Search Results

Search found 45975 results on 1839 pages for 'convert text to audio'.

Page 121/1839 | < Previous Page | 117 118 119 120 121 122 123 124 125 126 127 128  | Next Page >

  • convert home phone wiring to Ethernet

    - by aaa
    can i convert phone wiring in walls to act as only Ethernet network cause the phone wiring is not in use and not connected to the phone company so there is no voltage in the wires i remove the wall plate and i find 6 wires blue,blue/white,green,green/white,orange,orange/white , and i know that Ethernet use 8 here is what i am thinking get Ethernet cable cut it in half and attach wires from wall to the first computer and the same with the other computer so if this is possible do i just attach wires in the same color and ignore brown wire or do i have to rearrange wires , and how much the speed will be thank you in advance

    Read the article

  • convert home phone wiring to Ethernet

    - by aaa
    can i convert phone wiring in walls to act as only Ethernet network cause the phone wiring is not in use and not connected to the phone company so there is no voltage in the wires i remove the wall plate and i find 6 wires blue,blue/white,green,green/white,orange,orange/white , and i know that Ethernet use 8 here is what i am thinking get Ethernet cable cut it in half and attach wires from wall to the first computer and the same with the other computer so if this is possible do i just attach wires in the same color and ignore brown wire or do i have to rearrange wires , and how much the speed will be thank you in advance

    Read the article

  • How to copy/paste LARGE amounts of text in Windows

    - by Johnson
    I am not sure if this is more suited for Superuser or Stackoverflow, but here goes... A little bit of background: I'm learning SQL and was trying to make a very large table which I could use for optimization tests. Something generic with random values. I created a little Java program to do just that, and was able to put out a text file with 100,000 lines, each line being an SQL INSERT statement for a new random record. However, with anything much bigger than 100,000 lines, I had problems either opening/using the text file in any text editor, or copying/pasting the text to the windows clipboard and then into SQL Developer so I could execute it as a script. I'm probably overlooking something really obvious, or doing something really stupid. There has got to be a better way to do this, but I couldn't find anything through Google or Stackoverflow or Superuser. Thanks!

    Read the article

  • 'Can't convert nil into String' error upon Puppet run

    - by Adrian
    When attempting to use modules copied into the Puppet modules directory, my puppet client returns ' Could not retrieve catalog from remote server: Error 400 on SERVER: can't convert nil in String' errors when connecting to the Puppet master server. [root@puppetmaster modules]# rpm -qa *puppet* puppet-2.7.18-1.el6.noarch puppet-server-2.7.18-1.el6.noarch [root@puppetmaster modules]# uname -sr Linux 2.6.32-279.el6.x86_64 Code all checks out and is valid. SELinux is turned on.

    Read the article

  • Convert FAT32 to NTFS, risk/time?

    - by Rakward
    After a quick search I found that through a command prompt I can convert a drive from FAT32 to NTFS without losing data(see here). What I want to ask here is, how safe is this method on a 1.5 TB drive with 500 GB of data? What are the chances of this freezing up(or is there really nothin to worry about) and what is the probable time, a couple of minutes or a whole hour? Sorry if this seems like a stupid question, just want to play on the safe side here ...

    Read the article

  • Any website/software where i can add some text rows on daily basis

    - by Moorage
    I have few notes or text like few remembering lines on daily or weekly basis. I want to write it. but i should be able to see at any backdate /monthly or yearly. The date-time should also be stored when i enter text. is it possible EDIT: I will explain clearly what i exactly want. Suppose while working on internet 1)i find "ABC is good for BCD". now i want to add that text to some online site where i can see later 2)Now i can add those type of things any time and on internet i can see that in tabular form like click to see montly list , yearly or weekly 3)Other thing is i should be able to add text as easy as possible like in firefox if i can press some shotcut and enter something and it gets added there rather than opening the site and then write The to do list do that sort of thing but they dont have creation date , rather they filter based on due date.

    Read the article

  • Making audio CDs en mass - Linux based solutions?

    - by The Journeyman geek
    My mom's sings and gives away cds to people. Invariably it falls to me to have to burn cds for her, and burning 50-100 cds on a single drive is a pain. I DO have a handful of cd burners and a slightly geriatric old PIII 450. This is what i want to be able to do - either point an application at a folder of WAV or MP3s, say how many copies i need on CLI (since then i can SSH into the system and use it headless) feed 2 or more CD burners cds until its done, OR pop in a single CD into a master drive and have its contents duplicated to 2 or more burners. I'd rather have it running on linux, be command line based, and be as little work as possible - almost automatic short of telling it how many copies i want would be ideal. I'm sure i'll have people wondering about legality - My mom sings her own music, and its classical, and older than copyright law, so, that's a non issue. I just want a way to make this chore a little easier, short of telling my mom to do it herself.

    Read the article

  • Can't select text with mouse in Word / Office 2007

    - by asc99c
    I'm having a very weird problem here for the last few months. In Word, and in fact all programs from the Office 2007 suite, I can't drag the mouse pointer to select text. I can click at a point in the text and the cursor moves correctly to that point. If I double click, the word under the cursor is selected, and triple clicking selects the whole line. However if I hold the mouse button down and drag the mouse, no text is selected. Occasionally the problem disappears and everything works fine, but it then reappears a few minutes later. Text selection with the mouse works everywhere else (Firefox, PuTTY, OpenOffice), just not in Office. The only addins are Google Desktop Office Addin, and Person Name (). For info it is Office 2007 SP3, running on Windows 7 64-bit.

    Read the article

  • Free OCR for Arabic text

    - by pnuts
    A friend has requested I convert an Arabic text .pdf into Word. Google Docs does not seem an option but new OCR looked promising because Arabic is featured in the 'Recognition language' dropdown. I have failed to get this to work beyond "Error! Text can not be recognized." even with only a few sample pages (111KB). I'd much appreciate any advice about what I am doing wrong at that site (or even how to access any help available there!) or pointing to other (free!) options that work with Arabic text (preferably that do not require registration and or large downloads). Anyone willing to help please? Note this .pdf does not have a text layer.

    Read the article

  • Keyboard Shortcut for Navigating to a Text Field in Google Chrome

    - by Micky McQuade
    I am trying to use keyboard shortcuts more and more and have run across something I've not been able to figure out. If there is a text box on the page that I want to enter text into, how can I navigate to that field quickly without actually clicking on it with the mouse? I know I can just start tabbing and eventually get to it I've tried using Ctrl-F to find text near it and then tab to it Any ideas?

    Read the article

  • How to get rid of large gaps in text in MS Word

    - by Kristin
    When formatting a document such as a resume, MS Word often inserts a large gap in the text--sometimes as much as half a page of blank space. When I try to delete the gap, moving the cursor from the continued text after the gap, it skips over the gap as if it's not even there, and deletes text from the previous point in the document before the gap. I can't "grab" the gap or highlight/delete the gap in any way. Ideas??

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • How to single click and select text?

    - by jasondavis
    I am having a issue I have never experienced until recently, I believe (hoping) it is just a setting I can change? The issue: When I left click and hold the left mouse button down and slide the mouse around to select text in a document or webpage, it works as far as selecting the text, however when I release the left button , it does not stop selecting more text. Instead I must hit the left button again to stop it from selecting more text. This is very annoying, at first I thought I just had a faulty mouse but I just bought a new mouse and it is the same problem. I am running windows 7 pro Please help, hoping it is something simple I overlooked?

    Read the article

  • Copy all text in a LibreOffice Draw drawing

    - by harbichidian
    I have a large flowchart, created in LibreOffice Draw (3.3.1), that I would like to copy all of the text from. I do not need, nor care about the order or structure, I just need all of the text from within the blocks. I can't seem to find any way to export without turning it into an image, and none of the "Paste Special" options allow me to get unformatted text. Is there a way to do this without retyping everything?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert apache rewrite rules to nginx

    - by Shiyu Sekam
    I want to migrate an Apache setup to Nginx, but I can't get the rewrite rules working in Nginx. I had a look on the official nginx documentation, but still some trouble converting it. http://nginx.org/en/docs/http/converting_rewrite_rules.html I've used http://winginx.com/en/htaccess to convert my rules, but this just works partly. The / part looks okay, the /library part as well, but the /public part doesn't work at all. Apache part: ServerAdmin webmaster@localhost DocumentRoot /srv/www/Web Order allow,deny Allow from all RewriteEngine On RewriteRule ^$ public/ [L] RewriteRule (.*) public/$1 [L] Order Deny,Allow Deny from all RewriteEngine On RewriteCond %{QUERY_STRING} ^pid=([0-9]*)$ RewriteRule ^places(.*)$ index.php?url=places/view/%1 [PT,L] # Extract search query in /search?q={query}&l={location} RewriteCond %{QUERY_STRING} ^q=(.*)&l=(.*)$ RewriteRule ^(.*)$ index.php?url=search/index/%1/%2 [PT,L] # Extract search query in /search?q={query} RewriteCond %{QUERY_STRING} ^q=(.*)$ RewriteRule ^(.*)$ index.php?url=search/index/%1 [PT,L] RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d # Rewrite all other URLs to index.php/URL RewriteRule ^(.*)$ index.php?url=$1 [PT,L] Order deny,allow deny from all ErrorLog ${APACHE_LOG_DIR}/error.log # Possible values include: debug, info, notice, warn, error, crit, # alert, emerg. LogLevel warn AddHandler php5-fcgi .php Action php5-fcgi /php5-fcgi Alias /php5-fcgi /usr/lib/cgi-bin/php5-fcgi FastCgiExternalServer /usr/lib/cgi-bin/php5-fcgi -socket /var/run/php5-fpm.sock -pass-header Authorization CustomLog ${APACHE_LOG_DIR}/access.log combined Nginx config: server { #listen 80; ## listen for ipv4; this line is default and implied root /srv/www/Web; index index.html index.php; server_name localhost; location / { rewrite ^/$ /public/ break; rewrite ^(.*)$ /public/$1 break; } location /library { deny all; } location /public { if ($query_string ~ "^pid=([0-9]*)$"){ rewrite ^/places(.*)$ /index.php?url=places/view/%1 break; } if ($query_string ~ "^q=(.*)&l=(.*)$"){ rewrite ^(.*)$ /index.php?url=search/index/%1/%2 break; } if ($query_string ~ "^q=(.*)$"){ rewrite ^(.*)$ /index.php?url=search/index/%1 break; } if (!-e $request_filename){ rewrite ^(.*)$ /index.php?url=$1 break; } } location ~ \.php$ { fastcgi_pass unix:/var/run/php5-fpm.sock; fastcgi_index index.php; include fastcgi_params; } } I haven't written the original ruleset, so I've a hard time converting it. Would you mind giving me a hint how to do it easily or can you help me to convert it, please? I really want to switch over to php5-fpm and nginx :) Thanks

