Search Results

Search found 55188 results on 2208 pages for 'text based'.

Page 114/2208 | < Previous Page | 110 111 112 113 114 115 116 117 118 119 120 121  | Next Page >

  • Date based sum in Excel / Google Docs spreadsheets

    - by alumb
    I have a bunch of rows with a date and a dollar amount (expenses). I want to produce a list of the days of the month and what the balance of the expenses is. So, for example the 5th entry in the list would be 8/5/2008 and the sum of all the expenses that occurred on or before 8/5/2008. Approximately this is =sumif(D4:D30-A5,">0",E4:E30) but of course that doesn't work (where the source data is dates in D4:D30 and the expenses are in E4:E30). Notes source data can't be sorted for various reasons. must work in google spreadsheets, which is a fairly complete subset of excel's functions.

    Read the article

  • Choose relayhost based on the postfix smtpd instance

    - by Zizzencs
    I'd like to setup a postfix host (using RHEL 5.4's default postfix, which is version 2.3) with the following characteristics: an SMTP listener listens on 10.0.0.1:25 and relays all e-mails to 10.0.0.1:2525 an SMTP listener listens on 10.0.0.1:2525 and relays all e-mails to 10.0.0.2:25 Basically the challenge here is to use two different relayhosts for the different SMTP listeners. Is it possible? Is there a better solution to achieve similar behavior?

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Set origin for forwarder based on virtual domain in Postfix

    - by Andrew Koester
    I currently have a machine set up to operate with two domains. The main name uses the standard Unix-user delivery, and the second domain is entirely virtual (using virtual_alias_domains and virtual_alias_maps), with the second domain only forwarding mail. However, when mail is forwarded, it still appears to be delivered by the host of the primary domain (presumably set by myorigin.) Is it possible to get it so when mail is forwarded to the virtual domain, it appears to be delivered by it as well? That domain is on another IP and I'd like to use it so the mail stays consistent. Thanks.

    Read the article

  • Fill down in Excel, but based on multiple values

    - by Jenn D.
    I have spreadsheets (not created by me) that have blank entries in one column where they should really have data. I want to take every empty cell and fill it with the nearest value above it. I'm looking for as little manual intervention as possible, because I'll have to do it repeatedly. I thought some previous version of Excel, or maybe another spreadsheet from the distant past, would do this by default -- that is, if you selected the column with foo and bar, and chose the equivalent of "fill down", you would get what's in the WANT column. What I actually get in Excel is the GET column. HAVE: WANT: GET: foo 1 foo 1 foo 1 2 foo 2 foo 2 bar 1 bar 1 foo 1 2 bar 2 foo 2 3 bar 3 foo 3 I'm worried that this might need a macro to be done properly. I used to be a whiz with Excel macros, and then suddenly they were all in VB. My fallback position will be to dump the whole thing to CSV and write a Python script, but if there's any way to do it in Excel that would be much preferable. Even if it involves a couple of different manual steps, that's fine; just not one step per group of lines. That is, a process of "copy the column, do X to it, cut and paste it back" would work, but "do X for each occurrence of foo or bar" won't. The files are too big for that. Any thoughts are appreciated!

    Read the article

  • route to vpn based on destination

    - by inquam
    I have a VPN connection on a Windows 7 machine. It's set up to connect to a server in US. Is it possible, and if so how, to setup so that .com destinations uses the vpn interface and .se destinations uses the "normal" connection? Edit (clarification): This is for outbound connections. I.e. the machine conencts to a server on foo.com and uses the VPN and the machine connects to bar.se and uses the "normal" interface. Let's say foo.com has an IP filter that ensures users are located in USA, if I go through the VPN I get a US ip and everything is fine. But tif all traffic goes this way the bar.se server that has a IP filter ensuring users are in Sweden will complain. So I want to route the traffic depending on server location. US servers through VPN and others through the normal interface.

    Read the article

  • Windows server 2008 - Access Based Enumeration (ABE) not working correctly

    - by Napster100
    I have a folder shared with permissions of only one user account, admin account and admin group having access to it, but when I open the shared area from a second user account which dose not have access to it, the folder is still visible to the second account despite ABE being enabled on it and all other parent directories/folders and even the the drive. The user can't access the shared folder (which is what I want), but I'd like the folder to also be invisible to that user, just to make it look cleaner and theirs no confusion between what they can access and what they cannot. How would I stop the folder appearing for users who don't have permissions to use it? Thanks in advanced. EDIT: I've just added the second user account to the permissions list but denied it access so that the account definitely has no permissions to access it in any way but that's still not hiding it.

    Read the article

  • Configure PL2303-based USB-to-RS232 adapter to stay awake when no active device is present

    - by casualuser
    I am resurrecting some X10 devices with the aid of a USB-to-RS232 adapter. The problem is, that the adapter only works with the Firecracker device when there is another serial device on the line (the Firecracker is a pass-through device that monitors the RTS and DTR lines to do its magic). Is the PL2303 going to sleep without a real device on the line? Is there an option or command to keep it awake? Is there a cable configuration that would make it work without a real serial device present?

    Read the article

  • Free, web based alternative to Visio?

    - by Lars
    I have used Visio to map out my network structure, and have used the export function to create an HTML page that is searchable by IP, hostname etc. This is a really nice tool and I use it often. However, I would like for users who do not use Internet Explorer to be able to use the search features. What are some alternatives to Visio here? I want to draw a network diagram where objects are searchable. Thanks!

    Read the article

  • Output current with Teensy++ 2.0 (arduino-based hardware)

    - by omtinez
    I am working on a project with a Teensy++ 2.0 for testing, eventually the goal is to use a Teensy 2.0 (info on both available here) and mount it onto a robot R/C car along with a Raspberry Pi. I have been able to use and test one of the very cheap distance sensors that use ultrasound, which requires very little current. I was trying to power a motor, I don't know exactly what kind of motor but I assume a very low-power one which is what comes with the R/C car cheapo, but nothing is happening. When I plug the motor to GROUND and +5V it runs fine, but when I use GROUND and one of the GPIO pins then nothing happens with the motor. The same GPIO pins were tested to successfully power and run the ultrasound sensor, so the board is fine. My suspicion is that the GPIO pins don't output enough current to power the motor, but my knowledge of electronics is rather scarce (I am a computer scientist, not an electrical engineer). So please forgive me if I am asking something obvious or plain stupid, but does the board not have enough power to power the motor? If so, I could try to use a second power supply that would go straight into the motor and use the GPIO as a gate to turn that power on and off; would such thing work? Is there a better design that could be used?

    Read the article

  • Key based authentication (SFTP) failed

    - by rahularyansharma
    I created a pair or RSA keys using Putty key generator, The Public key is attached set on the server side. The private key at windows client machine and being used with pageant and FileZila and working fine. Now Problem is that when I want to connect same sftp through PSFTP commandline tool, it failes. if possible please provide steps to setup ssh key on windows client to access sftp using psftp or direct through batch file.

    Read the article

  • Excel 2010: dynamic update of drop down list based upon datasource validation worksheet changes

    - by hornetbzz
    I have one worksheet for setting up the data sources of multiple data validation lists. in other words, I'm using this worksheet to provide drop down lists to multiple other worksheets. I need to dynamically update all worksheets upon any of a single or several changes on the data source worksheet. I may understand this should come with event macro over the entire workbook. My question is how to achieve this keeping the "OFFSET" formula across the whole workbook ? Thx To support my question, I put the piece of code that I'm trying to get it working : Provided the following informations : I'm using such a formula for a pseudo dynamic update of the drop down lists, for example : =OFFSET(MyDataSourceSheet!$O$2;0;0;COUNTA(MyDataSourceSheet!O:O)-1) I looked into the pearson book event chapter but I'm too noob for this. I understand this macro and implemented it successfully as a test with the drop down list on the same worksheet as the data source. My point is that I don't know how to deploy this over a complete workbook. Macro related to the datasource worksheet : Option Explicit Private Sub Worksheet_Change(ByVal Target As Range) ' Macro to update all worksheets with drop down list referenced upon ' this data source worksheet, base on ref names Dim cell As Range Dim isect As Range Dim vOldValue As Variant, vNewValue As Variant Dim dvLists(1 To 6) As String 'data validation area Dim OneValidationListName As Variant dvLists(1) = "mylist1" dvLists(2) = "mylist2" dvLists(3) = "mylist3" dvLists(4) = "mylist4" dvLists(5) = "mylist5" dvLists(6) = "mylist6" On Error GoTo errorHandler For Each OneValidationListName In dvLists 'Set isect = Application.Intersect(Target, ThisWorkbook.Names("STEP").RefersToRange) Set isect = Application.Intersect(Target, ThisWorkbook.Names(OneValidationListName).RefersToRange) ' If a change occured in the source data sheet If Not isect Is Nothing Then ' Prevent infinite loops Application.EnableEvents = False ' Get previous value of this cell With Target vNewValue = .Value Application.Undo vOldValue = .Value .Value = vNewValue End With ' LOCAL dropdown lists : For every cell with validation For Each cell In Me.UsedRange.SpecialCells(xlCellTypeAllValidation) With cell ' If it has list validation AND the validation formula matches AND the value is the old value If .Validation.Type = 3 And .Validation.Formula1 = "=" & OneValidationListName And .Value = vOldValue Then ' Debug ' MsgBox "Address: " & Target.Address ' Change the cell value cell.Value = vNewValue End If End With Next cell ' Call to other worksheets update macros Call Sheets(5).UpdateDropDownList(vOldValue, vNewValue) ' GoTo NowGetOut Application.EnableEvents = True End If Next OneValidationListName NowGetOut: Application.EnableEvents = True Exit Sub errorHandler: MsgBox "Err " & Err.Number & " : " & Err.Description Resume NowGetOut End Sub Macro UpdateDropDownList related to the destination worksheet : Sub UpdateDropDownList(Optional vOldValue As Variant, Optional vNewValue As Variant) ' Debug MsgBox "Received info for update : " & vNewValue ' For every cell with validation For Each cell In Me.UsedRange.SpecialCells(xlCellTypeAllValidation) With cell ' If it has list validation AND the validation formula matches AND the value is the old value ' If .Validation.Type = 3 And .Value = vOldValue Then If .Validation.Type = 3 And .Value = vOldValue Then ' Change the cell value cell.Value = vNewValue End If End With Next cell End Sub

    Read the article

  • How to filter Varnish logs based on XID?

    - by Martijn Heemels
    I'm running into infrequent 503 errors which appear hard to pinpoint. Varnishlog is driving me mad, since I can't seem to get the information I want out of it. I'd like to see both the client- and backend-communications as seen by Varnish. I thought the XID number, which is logged on Varnish's default error page, would allow me to filter the exact request out of the logging buffer. However, no combination of varnishlog parameters gives me the output I need. The following only shows the client-side communication: varnishlog -d -c -m ReqStart:1427305652 while this only shows the resulting backend communication: varnishlog -d -b -m TxHeader:1427305652 Is there a one-liner to show the entire request?

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Mixed IP and Name Based Virtual Hosts with nginx

    - by nerkn
    I set up many domains but I dont know how to configure if only ip address is given. say foo.com I have a setup to go web/foo.com/htdocs, I want to 88.99.66.55 ip address like a domain to web/fook.com/htdocs server { listen 80; server_name 85.99.66.55; location / { root /home/web/fook.com/htdocs; } location ~ \.(php|php3|php4|php5)$ { root /home/web/fook.com/htdocs; include fastcgi_params; fastcgi_pass 127.0.0.1:9000; } } resulted [warn]: conflicting server name "85.105.65.219" on 0.0.0.0:80, ignored

    Read the article

  • Apache Request IP Based Security

    - by connec
    I run an Apache server on my home system that I've made available over the internet as I'm not always at my home system. Naturally I don't want all my home server files public, so until now I've simply had: Order allow, deny Deny from all Allow from 127.0.0.1 in my core configuration and just Allow from all in the htaccess of any directories I wanted publicly viewable. However I've decided a better system would be to centralise all the access control and just require authentication (HTTP basic) for requests not to 127.0.0.1/localhost. Is this achievable with Apache/modules? If so how would I go about it? Cheers.

    Read the article

  • Running out of space on a SAS-based workstation

    - by SteveWilkinson
    Hi - first question on serverfault - pls excuse if asked elsewhere. I have a Dell Precision 690 with one 73GB (15000RPM) SAS drive in it. Running Windows 7 (x64) with a bunch of apps means it is running out of space. I have on order a 147GB (15000RPM) SAS drive (same GB/s, same make) which I want to put into the machine. Not knowing anything about SAS, do I need to replace the 73GB with the 147GB and restore from a backup, or can I put the drive in the machine and get the controller to treat the two drives as one large one? (The original paperwork for the machine says 73GB SAS (No RAID) if that is relevant.) Thanks in advance.

    Read the article

  • Running out of space on a SAS-based workstation

    - by SteveWilkinson
    Hi - first question on serverfault - pls excuse if asked elsewhere. I have a Dell Precision 690 with one 73GB (15000RPM) SAS drive in it. Running Windows 7 (x64) with a bunch of apps means it is running out of space. I have on order a 147GB (15000RPM) SAS drive (same GB/s, same make) which I want to put into the machine. Not knowing anything about SAS, do I need to replace the 73GB with the 147GB and restore from a backup, or can I put the drive in the machine and get the controller to treat the two drives as one large one? (The original paperwork for the machine says 73GB SAS (No RAID) if that is relevant.) Thanks in advance.

    Read the article

  • Network based on Netgear FVS318 extremely slow

    - by Fentible
    A network I maintain uses an FVS318 as a router, with a separate switch. Communication within the network is slow. Out to the internet is even slower. As it stands there is one patch from the FVS to the switch and no other devices directly connected to the FVS because any that are run so slowly they might as well not be connected to the network. Swapping in a bog-standard home router dramatically increases network speed, but that's not a viable solution because some of the enterprise features of the FVS are required. There are quite a few complaints about this on the Netgear forum, but Netgear support have not been forthcoming with any help - so I turn to you all: any ideas?

    Read the article

  • VBA code to hide or unhide rows based on a cell value

    - by I AM L
    Heres my code, but its not really doing anything, I dont see anything wrong with it: Private Sub PG1(ByVal Target As Range) If .Range("E50").Value = "Passed" Then Rows("51").EntireRow.Hidden = True End If ElseIf Range("E50").Value = "Failed" Then Rows("51").EntireRow.Hidden = True End If End Sub My intention is that when that specific cell in the previous row is set to "Passed" from the dropdown, then the below row would appear, if its a 'Failed" then it'll be hidden instead.

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Record Matching Software to Compare two tables and match on % Based

    - by Crazyd
    So I have some table with Name, Address, and Zip with no record data attached; and I have a table which has all the same, but has more information and I need a way to merge the tables when they don't match 100%. How do I match them up if they aren't Identical? I'm a newb @ SQL, but I know they won't match up for the most part and I can't be the only one with this issue. However software which will do this has proven to be difficult. Writing software to do this would even be worse than having to do it in the first place. I know I can do this in excel; kinda, but with the amount of records I have its proving to be difficult over a million.

    Read the article

  • re-direct SSL pages using header statement based on port

    - by bob's your brother
    I found this in the header.php file of a e-commerce site. Is this better done in a .htaccess file. Also what would happen to any post parameters that get caught in the header statement. // flip between secure and non-secure pages $uri = $_SERVER['REQUEST_URI']; // move to secure SSL pages if required if (substr($uri,1,12) == "registration") { if($_SERVER['SERVER_PORT'] != 443) { header("HTTP/1.1 301 Moved Permanently"); header("Location: https://".$_SERVER['HTTP_HOST'].$_SERVER['REQUEST_URI']); exit(); } } // otherwise us regular non-SSL pages else { if($_SERVER['SERVER_PORT'] == 443) { header("HTTP/1.1 301 Moved Permanently"); header("Location: http://".$_SERVER['HTTP_HOST'].$_SERVER['REQUEST_URI']); exit(); } }

    Read the article

< Previous Page | 110 111 112 113 114 115 116 117 118 119 120 121  | Next Page >