Search Results

Search found 518 results on 21 pages for 'brij raj singh'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 12/21 | < Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >

  • Source control on internet i.e. no private networks.

    - by Kavitesh Singh
    Me and my friend are in the process of starting a small project and want to implement a source control. Now both are located in different cities and can communicate using internet for file sharing etc. I need an online hosting solution or any way where i can maintain the source code repository for both of us to check in/out. As of now we want to maintain it as private project. Does sourceforge allow hosting projects which would not be opensource? One option i was thinking, to obtain a static IP form ISP and host the repository.But that mean my system needs to be online when my friend wants to checkin/out or do some diff with old version code. Secondly, would SVN or git be a better choice in such a situation. I have no experience in git/mercurial as of now.

    Read the article

  • check only one checkbox in gridview using jquery

    - by Gurbax Singh Bhangal
    i have a grid view in which i have placed the checkbox in itemtemplate i want only the one checkbox is selected from Gridview to select that perticular row so that i can use that id to edit or delete the row aspx page code is <asp:TemplateField Visible="false"> <ItemTemplate> <asp:Label ID="lblId" runat="server" Text='<%#Eval("id") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Select </HeaderTemplate> <ItemTemplate> <asp:CheckBox ID="chkSelect" runat="server"/> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Branch Name </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblBranch_Name" runat="server" Text='<%# Bind("Branch") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> Address </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblAddress" runat="server" Text='<%# Eval("Address") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> <asp:TemplateField> <HeaderTemplate> City </HeaderTemplate> <ItemTemplate> <asp:Label ID="lblCity" runat="server" Text='<%# Bind("City") %>'></asp:Label> </ItemTemplate> </asp:TemplateField> </Columns> and i want when i click on the checkbox which is at first of each row only one check box is selected from all the rows thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • select option in Safari ?

    - by Karandeep Singh
    < select size="2" multiple> < option value="1">1< /option> < option value="2">2< /option> < option value="3">3< /option> < option value="4">4< /option> < option value="5">5< /option> < option value="6">6< /option> < option value="7">7< /option> < option value="8">8< /option> < option value="9">9< /option> < option value="10">10< /option> < option value="11">11< /option> < option value="12">12< /option> < option value="13">13< /option> < /select> size attribute of Select tag is not working properly in Safari. if size attribute's value is greater than four then there have no problem, its working. But when I set the value of size less than four then it show four values. above example displays four options in safari but I want two options. What is the reason for this ?

    Read the article

  • Index Tuning for SSIS tasks

    - by Raj More
    I am loading tables in my warehouse using SSIS. Since my SSIS is slow, it seemed like a great idea to build indexes on the tables. There are no primary keys (and therefore, foreign keys), indexes (clustered or otherwise), constraints, on this warehouse. In other words, it is 100% efficiency free. We are going to put indexes based on usage - by analyzing new queries and current query performance. So, instead of doing it our old fashioned sweat and grunt way of actually reading the SQL statements and execution plans, I thought I'd put the shiny new Database Engine Tuning Advisor to use. I turned SQL logging off in my SSIS package and ran a "Tuning" trace, saved it to a table and analyzed the output in the Tuning Advisor. Most of the lookups are done as: exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',1 exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',2 exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',3 exec sp_executesql N'SELECT [Active], [CompanyID], [CompanyName], [CompanyShortName], [CompanyTypeID], [HierarchyNodeID] FROM [dbo].[Company] WHERE ([CompanyID]=@P1) AND ([StartDateTime] IS NOT NULL AND [EndDateTime] IS NULL)',N'@P1 int',4 and when analyzed, these statements have the reason "Event does not reference any tables". Huh? Does it not see the FROM dbo.Company??!! What is going on here? So, I have multiple questions: How do I get it to capture the actual statement executing in my trace, not what was submitted in a batch? Are there any best practices to follow for tuning performance related to SSIS packages running against SQL Server 2008?

    Read the article

  • What is the difference between clearcase and vss in label a release?

    - by raj
    Hi, We are using clearcase as our SCM. I have not much experience with clearcase. Now we are about to release our code to production. I want to label my code as I have done using VSS in my previous projects. But in clearcase labeling is not as easy as in VSS. clearcase is asking to create a label type before label a folder in VOB. I don't understand the concept of creating label type? Any guidance on this will be highly appreciated.

    Read the article

  • pivots using pyExcelerator/xlrd

    - by Raj N
    How can I go about creating a sheet with a pivot table using python libs like pyExcelerator / xlrd? I need to generate a daily report that has a pivot table to summarize data on other sheets. One option would be to have a blank template that I copy and populate with the data. In this case, is there a way to refresh the pivot from code? Any other suggestions?

    Read the article

  • specifying multiple URLs with cURL/PHP using square brackets

    - by Raj Gundu
    I have a large array of URLS similar to this: $nodes = array( 'http://www.example.com/product.php?page=1&sortOn=sellprice', 'http://www.example.com/product.php?page=2&sortOn=sellprice', 'http://www.example.com/product.php?page=3&sortOn=sellprice' ); The cURL manual states here (http://curl.haxx.se/docs/manpage.html) that i can use square brackets '[]' to specify multiple urls. Used in the above example this would be similar to this: 'http://www.example.com/product.php?page=[1-3]&sortOn=sellprice' So far i have been unable to reference this correctly. This is the complete code segment I'm currently trying to utilize this with: $nodes = array( 'http://www.example.com/product.php?page=1&sortOn=sellprice', 'http://www.example.com/product.php?page=2&sortOn=sellprice', 'http://www.example.com/product.php?page=3&sortOn=sellprice' ); $node_count = count($nodes); $curl_arr = array(); $master = curl_multi_init(); for($i = 0; $i < $node_count; $i++) { $url =$nodes[$i]; $curl_arr[$i] = curl_init($url); curl_setopt($curl_arr[$i], CURLOPT_RETURNTRANSFER, true); curl_multi_add_handle($master, $curl_arr[$i]); } do { curl_multi_exec($master,$running); } while($running > 0); echo "results: "; for($i = 0; $i < $node_count; $i++) { $results = curl_multi_getcontent ( $curl_arr[$i] ); echo( $i . "\n" . $results . "\n"); echo 'done'; I can't seem to find any more documentation on this. Thanks in advance.

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • how to design two inputs in or/And logic for email form with validation

    - by Raj Nimbalkar
    my purpose is user enter only email or mobile number.i have the partial success in that.code notify user in OR logic but....IF user entered the incorrect mobile & email @same time then user must be notified for dat. var emailReg = /^([\w-\.]+@([\w-]+\.)+[\w-]{2,4})?$/; var emailaddressVal = $("#UserEmail").val(); ////email & mobile input cheak if(emailaddressVal == '' && $("#mobile").val() == '') { $("#UserEmail").after('<p><span class="error">Please enter your email address.</span></p>') $("#mobile").after('<p><span class="error">Please enter your Mobile number.</span></p>') hasError = true; } //////validating currect email else if(!emailReg.test(emailaddressVal)) { $("#UserEmail").after('<p><span class="error">Enter a valid email address.</span></p>') hasError = true; } //////Mobile number else if( $("#mobile").val()) { $("#mobile").after('<p><span class="error">Enter currect Mobile number.</span></p>') hasError = true; }

    Read the article

  • how to create Cross domain asp.net web service

    - by Prithvi Raj Nandiwal
    i have create a web service. i want to access this web service using Ajax jqury. i am able to access on same domain. but i want to access thia web service to another domain. Have any one idea. how to create cross domain web service in asp.net. any setting in web,config file so that i access it on another domain. my webservice [WebService(Namespace = "http://tempuri.org/")] [System.Web.Script.Services.ScriptService] public class Service : System.Web.Services.WebService { public Service () { } [WebMethod] public string SetName(string name) { return "hello my dear friend " + name; } } JavaScript $.ajax({ type: "GET", url:'http://192.168.1.119/Service/SetName.asmx?name=pr', ContentType: "application/x-www-form-urlencoded", cache: false, dataType: "jsonp", success: onSuccess });

    Read the article

  • 'mvn install' does not work & shows error while attempting to download

    - by Raj
    I am using maven 3.0.2 version. mvn --version works fine on command line but when I try mvn install it does not work & shows following error. Z:\dev\hector rantavmvn install [INFO] Scanning for projects... Downloading: http://repo1.maven.org/maven2/junit/junit/3.8.2/junit-3.8.2.jar [ERROR] The build could not read 1 project - [Help 1] [ERROR] [ERROR] The project me.prettyprint:hector:0.7.0-24-SNAPSHOT (Z:\dev\hector ran tav\pom.xml) has 1 error [ERROR] Unresolveable build extension: Plugin org.apache.maven.scm:maven-scm -manager-plexus:1.3 or one of its dependencies could not be resolved: Could not transfer artifact junit:junit:jar:3.8.2 from/to central (http://repo1.maven.org/ maven2): Error transferring file: repo1.maven.org: Unknown host repo1.maven.org - [Help 2] [ERROR] [ERROR] To see the full stack trace of the errors, re-run Maven with the -e swit ch. [ERROR] Re-run Maven using the -X switch to enable full debug logging. [ERROR] [ERROR] For more information about the errors and possible solutions, please rea d the following articles: [ERROR] [Help 1] http://cwiki.apache.org/confluence/display/MAVEN/ProjectBuildin gException [ERROR] [Help 2] http://cwiki.apache.org/confluence/display/MAVEN/PluginResoluti onException Z:\dev\hector rantav Please let me how I can fix this.

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • Silverlight Application

    - by Avijit Singh
    I have prepared a Silverlight application and my database is in the server. Its running smoothly for small set of data but for large data set giving an error : Remote Serve returned an error:notFound. How can i resolve it,please any one solve this problem. I have build it in ASP.NET with C#. So kindly provide the solution in C# if possible.

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • Parsing the json and storing it in an array?

    - by Prateek Raj
    hi everyone, i'm very new to this web related problems, please help i'm working on sencha which proves to be very difficult wen it comes to json parsing . . . . so i'm planning on retrieving the data to the html page and then load it into my js file. . . so here is the problem: i've already asked about it and got a reply.. http://jsbin.com/uwuca5 but now wen i use the html source code locally in my system or even by using the IIS i couldn't parse the data. . . . . . . here is the link for my json file: http://compliantbox.com/optionsedge/sample.php i'm trying to use this link in my code and retrive the data but the data is returning null Please Help Thank you,

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >