Search Results

Search found 1163 results on 47 pages for 'bobby kumar'.

Page 13/47 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • getaddrinfo is not statically compiled

    - by bobby
    I have included the header netdb.h, where getaddrinfo is included, but gcc issues this warning: warning: Using 'getaddrinfo' in statically linked applications requires at runtime the shared libraries from the glibc version used for linking gcc -m32 -static -s -O2 -std=c99 -D_POSIX_C_SOURCE=200112L myprogram.c How can I statically compile whatever file is missing ?

    Read the article

  • disable Alert view button

    - by shishir.bobby
    HI all, i hv an alert view for twitter posting. Alert view has 2 button and a textfeild send and cancel i want to disable send button,until user fills the message box(i.e textfeild). like,empty field kind of validation. so,how can i disable send button?? regards shishir

    Read the article

  • copy array from one class to another class array

    - by shishir.bobby
    hi all, i hv an array ("array A", which contains 3 objects, fox ex, to,from,message) in class "A". and in class "B",i m having another array ("array B"),which fills tableview,of class "B" only. i need to fill tableview,with the values of class A's array (i.e array A,with the object values, to,from,message). how can i do it?? how to copy array from another class ? i hope i m clear with my question regards shishir

    Read the article

  • Testing system where App-level and Request-level IoC containers exist

    - by Bobby
    My team is in the process of developing a system where we're using Unity as our IoC container; and to provide NHibernate ISessions (Units of work) over each HTTP Request, we're using Unity's ChildContainer feature to create a child container for each request, and sticking the ISession in there. We arrived at this approach after trying others (including defining per-request lifetimes in the container, but there are issues there) and are now trying to decide on a unit testing strategy. Right now, the application-level container itself is living in the HttpApplication, and the Request container lives in the HttpContext.Current. Obviously, neither exist during testing. The pain increases when we decided to use Service Location from our Domain layer, to "lazily" resolve dependencies from the container. So now we have more components wanting to talk to the container. We are also using MSTest, which presents some concurrency dilemmas during testing as well. So we're wondering, what do the bright folks out there in the SO community do to tackle this predicament? How does one setup an application that, during "real" runtime, relies on HTTP objects to hold the containers, but during test has the flexibility to build-up and tear-down the containers consistently, and have the ServiceLocation bits get to those precise containers. I hope the question is clear, thanks!

    Read the article

  • .NET Application broken on one PC, unhandleable exception

    - by Bobby
    Hello people. I have a .NET 2.0 application with nothing fancy in it. It worked until yesterday on every PC I installed or copied it to, no matter if 2.0, 3.0, 3.5 or 3.5 SP1 was installed, no matter if it was Win2000, XP or even Win7 (in total 100+ machines). Yesterday I did my normal installation procedure and wanted to start it one time to check if everything is working...and it wasn't. The program crashed hard leaving me with the uninformative "Do you wanna report this error?" dialog. The problem is an exception in the Main(String[] args) routine of my application. The event viewer is showing the following entry: Event Type: ErrorEvent Source: .NET Runtime 2.0 Error Reporting Event Category: None Event ID: 5000 Date: 05/05/2010 Time: 16:09:09 User: N/A Computer: myClientPC Description: EventType clr20r3, P1 apomenu.exe, P2 1.4.90.53, P3 4bdedea4, P4 system.configuration, P5 2.0.0.0, P6 4889de74, P7 1a6, P8 136, P9 ioibmurhynrxkw0zxkyrvfn0boyyufow, P10 NIL. Well...great information. After a lot of searching I finally was able to get further information about this exception (by adding a handler for UnhandledExceptions directly in My.MyApplication.New(), Application.Designer.vb): System.Configuration.ConfigurationErrorsException Configuration system failed to initialize at System.Configuration.ClientConfigurationSystem.EnsureInit(String configKey) at System.Configuration.ClientConfigurationSystem.PrepareClientConfigSystem(String sectionName) at System.Configuration.ClientConfigurationSystem.System.Configuration.Internal.IInternalConfigSystem.GetSection(String sectionName) at System.Configuration.ConfigurationManager.GetSection(String sectionName) at System.Configuration.PrivilegedConfigurationManager.GetSection(String sectionName) at System.Net.Configuration.SettingsSectionInternal.get_Section() at System.Net.Sockets.Socket.InitializeSockets() at System.Net.Sockets.Socket.get_SupportsIPv4() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.get_HostName() at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.RegisterChannel(Boolean SecureChannel) at Microsoft.VisualBasic.ApplicationServices.WindowsFormsApplicationBase.Run(String[] commandLine) at MyAppNameHere.My.MyApplication.Main(String[] Args) in 17d14f5c-a337-4978-8281-53493378c1071.vb:Line 81. And at this point I'm stuck...I'm out of ideas. I'm not using any kind of configuration system from the framework (no reference to System.Configuration, and there never was a MyAppnameHere.exe.config generated or distributed, nor have I seen this error before). I also found a bug report at Microsoft (Google Cache) about this bug (in another context, though). But as it seems, they won't even look at it. Every help is greatly appreciated! Edit: I'm using Visual Studio 2008 Prof.. Crash happens in Release- and Debug-Build on the client machine. Debugging the application directly on this machine is out of question I fear, 300+ Miles and they only have two computers to work with.