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • "Clear Text Credential Access Enabled" field

    - by Dave
    Searching for answers about the "Clear Text Credential Access Enabled" field, I found a question on an oracle forum that was my exactly what I was trying to find out. Thinking that my answer would soon be found, I happily click on the link only to find zero replies. All hope was lost. I am posting the question here, hoping that someone on this site will know the answer. Can somebody please explain the usage of "Clear Text Credential Access Enabled" checkbox under "-Security-Advanced tab for Weblogic 11g? What is the difference if we set or unset this flag? If I dont set this flag I get an exception like "Access to sensitive attribute in clear text is not allowed due to the setting of ClearTextCredentialAccessEnabled attribute in SecurityConfigurationMBean" when I try to set a value for the "Credential" field. But what should be the value for "Credential" field if I dont set the "Clear Text Credential Access Enabled"flag?

    Read the article

  • Trying to convert string to datetime

    - by user1596472
    I am trying to restrict a user from entering a new record if the date requested already exits. I was trying to do a count to see if the table that the record would be placed in already has that date 1 or not 0. I have a calendar extender attached to a text box which has the date. I keep getting either a: String was not recognized as a valid DateTime. or Unable to cast object of type 'System.Web.UI.WebControls.TextBox' to type 'System.IConvertible'. depending on the different things I have tried. Here is my code. TextBox startd = (TextBox)(DetailsView1.FindControl("TextBox5")); TextBox endd = (TextBox)(DetailsView1.FindControl("TextBox7")); DropDownList lvtype = (DropDownList)(DetailsView1.FindControl("DropDownList6")); DateTime scheduledDate = DateTime.ParseExact(startd.Text, "dd/MM/yyyy", null); DateTime endDate = DateTime.ParseExact(endd.Text, "dd/MM/yyyy", null); DateTime newstartDate = Convert.ToDateTime(startd.Text); DateTime newendDate = Convert.ToDateTime(endd.Text); //foreach (DataRow row in sd.Tables[0].Rows) DateTime dt = newstartDate; while (dt <= newendDate) { //for retreiving from table Decimal sd = SelectCountDate(dt, lvtype.SelectedValue, countDate); String ndt = Convert.ToDateTime(dt).ToShortDateString(); // //start = string.CompareOrdinal(scheduledDate, ndt); // // end = string.CompareOrdinal(endDate, ndt); //trying to make say when leavetpe is greater than count 1 then throw error. if (sd > 0) { Response.Write("<script>alert('Date Already Requested');</script>"); } dt.AddDays(1); } ^^^ This version throws the: "String was not recognized as valid date type" error But if i replace the string with either of these : /*-----------------------Original------------------------------------ string scheduledDate = Convert.ToDateTime(endd).ToShortDateString(); string endDate = Convert.ToDateTime(endd).ToShortDateString(); -------------------------------------------------------------------*/ /*----------10-30--------------------------------------- DateTime scheduledDate = DateTime.Parse(startd.Text); DateTime endDate = DateTime.Parse(endd.Text); ------------------------------------------------------*/ I get the "Unable to cast object of type 'System.Web.UI.WebControls.TextBox' to type 'System.IConvertible'." error. I am just trying to stop a user from entering a record date that already exits. <InsertItemTemplate> <asp:TextBox ID="TextBox5" runat="server" Height="19px" Text='<%# Bind("lstdate", "{0:MM/dd/yyyy}") %>' Width="67px"></asp:TextBox> <asp:CalendarExtender ID="TextBox5_CalendarExtender" runat="server" Enabled="True" TargetControlID="TextBox5"> </asp:CalendarExtender> <asp:RequiredFieldValidator ID="RequiredFieldValidator2" runat="server" ControlToValidate="TextBox5" ErrorMessage="*Leave Date Required" ForeColor="Red"></asp:RequiredFieldValidator> <br /> <asp:CompareValidator ID="CompareValidator18" runat="server" ControlToCompare="TextBox7" ControlToValidate="TextBox5" ErrorMessage="Leave date cannot be after start date" ForeColor="Red" Operator="LessThanEqual" ToolTip="Must choose start date before end date"></asp:CompareValidator> </InsertItemTemplate>

    Read the article

< Previous Page | 117 118 119 120 121 122 123 124 125 126 127 128  | Next Page >