Search Results

Search found 89033 results on 3562 pages for 'style css template file'.

Page 119/3562 | < Previous Page | 115 116 117 118 119 120 121 122 123 124 125 126  | Next Page >

  • Background-color puzzle on CSS for heading/title div.

    - by ProfK
    I have the following title div setup, but when only the leftmost div has content, the red background for the title is not applied. Why is this, as the 'title' div has content, and its background should be red. Head stuff: <title>Into the Breech</title> <link href="Styles/Reset.css" rel="stylesheet" type="text/css" /> <style type="text/css"> body { font-family: Arial, Sans-Serif, System; } #title { background-color: #F71831; font-weight: bold; } .title-segment-left { float: left; } </style> Body stuff: <div id="title"> <div id="menu-title" class="title-segment-left" style="width: 200px;"> Menu </div> <div id="main-title" class="title-segment-left" style="width: auto;"> Home Page </div> <div id="right-title" style="float: right;"> Provantage Media Management System </div> </div>

    Read the article

  • Can't override a global WPF style that is set by TargetType on a single specific control

    - by Matt H.
    I have a style applied to all my textboxes, defined in a resource dictionary.. <Style TargetType="TextBlock"> <Setter Property="TextBlock.FontSize" Value="{Binding Source={StaticResource ApplicationUserSettings}, Path=fontSize, Mode=OneWay}" /> <Setter Property="TextBlock.TextWrapping" Value="Wrap" /> <Setter Property="TextBlock.VerticalAlignment" Value="Center"/> <Setter Property="Background" Value="Transparent"/> <Setter Property="TextBox.FontFamily" Value="{Binding Source={StaticResource ApplicationUserSettings}, Path=fontName, Mode=OneWay}"/> </Style>\ The fontsize and fontstyle properties are bound to a special user settings class that implements iNotifyPropertyChanged, which allows changes to font size and fontfamily to immediately propogate throughout my application. However, in a UserControl I've created (Ironically, the screen that allows the user to customize their font settings), I want the font size and fontfamily to remain static. No matter what I try, my global font settings override what I set in my user control: <UserControl x:Class="ctlUserSettings" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:local="clr-namespace:R2D2" Height="400" Width="600"> <Grid> <Grid.Resources> <Style x:Key="tbxStyle" TargetType="TextBox"> <Style.Setters> <Setter Property="FontSize" Value="14"/> <Setter Property="FontFamily" Value="Tahoma"/> </Style.Setters> </Style> ... etc... <StackPanel Margin="139,122.943,41,0" Orientation="Horizontal" Height="33" VerticalAlignment="Top"> <TextBox Style="{x:Null}" FontSize="13" FontFamily="Tahoma" HorizontalAlignment="Left" MaxWidth="500" MinWidth="350" Name="txtReaderPath" Height="Auto" VerticalAlignment="Top" /> <TextBox Style="{x:tbxStyle}" Margin="15,0,0,0" HorizontalAlignment="Left" Name="txtPath" Width="43" Height="23" VerticalAlignment="Top">(some text)</Button> </StackPanel> I've tried setting Style to {x:Null}, setting custom font sizes inline, and setting a style in the resources of this control. None take precedence over the styles in my resource dictionary. As you can see, I show a sprinkling of all the things I've tried in the XAML sample above... What am I missing?

    Read the article

  • WPF - ListBox ignores Style When ItemsSource is bound

    - by Andy T
    Hi, I have created styled a ListBox in WPF so that it is rendered as a checkbox list. When I populate the ListBox's items manually, the styling works perfectly. However, when I instead bind the ItemsSource of the ListBox to a static resource (an ItemsControl containing the required items), the styling is completely dropped. Here's the style: <Style x:Key="CheckBoxListStyle" TargetType="ListBox"> <Style.Resources> <Style TargetType="ListBoxItem"> <Setter Property="Template"> <Setter.Value> <ControlTemplate TargetType="ListBoxItem"> <Grid Margin="2"> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto" /> <ColumnDefinition /> </Grid.ColumnDefinitions> <CheckBox IsChecked="{Binding IsSelected, RelativeSource={RelativeSource TemplatedParent}, Mode=TwoWay}"/> <ContentPresenter Grid.Column="1" Margin="2,0,0,0" /> </Grid> </ControlTemplate> </Setter.Value> </Setter> </Style> </Style.Resources> <Setter Property="ItemsPanel"> <Setter.Value> <ItemsPanelTemplate> <WrapPanel Orientation="Vertical" /> </ItemsPanelTemplate> </Setter.Value> </Setter> <Setter Property="BorderThickness" Value="0" /> <Setter Property="Background" Value="Transparent" /> </Style> Here's the code for the ListBox that shows the style correctly: <ListBox x:Name="ColumnsList" Grid.Column="0" Grid.Row="0" Style="{StaticResource CheckBoxListStyle}" BorderThickness="1"> <ListBox.Items> <ListBoxItem>Test</ListBoxItem> <ListBoxItem>Test2</ListBoxItem> <ListBoxItem>Test3</ListBoxItem> </ListBox.Items> </ListBox> Here's the code for the ListBox that ignores the style: <ListBox x:Name="ColumnsList2" Grid.Column="0" Grid.Row="0" Style="{StaticResource CheckBoxListStyle}" BorderThickness="1" ItemsSource="{Binding Source={StaticResource Test1}, Path=Items}"> </ListBox> Hoping someone can help - I'm pretty new to all this and have tried everything I can think of, but everything I've read leads me to believe that setting ItemsSource should have the same outcome as setting the items manually, so I can't see any reason why this would not work. Thanks, AT

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • How do I check for a css value using jQuery?

    - by zeckdude
    After the user clicks on a table row, I want it to check if the table row's background-color is white, and if so, it will change the color to light blue. The code I am using is not working. Here it is: $("#tracker_table tr#master").click(function(){ if($(this).css("background-color") == "#FFFFFF") { $(this).css("background-color", "#C2DAEF"); } }); I think there is something wrong with my if statement. How do I check for a css value using jQuery?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • CSS: Possible to define styles mid way through an html document?

    - by Dr. Zim
    In ASP.NET MVC, there are these snippets of html called view templates which appear when their matching data appears on the screen. For example, if you have a customer order and it has a vendor address, the vendor address view template shows up populated with data. Unfortunately, these don't have access to "MasterPages" nor are aware of their CSS surroundings. Instead of loading these up with style tags, is there any way to create partial CSS files that could work for that particular html snippet, a sort of in-line CSS style section? It would be really nice to plop this down just before we render the partial view: <style type="text/css"> input { margin: .2em .2em; overflow: hidden; width: 18.8em; height: 1.6em; border: 1px solid black;} </style> to have the 15 or so input fields in that particular Html snippet be formatted the same. These are swapped out, so the positions of the input fields change. This may also imply a CSS reset on each partial view.

    Read the article

  • How do I change syntax highlighting CSS to a blog hosted on WordPress.com?

    - by Emilio
    I've a blog hosted on WordPress.com, and i've buyed the "Custom CSS" update to modify CSS. Now I want to change some CSS options of Syntax Highlighting provided by Wordpress.com. For example, i want that [code lang="C"] int main() { } [/code] will be displayed with a black background instead of standard white one. I've added in Wordpress.com Appareance > Modify CSS the following code: .syntaxhighlighter { background-color: black !important; } As explained here, but it doesn't works. Any idea?

    Read the article

  • What are cons if we use javascript to apply css property to that browser who do not support that pro

    - by metal-gear-solid
    What are cons if we use JavaScript to apply only CSS property to that browser who do not support that property by default? to keep my HTML semantic and keep free from Deprecated HTML. Is it against content, style and Behavior separation? How much it will effect to site accessibility, usability? What are cons? If I make accessible site then should i only use whatever i can do with pure css. shouldn't use JavaScript to apply CSS properties

    Read the article

  • In CSS, want to override my a:link and a:hover directives to for a specific span

    - by brendan
    This will probably be a softball for you CSS folks... I have a site like this: <div id="header"> <span class="myheader">This is the name of my awesome site!!!!</span> </div> <div id="content">whole bunch of other stuff</div> <div="sidemenu"><ul><li>something</li><li>something else</li></ul> <div id="footer">Some footer stuff will go here....</div> In my css I have some directives to format the hyperlinks: a:link { text-decoration: none; color : #ff6600; border: 0px; -moz-outline-style: none;} a:active { text-decoration: underline; color : #ff6600; border: 0px; -moz-outline-style: none;} a:visited { text-decoration: none; color : #ff6600; border: 0px; -moz-outline-style: none;} a:hover { text-decoration: underline; color : #000; border: 0px; -moz-outline-style: none;} a:focus { outline: none;-moz-outline-style: none;} Now here is the problem. In my header I have some text that is a link, but I do not want to to format it like all the other links in the site. So basically I want my a:link, a:hover, etc to ignore anything in the "header" div. How can I do this? Assume I need to override this for that div/span?

    Read the article

  • What is preferred strategies for cross browser and multiple styled table in CSS?

    - by jitendra
    What is preferred strategies for cross browser and multiple styled table in CSS? in default css what should i predefined for <table>, td, th , thead, tbody, tfoot I have to work in a project there are so many tables with different color schemes and different type of alignment like in some table , i will need to horizontally align data of cell to right, sometime left, sometime right. same thing for vertical alignment, top, bottom and middle. some table will have thin border on row , some will have thick (same with column border). Some time i want to give different background color to particular row or column or in multiple row or column. So my question is: What code should i keep in css default for all tables and how to handle table with different style using ID and classes in multiple pages. I want to do every presentational thing with css. How to make ID classes for everything using semantic naming ? Which tags related to table can be useful? How to control whole tables styling from one css class?

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • How can I have a certain set of CSS properties affect only IE users?

    - by rowan
    definately one or the other, not one and the other if.... HTML doesnt have an else function.. or does it? could you please be so kind as to code it in your answer im a php newb but so far getting nice results! this one's got be buggered though. if browser = IE then css/ie.css else css/moz even a webkit 3rd option if you think its needed... thanks guys you're all marvelous. also, does anyone know of a full properties list for webkit transitions/css?d

    Read the article

  • What is the preferred way of loading browser-specific CSS files?

    - by Yuval A
    What is the best way to handle browser-specific CSS file loading? Assume you are running in the context of a proper MVC framework. Here are some options, you are free to discuss the pros and cons of these options as well as any other methods you know of, and prefer: Server-side solution: use the controller (e.g. servlet) to analyze the user-agent header in the request and return the proper CSS file in the view. Use browser specific hacks to load files, such as: <!--[if IE]> ... <![endif]--> Load CSS files asynchronously in client side by inspecting user-agent and adding respective files Use a client side framework to handle browser-specifics (such as jQuery browser-specific css rules)

    Read the article

  • Compiling CSS to SWF server side Java, What is the best practice?

    - by DataSurfer
    My project allows users to create custom css for our flex app. In regards to compiling the CSS into SWFs on the server side: Should I use the flex2.compiler.css.Compiler class in mxmlc-3.5.0.12683.jar? Or Should I invoke mxmlc from Runtime.getRuntime().exec()? The css.Compiler class is not very well documented. Does anyone have any examples that use this? For the Runtime exec method, what is the best way to package mxmlc into the maven build so its available to the server at runtime?

    Read the article

  • Why do browser vendors make their own css properties?

    - by jitendra
    Why do browser vendors make their own css properties, even they know these will not pass the w3c validation? What is the purpose? Is for their own testing, or for web developers, or to demonstrate browser capabilities to the world and to the W3C organizations and to CSS development team of W3C? is it like a beta version of demonstration? if i use any browser specific for now can they remove that property's support from future versions.will i have to edit my css in future For example: https://developer.mozilla.org/en/CSS_Reference/Mozilla_Extensions

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

< Previous Page | 115 116 117 118 119 120 121 122 123 124 125 126  | Next Page >