    Read the article

  • Finding column index using jQuery when table contains column-spanning cells

    - by Brant Bobby
    Using jQuery, how can I find the column index of an arbitrary table cell in the example table below, such that cells spanning multiple columns have multiple indexes? HTML <table> <tbody> <tr> <td>One</td> <td>Two</td> <td id="example1">Three</td> <td>Four</td> <td>Five</td> <td>Six</td> </tr> <tr> <td colspan="2">One</td> <td colspan="2">Two</td> <td colspan="2" id="example2">Three</td> </tr> <tr> <td>One</td> <td>Two</td> <td>Three</td> <td>Four</td> <td>Five</td> <td>Six</td> </tr> </tbody> </table> jQuery var cell = $("#example1"); var example1ColIndex = cell.parent("tr").children().index(cell); // == 2. This is fine. cell = $("#example2"); var example2ColumnIndex = cell.parent("tr").children().index(cell); // == 2. It should be 4 (or 5, but I only need the lowest). How can I do this?

    Read the article

  • xml parsing + tablew view tutorial needed

    - by shishir.bobby
    Hi all, i am working on live XML arsing, i am able to parse xml and pass into array,but i am not able to set those values into table view, so if any 1 can provide me some guideline or some tutorials to set array data into table view,with xml parsing,it will be a great heklp for me. regard shishir

    Read the article

  • <nunit2> is not working correctly.

    - by Bobby
    I have the following task in my nant script: <nunit2 verbose="true"> <formatter type="Plain" /> <test assemblyname="${output}\Test.dll" appconfig="${project.src.root}\Test\Test.config"/> </nunit2> Test.config is the following: <?xml version="1.0" encoding="utf-8" ?> <configuration> <runtime> <assemblyBinding xmlns="urn:schemas-microsoft-com:asm.v1"> <dependentAssembly> <assemblyIdentity name="nunit.framework" publicKeyToken="96d09a1eb7f44a77" culture="Neutral" /> <bindingRedirect oldVersion="2.5.3.9345" newVersion="2.2.8.0" /> </dependentAssembly> </assemblyBinding> </runtime> </configuration> I get an error when i run this task saying could not load nunit.framework. I know nunit is not in the GAC (not strongly signed). Does Nunit have to be in the GAC for this task to work?

    Read the article

  • Converting float values from big endian to little endian

    - by Bobby
    Is it possible to convert floats from big to little endian? I have a value from a PowerPC(big endian)platform that I am send via TCP to a Windows process (little endian). This value is a float, but when I "memcpy" the value into a win32 float type and then call _byteswap_ulongon that value, I always get 0.0000? What am I doing wrong?

    Read the article

  • When should I implement IDisposable?

    - by Bobby
    What is the best practice for when to implement IDisposable? Is the best rule of thumb to implement it if you have one managed object in the class, or does it depend if the object was created in the class or just passed in? Should I also do it for classes with no managed objects at all?

    Read the article

  • Creating a new nested resource

    - by Bobby B
    I'm working on a basic garden logging application which consists of gardens, plants and planted plants. Each user has one or many gardens, plants are master definitions, and a planted plant can be thought of as an instance of a plant in a specific user's garden. In my routes.rb file I have the following: map.resources :gardens do |gardens| gardens.resources :planted_plants, :has_many => :plant_log_entries, :collection => { :filter => :post, :choose_garden => :post} gardens.resources :garden_log_entries end map.resources :plants This makes sense to me when retrieving a list of planted_plants in a user's garden, but I'd like to create a planted_plant record from the index of plant. The problem is, a user can have multiple gardens. How can I create a new form for a planted_plant that allows the user to specify which garden should be used? The current route requires a garden_id - which makes sense for retrieval, but I'd like to supply that as a parameter for creation. Thanks in advance for any help!

    Read the article

  • IE problem: keyboard interaction with checkbox

    - by Bobby Eickhoff
    I have an HTML table, and each row has a checkbox for selecting or deselecting its row. Whenever a checkbox changes value, I need to add or remove highlighting to the row and also ensure that the page's submit button is only enabled when at least one row is selected and disabled otherwise. The checkbox event handler is defined by the following function: function getCheckboxCallback() { return function () { var parentRow = getParentRow(this); if (!parentRow) { return; // No parent row found; abort } // Adjust the appearance of the row setSelected(parentRow, this.checked); // Count the number of selected table rows, and disable the submit // button whenever no rows are selected enforceInvariants(); return true; }; } Elsewhere in the same module, the checkboxes are given the event handlers: checkbox.onchange = getCheckboxCallback(); checkbox.onclick = getCheckboxCallback(); // alleged IE fix I'm working in Windows XP, and everything works fine in both Firefox 3 and Opera 9. However, IE 7 does not handle keyboard interaction well (mouse interaction works fine). The problem is that if a checkbox has the focus and I hit the spacebar, the checkbox doesn't get checked -- instead it gets half checked (it has the same shadowed appearance that it would get immediately after a mousedown). I have to press the spacebar a second time to actually check the box. Similarly, it requires two key presses to uncheck it. Oddly enough, if I hold down the spacebar for a few moments, then a single press works as expected. Can anyone explain what is going on here? Is there something I'm doing wrong in the JavaScript code that is causing this behavior? How can I fix this?

    Read the article

  • help with javamail api

    - by bobby
    import javax.servlet.*; import javax.servlet.http.*; import java.io.*; import javax.mail.*; import javax.mail.internet.*; import javax.mail.event.*; import java.net.*; import java.util.*; public class servletmail extends HttpServlet { public void doPost(HttpServletRequest request,HttpServletResponse response)throws ServletException,IOException { PrintWriter out=response.getWriter(); response.setContentType("text/html"); try { Properties props=new Properties(); props.put("mail.transport.protocol", "smtp"); props.put("mail.smtp.host","smtp.gmail.com"); props.put("mail.smtp.port", "25"); props.put("mail.smtp.auth", "true"); Authenticator authenticator = new Authenticator() { protected PasswordAuthentication getPasswordAuthentication() { return new PasswordAuthentication("user", "pass"); } }; Session sess=Session.getDefaultInstance(props,authenticator); Message msg=new MimeMessage(sess); msg.setFrom(new InternetAddress("[email protected]")); msg.addRecipient(Message.RecipientType.TO, new InternetAddress("[email protected]")); msg.setSubject("Hello JavaMail"); msg.setText("Welcome to JavaMail"); Transport.send(msg); out.println("mail has been sent"); } catch(Exception e) { System.out.println("err"+e); } } } im working with above im gettin d following error servletmail.java:22: reference to Authenticator is ambiguous, both class java.ne t.Authenticator in java.net and class javax.mail.Authenticator in javax.mail mat ch Authenticator authenticator = new Authenticator() ^ servletmail.java:22: reference to Authenticator is ambiguous, both class java.ne t.Authenticator in java.net and class javax.mail.Authenticator in javax.mail mat ch Authenticator authenticator = new Authenticator() ^ 2 errors i have followed the example in http://java.sun.com/developer/onlineTraining/JavaMail/contents.html how should i get the output..will the above code...work what are the changes that need to be made..im using thunderbird smtp server

    Read the article

  • Combining the UNIQUE and CHECK constraints

    - by Bobby
    I have a table with columns a b and c, and if c is false then I only want to allow insertions if columns a and b are unique, but if c is true then a and b do not need to be unique. Example: There can only be one (foo, bar, false) in the table, but no limit on how many (foo, bar, true) there can be. I tried something like CONSTRAINT blah UNIQUE (a,b) AND CHECK (C is TRUE) but I can't figure out the correct syntax.

    Read the article

  • Python ValueError: not allowed to raise maximum limit

    - by Ricky Bobby
    I'm using python 2.7.2 on mac os 10.7.3 I'm doing a recursive algorithm in python with more than 50 000 recursion levels. I tried to increase the maximum recursion level to 1 000 000 but my python shell still exit after 18 000 recursion levels. I tried to increase the resources available : import resource resource.setrlimit(resource.RLIMIT_STACK, (2**29,-1)) sys.setrecursionlimit(10**6) and I get this error : Traceback (most recent call last): File "<pyshell#58>", line 1, in <module> resource.setrlimit(resource.RLIMIT_STACK,(2**29,-1)) ValueError: not allowed to raise maximum limit I don't know why I cannot raise the maximum limit ? thanks for your suggestions .

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Convert .cshrc to .bashrc

    - by Bobby
    I am new to Linux and I am trying to compile some code that needs environment variables set first. The script is in cshrc, but whenever I try to run that code I get "if: badly formed number" errors. I want to run it in bash instead. Is there an easy way to convert cshrc to bashrc?

    Read the article

  • Generate and merge data with python multiprocessing

    - by Bobby
    I have a list of starting data. I want to apply a function to the starting data that creates a few pieces of new data for each element in the starting data. Some pieces of the new data are the same and I want to remove them. The sequential version is essentially: def create_new_data_for(datum): """make a list of new data from some old datum""" return [datum.modified_copy(k) for k in datum.k_list] data = [some list of data] #some data to start with #generate a list of new data from the old data, we'll reduce it next newdata = [] for d in data: newdata.extend(create_new_data_for(d)) #now reduce the data under ".matches(other)" reduced = [] for d in newdata: for seen in reduced: if d.matches(seen): break #so we haven't seen anything like d yet seen.append(d) #now reduced is finished and is what we want! I want to speed this up with multiprocessing. I was thinking that I could use a multiprocessing.Queue for the generation. Each process would just put the stuff it creates on, and when the processes are reducing the data, they can just get the data from the Queue. But I'm not sure how to have the different process loop over reduced and modify it without any race conditions or other issues. What is the best way to do this safely? or is there a different way to accomplish this goal better?

    Read the article

  • Debugging EXC_BAD_ACCESS that occurs only on release target for an iPhone app?

    - by Bobby Moretti
    I'm developing an iPhone application. I have an EXC_BAD_ACCESS that occurs only in the release target; when I build the debug target the exception does not occur. However, when I set the NSZombieEnabled environment variable to YES, I still get the EXC_BAD_ACCESS with no further information. Is it even possible for NSZombieEnabled to work when executing the release target? I don't see why not, since gdb is running in both cases... Update: here is a printout of the top of the stack: #0 0x33369ebc in objc_msgSend () #1 0x3144f968 in -[EAInputStream _streamEventTrigger] () #2 0x3144fe78 in __streamEventTrigger () #3 0x338ae3a6 in CFRunLoopRunSpecific () #4 0x338adc1e in CFRunLoopRunInMode () #5 0x32ed6966 in -[NSRunLoop(NSRunLoop) runMode:beforeDate:] () #6 0x00005b06 in -[IOStreamDelegate removeMsg:] (self=0x142cc0, _cmd=<value temporarily unavailable, due to optimizations>, message=0x2fffe544) at /Users/robertmoretti/Documents/XXXXXXX/IOStreamDelegate.m:191 Here is a gdb session from inside the objc_msgSend call at the top: (gdb) p/x $r0 $6 = 0x3100000 (gdb) x/s $r1 0x32d7cff8: "release" (gdb) disassemble $pc Dump of assembler code for function objc_msgSend: 0x33369ea8 <objc_msgSend+0>: teq r0, #0 ; 0x0 0x33369eac <objc_msgSend+4>: moveq r1, #0 ; 0x0 0x33369eb0 <objc_msgSend+8>: bxeq lr 0x33369eb4 <objc_msgSend+12>: push {r3, r4, r5, r6} 0x33369eb8 <objc_msgSend+16>: ldr r4, [r0] 0x33369ebc <objc_msgSend+20>: ldr r5, [r4, #8] 0x33369ec0 <objc_msgSend+24>: ldr r6, [r5] 0x33369ec4 <objc_msgSend+28>: add r3, r5, #8 ; 0x8 0x33369ec8 <objc_msgSend+32>: and r5, r6, r1, lsr #2 0x33369ecc <objc_msgSend+36>: ldr r4, [r3, r5, lsl #2] 0x33369ed0 <objc_msgSend+40>: teq r4, #0 ; 0x0 0x33369ed4 <objc_msgSend+44>: add r5, r5, #1 ; 0x1 0x33369ed8 <objc_msgSend+48>: beq 0x33369efc <objc_msgSend+84> 0x33369edc <objc_msgSend+52>: ldr r12, [r4] 0x33369ee0 <objc_msgSend+56>: teq r1, r12 0x33369ee4 <objc_msgSend+60>: and r5, r5, r6 0x33369ee8 <objc_msgSend+64>: bne 0x33369ecc <objc_msgSend+36> 0x33369eec <objc_msgSend+68>: ldr r12, [r4, #8] 0x33369ef0 <objc_msgSend+72>: teq r4, r4 0x33369ef4 <objc_msgSend+76>: pop {r3, r4, r5, r6} 0x33369ef8 <objc_msgSend+80>: bx r12 0x33369efc <objc_msgSend+84>: pop {r3, r4, r5, r6} 0x33369f00 <objc_msgSend+88>: b 0x33369f04 <objc_msgSend_uncached> End of assembler dump. (gdb) p/x *$r0 $9 = 0x0 The exception occurs on the line 0x33369ebc <objc_msgSend+20>: ldr r5, [r4, #8]. r4 has just been given the value pointed to by r0, which happens to be 0. I am wondering what is supposed to be in the memory region of 0x3100000. Here's a memory dump of that area: (gdb) x/256w 0x3100000 0x3100000: 0x00000000 0x0000a293 0xaa650505 0x00000000 0x3100010: 0x0000a294 0xaa670505 0x00000000 0x0000a295 0x3100020: 0xaa690505 0x00000000 0x0000a296 0xaa6b0505 0x3100030: 0x00000000 0x0000a297 0xaa6d0505 0x00000000 0x3100040: 0x0000a298 0xaa6f0505 0x00000000 0x0000a299 0x3100050: 0xaa710505 0x00000000 0x0000a29a 0xaa730505 0x3100060: 0x00000000 0x0000a29b 0xaa750505 0x00000000 0x3100070: 0x0000a29c 0xaa770505 0x00000000 0x0000a29d 0x3100080: 0xaa790505 0x00000000 0x0000a29e 0xaa7b0505 0x3100090: 0x00000000 0x0000a29f 0xaa7d0505 0x00000000 0x31000a0: 0x0000a2a0 0xaa7f0505 0x00000000 0x0000a2a1 0x31000b0: 0xaa810505 0x00000000 0x0000a2a2 0xaa830505 0x31000c0: 0x00000000 0x0000a2a3 0xaa850505 0x00000000 0x31000d0: 0x0000a2a4 0xaa870505 0x00000000 0x0000a2a5 0x31000e0: 0xaa890505 0x00000000 0x0000a2a6 0xaa8b0505 0x31000f0: 0x00000000 0x0000a2a7 0xaa8d0505 0x00000000 0x3100100: 0x0000a2a8 0xaa8f0505 0x00000000 0x0000a2a9 0x3100110: 0xaa910505 0x00000000 0x0000a2aa 0xaa930505 0x3100120: 0x00000000 0x0000a2ab 0xaa950505 0x00000000 0x3100130: 0x0000a2ac 0xaa970505 0x00000000 0x0000a2ad 0x3100140: 0xaa990505 0x00000000 0x0000a2ae 0xaa9b0505 0x3100150: 0x00000000 0x0000a2af 0xaa9d0505 0x00000000 0x3100160: 0x0000a2b0 0xaa9f0505 0x00000000 0x0000a2b1 0x3100170: 0xaaa10505 0x00000000 0x0000a2b2 0xaaa30505 0x3100180: 0x00000000 0x0000a2b3 0xaaa50505 0x00000000 0x3100190: 0x0000a2b4 0xaaa70505 0x00000000 0x0000a2b5 0x31001a0: 0xaaa90505 0x00000000 0x0000a2b6 0xaaab0505 0x31001b0: 0x00000000 0x0000a2b7 0xaaad0505 0x00000000 0x31001c0: 0x0000a2b8 0xaaaf0505 0x00000000 0x0000a2b9 0x31001d0: 0xaab10505 0x00000000 0x0000a2ba 0xaab30505 0x31001e0: 0x00000000 0x0000a2bb 0xaab50505 0x00000000 0x31001f0: 0x0000a2bc 0xaab70505 0x00000000 0x0000a2bd 0x3100200: 0xaab90505 0x00000000 0x0000a2be 0xaabb0505 0x3100210: 0x00000000 0x0000a2bf 0xaabd0505 0x00000000 0x3100220: 0x0000a2c0 0xaabf0505 0x00000000 0x0000a2c1 0x3100230: 0xaac10505 0x00000000 0x0000a2c2 0xaac30505 0x3100240: 0x00000000 0x0000a2c3 0xaac50505 0x00000000 0x3100250: 0x0000a2c4 0xaac70505 0x00000000 0x0000a2c5 0x3100260: 0xaac90505 0x00000000 0x0000a2c6 0xaacb0505 0x3100270: 0x00000000 0x0000a2c7 0xaacd0505 0x00000000 0x3100280: 0x0000a2c8 0xaacf0505 0x00000000 0x0000a2c9 0x3100290: 0xaad10505 0x00000000 0x0000a2ca 0xaad30505 0x31002a0: 0x00000000 0x0000a2cb 0xaad50505 0x00000000 0x31002b0: 0x0000a2cc 0xaad70505 0x00000000 0x0000a2cd 0x31002c0: 0xaad90505 0x00000000 0x0000a2ce 0xaadb0505 0x31002d0: 0x00000000 0x0000a2cf 0xaadd0505 0x00000000 0x31002e0: 0x0000a2d0 0xaadf0505 0x00000000 0x0000a2d1 0x31002f0: 0xaae10505 0x00000000 0x0000a2d2 0xaae30505 0x3100300: 0x00000000 0x0000a2d3 0xaae50505 0x00000000 0x3100310: 0x0000a2d4 0xaae70505 0x00000000 0x0000a2d5 0x3100320: 0xaae90505 0x00000000 0x0000a2d6 0xaaeb0505 0x3100330: 0x00000000 0x0000a2d7 0xaaed0505 0x00000000 0x3100340: 0x0000a2d8 0xaaef0505 0x00000000 0x0000a2d9 0x3100350: 0xaaf10505 0x00000000 0x0000a2da 0xaaf30505 0x3100360: 0x00000000 0x0000a2db 0xaaf50505 0x00000000 0x3100370: 0x0000a2dc 0xaaf70505 0x00000000 0x0000a2dd 0x3100380: 0xaaf90505 0x00000000 0x0000a2de 0xaafb0505 0x3100390: 0x00000000 0x0000a2df 0xaafd0505 0x00000000 0x31003a0: 0x0000a2e0 0xab050505 0x00000000 0x0000a2e1 0x31003b0: 0xab070505 0x00000000 0x0000a2e2 0xab090505 0x31003c0: 0x00000000 0x0000a2e3 0xab0b0505 0x00000000 0x31003d0: 0x0000a2e4 0xab0d0505 0x00000000 0x0000a2e5 0x31003e0: 0xab0f0505 0x00000000 0x0000a2e6 0xab110505 0x31003f0: 0x00000000 0x0000a2e7 0xab130505 0x00000000 I don't really know what else to try; hopefully someone with more iphone experience will be able to recognize this memory as something meaningful.

    Read the article

  • Float: left not showing up after a certain point.

    - by Bobby K
    http://test.jptgraphics.com/products?cat=APPAREL This works fine in Safari but shows incorrectly in the latest version of Firefox ( was fine in 3.5) and in some versions of IE. In the middle column the product thumbnails drop down below when the 'float: left;' parameter is used. It is as if it is being escaped by a tag from that point forward no 'float: left's work and all the items are centered moving forward.

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >