().values_list('year').distinct().order_by('-year') return [yv[0] for yv in year_values if len(yv[0]) == 4] Unfortunately I don't know how to express the condition that the TeacherAssignment must be related to at least one LessonPlan. Any ideas how I'd be able to write the query? Thanks in advance.

    Read the article

  • PHP: How to get creation date from uploaded file?

    - by Haemp
    Problem: I want to determine the original file creation time from a file uploaded to my server via PHP. My understanding is that the file is copied from the client to a temporary file on my server, which then is referenced in the $_FILES var. The temporary file is of course of no use because it was just created. Is there any way I could get the creation date from the clients original file? Thanks

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Passing session data to ModelForm inside of ModelAdmin

    - by theactiveactor
    I'm trying to initialize the form attribute for MyModelAdmin class inside an instance method, as follows: class MyModelAdmin(admin.ModelAdmin): def queryset(self, request): MyModelAdmin.form = MyModelForm(request.user) My goal is to customize the editing form of MyModelForm based on the current session. When I try this however, I keep getting an error (shown below). Is this the proper place to pass session data to ModelForm? If so, then what may be causing this error? TypeError at ... Exception Type: TypeError Exception Value: issubclass() arg 1 must be a class Exception Location: /usr/lib/pymodules/python2.6/django/forms/models.py in new, line 185

    Read the article

  • Is it ok to hardcode dynamic links in a permanent view?

    - by meder
    Let's say I wanted to showcase 2-3 clickable buttons on my homepage which will be there permanently. These are links to the css, html, and javascript tag listing pages. Is it fine to just hardcode href=/tags/css and href=/tags/html right in my django templates/view? I won't change them for at least a year or so, meaning I don't think I need to add a column to the tags table to distinguish them - is this common or should I try to make it somewhat dynamic? These tags are in a table but so are 1000 other tags.

    Read the article

  • Saving related model objects

    - by iHeartDucks
    I have two related models (one to many) in my django app and When I do something like this ObjBlog = Blog() objBlog.name = 'test blog' objEntry1 = Entry() objEntry1.title = 'Entry one' objEntry2 = Entry() objEntry2.title = 'Entry Two' objBlog.entry_set.add(objEntry1) objBlog.entry_set.add(objEntry2) I get an error which says "null value in column and it violates the foreign key not null constraint". None of my model objects have been saved. Do I have to save the "objBlog" before I could set the entries? I was hoping I could call the save method on objBlog to save it all. NOTE: I am not creating a blog engine and this is just an example.

    Read the article

  • Select distinct users with referrals

    - by Mark
    I have a bunch of Users. Since Django doesn't really let me extend the default User model, they each have Profiles. The Profiles have a referred_by field (a FK to User). I'm trying to get a list of Users with = 1 referral. Here's what I've got so far Profile.objects.filter(referred_by__isnull=False).values_list('referred_by', flat=True) Which gives me a list of IDs of the users who have referrals... but I need it to be distinct, and I want the User object, not their ID. Or better yet, it would be nice if it could return the number of referrals a user has. Any ideas?

    Read the article

  • Overwrite queryset which builds filter sidebar

    - by cw
    Hi, I'm writing a hockey database/manager. So I have the following models: class Team(models.Model): name = models.CharField(max_length=60) class Game(models.Model): home_team = models.ForeignKey(Team,related_name='home_team') away_team = models.ForeignKey(Team,related_name='away_team') class SeasonStats(models.Model): team = models.ForeignKey(Team) Ok, so my problem is the following. There are a lot of teams, but Stats are just managed for my Club. So if I use "list_display" in the admin backend, I'd like to modify/overwrite the queryset which builds the sidebar for filtering, to just display our home teams as a filter option. Is this somehow possible in Django? I already made a custom form like this class SeasonPlayerStatsAdminForm(forms.ModelForm): team = forms.ModelChoiceField(Team.objects.filter(club__home=True)) So now just the filtering is missing. Any ideas?

    Read the article

  • Enable export to XML via HTTP on a large number of models with child relations

    - by Vasil
    I've a large number of models (120+) and I would like to let users of my application export all of the data from them in XML format. I looked at django-piston, but I would like to do this with minimum code. Basically I'd like to have something like this: GET /export/applabel/ModelName/ Would stream all instances of ModelName in applabel together with it's tree of related objects . I'd like to do this without writing code for each model. What would be the best way to do this?

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

< Previous Page | 110 111 112 113 114 115 116 117 118 119 120 121  | Next Page >