Search Results

Search found 1139 results on 46 pages for 'ravi kumar h m'.

Page 12/46 | < Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy constructor with more than one parameter

    - by Ravi Gupta
    I am learning C++ and was reading copy constructor from the C++: The Complete Reference. The books says that It is permissible for a copy constructor to have additional parameters as long as they have default arguments defined for them. However, in all cases the first parameter must be a reference to the object doing the initializing. But I am confused that how we are going to pass those additional parameters? I am sure there should be some way which is not given in the book and which I am unable to figure out. Can anyone help me out? EDIT: Also is it possible to pass these extra parameters in all three cases i.e. ¦ When one object explicitly initializes another, such as in a declaration ¦ When a copy of an object is made to be passed to a function ¦ When a temporary object is generated (most commonly, as a return value)

    Read the article

  • Stored procedure using cursor in mySql.

    - by RAVI
    I wrote a stored procedure using cursor in mysql but that procedure is taking 10 second to fetch the result while that result set have only 450 records so, I want to know that why that proedure is taking that much time to fetch tha record. procedure as below: DELIMITER // DROP PROCEDURE IF EXISTS curdemo123// CREATE PROCEDURE curdemo123(IN Branchcode int,IN vYear int,IN vMonth int) BEGIN DECLARE EndOfData,tempamount INT DEFAULT 0; DECLARE tempagent_code,tempplantype,tempsaledate CHAR(12); DECLARE tempspot_rate DOUBLE; DECLARE var1,totalrow INT DEFAULT 1; DECLARE cur1 CURSOR FOR select SQL_CALC_FOUND_ROWS ad.agentCode,ad.planType,ad.amount,ad.date from adplan_detailstbl ad where ad.branchCode=Branchcode and (ad.date between '2009-12-1' and '2009-12-31')order by ad.NUM_ID asc; DECLARE CONTINUE HANDLER FOR SQLSTATE '02000' SET EndOfData = 1; DROP TEMPORARY TABLE IF EXISTS temptable; CREATE TEMPORARY TABLE temptable (agent_code varchar(15), plan_type char(12),sale double,spot_rate double default '0.0', dATE DATE); OPEN cur1; SET totalrow=FOUND_ROWS(); while var1 <= totalrow DO fetch cur1 into tempagent_code,tempplantype,tempamount,tempsaledate; IF((tempplantype='Unit Plan' OR tempplantype='MIP') OR tempplantype='STUP') then select spotRate into tempspot_rate from spot_amount where ((monthCode=vMonth and year=vYear) and ((agentCode=tempagent_code and branchCode=Branchcode) and (planType=tempplantype))); INSERT INTO temptable VALUES(tempagent_code,tempplantype,tempamount,tempspot_rate,tempsaledate); else INSERT INTO temptable(agent_code,plan_type,sale,dATE) VALUES(tempagent_code,tempplantype,tempamount,tempsaledate); END IF; SET var1=var1+1; END WHILE; CLOSE cur1; select * from temptable; DROP TABLE temptable; END // DELIMITER ;

    Read the article

  • Crystal Report Portuguese language support

    - by Ravi Gupta
    Hi I am using Crystal Reports 10 with IIS Server. I wish to display some of the reports in Portuguese language. How can I configure Crystal Reports to display data in Portuguese ? I guess I will need to download a language pack for this but will it allow word-by-word conversion from English to Portuguese ? Grammatically correct sentences are not currently my concern. Any inputs will be greatly appreciated.

    Read the article

  • Setting up a non-emacs Common Lisp Dev Env for web application development?

    - by Ravi S
    I am trying to set up a Common Lisp Dev Env for web application development on my Ubuntu 10.04 LTS 64-bit box and I can't find a single decent guide that is targeted at noobs. The closest I came is with Peter Seibel's Lisp in a box but I detest Emacs with a passion and it seems to have older versions of SBCL and CLISP (which are my preferred CL implementations). I do not want to use any of the commercial implementations. I am looking for a simple setup to write some very basic CRUD apps involving possibly hunchentoot, some framework like weblocks,CL-WHO, CL-SQl, sqlite or some datastores from the nosql family like mongo and couch.. Assuming, I go with either SBCL or CLISP on Linux, what is the best tool to manage packages and libraries? ASDF? I am looking for simplicity and consistency and I don't expect to use a ton of libs...

    Read the article

  • Is there a Scheduler/Calendar JS Widget library?

    - by Ravi Chhabra
    I am looking for some JavaScript based component to be used as a course scheduler which would be a cross between Google Calendar and the login time. I do not know if the right term for this is Course Scheduler but I shall describe this in more detail here. Course Scheduler The widget would be used to enter date and times of a course, as an example if I run a programming course 3 days a week on Mon, Tue and Wed every 7:00 am to 9:00am, 2 hours every day from 1st September to 30th November. I could answer various questions and the course data would be displayed in the calendar. It would also allow for non pattern based timings where each week is different from the other week etc. Question So would I end up creating something from scratch? Would it be sensible to use Google Calendar API for this? I did a Google search for some widgets, but I believe I need better keywords, as I could not find anything close to what I am looking for. Any tips? Commercial libraries would also work for me. Thanks.

    Read the article

  • Close smartpart view

    - by Ravi
    I am developing windows Forms application, for this i am using SmartClient. Here i click workspace close('X') event at the time i want to display messageBox based on user input (OK/Cancel) i have to decide pane has to be close or not.

    Read the article

  • How to deal with extra space characters while Reading a CSV file?

    - by Ravi Dutt
    I am reading a CSV file with CSV Open Source API. as shown below: Java Code:--> CSVReader reader = new CSVReader(new FileReader(filePath),'\n'); String[] values; if((read=(reader.readNext()))!=null) { values = (read[0].split(" (?=([^\"]*\"[^\"]*\")*[^\"]*$)",-1)).length; } // code ends here When I read this CSV file line by line and split that line with delimiter. Then after spliting values each value I get contains extra space character after each character in String. Suppose value in file is like "ABC" and I got this after reading from CSV file reader as " A B C " . I used removeAll("\s+","") on each value even after it is not working. Thank You in Advance.

    Read the article

  • How to see errors in an asp.net website?

    - by Jayam Ravi
    I just want to see error insteas of asp.net showing me default error Server Error in '/' Application. What should i change in web config? I used this, <customErrors mode="RemoteOnly" defaultRedirect="GenericErrorPage.htm"> <error statusCode="403" redirect="NoAccess.htm" /> <error statusCode="404" redirect="FileNotFound.htm" /> </customErrors> Any suggestion i want to see errors in browser as i do live testing...

    Read the article

  • FOP Encoding issue

    - by Ravi chandra
    Hi Guys, I have a similar issue.. I have HTML stored in DB clob. I am retrieving that and converting to XHTML using TIDY.jar. Once i got XHTML then using FOP i am converting to XSL-FO. Finally XSL-FO is rendering in PDF. Previously everything is working fine with Linux-WAS5-java1.4. Recently we migrated the apps to Linux-WAS6-Java1.5. Now XHTML to XSL-FO is messing up everything. XSL-FO contains ???(Question marks) in the place of Euro, spase(nbsp), Agrave, egrave ..etc. I tried changing the JVM encoding to UTF-8 and also i have modified my servlet request and response to support UTF-8. I am helfless and unable to figure where exactly the issue is coming out. Can someone please check this and suggest me some solution. Thanks in advance

    Read the article

  • visual studio 2008 linker error

    - by ravi
    In visual studio 2008, I have created a static dll called test_static.dll. I am trying to call this from one application. I have included this dll in source files folder and the header file related to it in headers folder. When i am running the application I am getting following liking error. Please give me a solution. error LNK2019: unresolved external symbol "struct morph_output * __cdecl morpho_data(struct morph_input *)" (?morpho_data@@YAPAUmorph_output@@PAUmorph_input@@@Z) referenced in function _wmain 1D:\test_app\Debug\test_app.exe : fatal error LNK1120: 1 unresolved externals 1Build log was saved at "file://d:\test_app\test_app\Debug\BuildLog.htm" Here test_app is application that is using static dll. and morpho_data is the dll function which is taking input as structure and returning another structure.

    Read the article

  • Weird output of Throwable getMessage()

    - by Ravi Gupta
    Hi I have below pseudo code with throws an exception like this throw new MyException("Bad thing happened","com.stuff.errorCode"); where MyException extends Exception class. So the problem is when I try to get the message from MyException class by calling myEx.getMessage() it returns ???en_US.Bad thing happened??? instead of my original message i.e. Bad thing happened I have checked that MyException class doesn't overrides Throwable class's getMessage() behavior. Below is the how the call passes from MyException.getMessage() to Throwable.getMessage() public MyException(String msg, String sErrorCode){ super(msg); this.sErrorCode = sErrorCode; this.iSeverity = 0; } which then calls public Exception(String message) { super(message); } and finally public Throwable(String message) { fillInStackTrace(); detailMessage = message; } when I do a getMessage on myexception it calls Throwable's getMessage as below public String getMessage() { return detailMessage; } So ideally it should return the original message as I set when throwing the exception. What's the ???en_US thing ?

    Read the article

  • Not getting content in Excel sheet after exporting using DynamicJasper in grails

    - by Ravi
    Hi. I am new to grails and jasper reports. Please help me with the issue. I am trying one example on how to save in excel format the data that we display in grails. I am able to save as excel but not able to get anything inside excel sheet after opening it, not even columns. Refer the link http://www.wysmedia.com/2009/05/dance-with-dynamic-jasper-report/ for the example I am trying. Many thanks.

    Read the article

  • Applications of Unification?

    - by Ravi
    What are (practical) applications of Unification ? Where it is been used in real world? I couldn't get the whole idea of what it is really about and why its considered as a part of Artificial Intelligence.

    Read the article

  • Update database every 30 minutes once

    - by Ravi
    Hi, I am working on C#.Net Windows application with SQL Server 2005. This project i am using ADO.Net Data-service for database maintenance. I am working on industrial automation domain, here data keep on reading more than 8 hours. After reading data from device based on the trigger i have periodically update data to database. for example start reading data on 9.00AM, trigger firing on 9.50AM. Once trigger fire, last 30 minutes(9.20 AM to 9.50AM) data store into data base. After trigger firing keep on reading data from device and store into data base. 10.00AM trigger going to off at time storing data to database has to be stop. Again trigger firing on 11.00AM. Once trigger fire, last 30 minutes(10.30 AM to 11.00AM) data store into data base. After trigger firing keep on reading data from device and store into data base. After 10.00AM trigger not firing means data keep on store locally. Here i don't know until trigger fire keep on reading data where & how to maintain temporarily , After trigger firing, last 30 minutes data how to bring and store into database. I don't know how to achieve it. It would be great if anyone could suggest any idea. Thanks

    Read the article

< Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >