Search Results

Search found 21488 results on 860 pages for 'image conversion'.

Page 132/860 | < Previous Page | 128 129 130 131 132 133 134 135 136 137 138 139  | Next Page >

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • Building a workstation computer for Image processing? [closed]

    - by echolab
    I am taking a gigapixel image my goal is 50gigapixel and shooting is almost done , i am doing some research to build a workstation so i can stitch images together , my questions is ! Could u suggest some dual cpu mainboard that works fine with xeon 5500+ , with 64GB+ ram support ? My other question is which hardware is most important in image processing , all i see in story of gigapixel panoramas is they have dual xeon and 32gb+ ram ? i wonder if i am doing this right , i mean they don't post information on graphic card , mainboard and stuff ! I did asked several websites , but nothing best answer was get some high-end workstation and plenty of hours , i don't want to purchase ready to use workstations, i wanna build it up Thanks in advance

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Serving a default image with nginx

    - by ustun
    I have the following configuration in nginx: location /static/ { root /srv/kose/; expires 2w; access_log off; } location / { proxy_pass http://127.0.0.1:8089; } If a file is not found in /static/, I want to serve a default image, and not proxy_pass to 8089. Currently, it looks for the file in the root for static, if it cannot find it, it tries the proxy. I have tried the following, but it doesn't work. How can I tell nginx to serve the default image? I have also tried try_files to no avail. location /static/ { root /srv/kose/; expires 2w; access_log off; error_page 404 /srv/static/defaultimage.jpg; } location / { proxy_pass http://127.0.0.1:8089; }

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • use correct-resolution background desktop image

    - by Rob Bos
    I have a desktop background image (a picture) in a half-dozen different resolutions, that I'd like to deploy to a disparate collection of computers with different monitors and video cards and whatnot. Laptops, netbooks, desktops, widescreen, and even a couple of "tall" screens. I have images to cover most of the cases. I would like Windows 7 to correctly pick the correct desktop background image via group policy. Now, the logon screen is already done. The OEMBackground method is rather clever, and lets you copy files of different resolutions to the machine, and the logon app will calculate the aspect ratio of the monitor and match it to a file as closely as possible. Is there any way to have that functionality on the desktop background as well?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • I want to "image" 40+ laptops quickly...i welcome suggestions on reliable software

    - by Joldfield101
    I often have batches of laptops/PC's to re-image and have tried various methods, but each of them has been problematic and often take more time to troubleshoot than it would have been to image them individually! For example, i have tried to use ghost - i installed ghostcast server on my laptop but the clients never seem to boot to LAN successfully, or it takes an hour to get everything sorted (drivers, LAN, DHCP etc etc). I want a reliable tool that makes imaging quick and easy - and i don't mind paying for it if it's going to work (but obviously free = always good!)

    Read the article

  • NSMutableURLRequest returns null on real device, while returning image on simulator

    - by Yanchi
    I was testing my app that I've been working on for past 2 months. Basically it requests for JSON, that contains info about items. One field of JSON file is image_url. When I want to display this image, I need to download it from another server, that needs additional credentials. So it goes like this- In my cellForRowAtIndexPath I'm doing NSDictionary *aucdict = [jsonAukResults objectAtIndex:indexPath.row]; NSURL *imageURL = [NSURL URLWithString:[aucdict objectForKey:@"img_url"]]; NSString *authPString = [[[NSString stringWithFormat:@"login:password"]dataUsingEncoding:NSUTF8StringEncoding] base64EncodedString]; NSString *verifPString = [NSString stringWithFormat:@"Image %@",authPString]; NSMutableURLRequest *Prequest = [[NSMutableURLRequest alloc] initWithURL:imageURL]; [Prequest setValue:verifPString forHTTPHeaderField:@"Authorization"]; NSError *error = nil; NSURLResponse *resp = nil; NSData *picresult = [NSURLConnection sendSynchronousRequest:Prequest returningResponse:&resp error:&error]; UIImage *imageLoad = [[UIImage alloc] initWithData:picresult]; Now, I just obscured credentials (they are not login:password :)). My problem is, that right now, I get 3 items. All 3 have image on same server. I can get two of them with this code no problem. However third one is problematic, I always get (NULL) imageLoad. On my simulator, everything works fine, I get all 3 pictures. On real device I get error. I tried to NSURLConnection with error and response so I could debug better. This is what I got in my error. Printing description of error: Error Domain=NSURLErrorDomain Code=-1202 "The certificate for this server is invalid. You might be connecting to a server that is pretending to be “server name” which could put your confidential information at risk." UserInfo=0x1e5a3080 {NSErrorFailingURLStringKey=pictureLink.jpg, NSLocalizedRecoverySuggestion=Would you like to connect to the server anyway?, NSErrorFailingURLKey=pictureLink.jpg, NSLocalizedDescription=The certificate for this server is invalid. You might be connecting to a server that is pretending to be “server name” which could put your confidential information at risk., NSUnderlyingError=0x1e5a30e0 "The certificate for this server is invalid. You might be connecting to a server that is pretending to be “server name” which could put your confidential information at risk.", NSURLErrorFailingURLPeerTrustErrorKey=} I dont use SSL so Im really confused as what could cause this error. Btw, everything worked fine until now (this is my initial screen, so it's been done for good month and a half). Now I started to do graphics and this problem popped up :(

    Read the article

  • How to train users converting from PC to Mac/Apple at a small non profit?

    - by Everette Mills
    Background: I am part of a team that provides volunteer tech support to a local non profit. We are in the position to obtain a grant to update almost all of our computers (many of them 5 to 7 year old machines running XP), provide laptops for users that need them, etc. We are considering switching our users from PC (WinXP) to Macs. The technical aspects of switching will not be an issue for the team. We are in the process of planning data conversions, machine setup, server changes, etc regardless of whether we switch to Macs or much newer PCs. About 1/4 of the staff uses or has access to a Mac at home, these users already understand the basics of using the equipment. We have another set of (generally younger) users that are technically savvy and while slightly inconvenienced and slowed for a few days should be able to switch over quickly. Finally, several members of the staff are older and have many issues using there computers today. We think in the long run switching to Macs may provide a better user experience, fewer IT headaches, and more effective use of computers. The questions we have is what resources and training (webpages, Books, online training materials or online courses) do you recommend that we provide to users to enable the switchover to happen smoothly. Especially, with a focus on providing different levels of training and support to users with different skill levels. If you have done this in your own organization, what steps were successful, what areas were less successful?

    Read the article

  • Connecting Samsung Note 3 to Hitachi CPX3030WN via Samsung MHL 2.0 HD kit , Will there be video output? [on hold]

    - by Monolord's Knight
    I need the video output to projector. but nobody can assure me this may work or not. some says yes some says no.But they have no real experience. Some says an special android app is required for this. Depending on this answer, I will purchase Samsung MHL 2.0 cable . If it wont work it will be no use for me. I don't have a way to change my phone or projector. Just want to know will it work or not. Thanks

    Read the article

  • how can i edit my admission form which i filled wrong . their is no other form is avilable now ...what i do ??? [closed]

    - by user60065
    Hi, I am a 2nd year student in graduation. Recently I filled an admission form for final year admission but it came back to me after 2 days because I had entered wrong information. I want to edit the wrong information and I have scanned the form. I am looking for a good online site where I can upload the scanned document and convert same into an editable format. I don’t mind paying. If any can point to a good site will be great & thanks in advance

    Read the article

  • django-avatar: cant save thumbnail

    - by Znack
    I'm use django-avatar app and can't make it to save thumbnails. The original image save normally in my media dir. Using the step execution showed that error occurred here image.save(thumb, settings.AVATAR_THUMB_FORMAT, quality=quality) I found this line in create_thumbnail: def create_thumbnail(self, size, quality=None): # invalidate the cache of the thumbnail with the given size first invalidate_cache(self.user, size) try: orig = self.avatar.storage.open(self.avatar.name, 'rb') image = Image.open(orig) quality = quality or settings.AVATAR_THUMB_QUALITY w, h = image.size if w != size or h != size: if w > h: diff = int((w - h) / 2) image = image.crop((diff, 0, w - diff, h)) else: diff = int((h - w) / 2) image = image.crop((0, diff, w, h - diff)) if image.mode != "RGB": image = image.convert("RGB") image = image.resize((size, size), settings.AVATAR_RESIZE_METHOD) thumb = six.BytesIO() image.save(thumb, settings.AVATAR_THUMB_FORMAT, quality=quality) thumb_file = ContentFile(thumb.getvalue()) else: thumb_file = File(orig) thumb = self.avatar.storage.save(self.avatar_name(size), thumb_file) except IOError: return # What should we do here? Render a "sorry, didn't work" img? maybe all I need is just some library? Thanks

    Read the article

  • Uget tray icon not showing

    - by ArK
    Since I upgraded to Saucy, Uget is not showing in the system tray, although the Always show tray icon option in Uget settings is checked. P.S. this happens only with Uget, all the other Softwares have working tray icons (vlc,qbittorrent..) Here is the snapshot which shows the settings of Uget: sudo dpkg -l | grep -e "^rc" -e "^iU": rc account-plugin-generic-oauth 0.10bzr13.03.26-0ubuntu1.1 i386 GNOME Control Center account plugin for single signon - generic OAuth rc appmenu-gtk:i386 12.10.3daily13.04.03-0ubuntu1 i386 Export GTK menus over DBus rc appmenu-gtk3:i386 12.10.3daily13.04.03-0ubuntu1 i386 Export GTK menus over DBus rc arora 0.11.0-0ubuntu1 i386 simple cross platform web browser rc buc 0.5.2-20 i386 BUC rc clementine 1.1.1+dfsg-2ubuntu1 i386 modern music player and library organizer rc epiphany-browser 3.6.1-2ubuntu1 i386 Intuitive GNOME web browser rc epiphany-browser-data 3.6.1-2ubuntu3 all Data files for the GNOME web browser rc fancontrol 1:3.3.3-1ubuntu1 all utilities to read temperature/voltage/fan sensors rc flaremonitor 1.0-5 i386 It is an advanced browser integration helper module of FlareGet rc google-chrome-stable 28.0.1500.95-r213514 i386 The web browser from Google rc hal 0.5.14-8ubuntu1 i386 Hardware Abstraction Layer rc hotot-gtk 1:0.9.8.5+git20120630.884797d-1 all lightweight microblogging client - GTK+ wrapper rc jockey-common 0.9.7-0ubuntu13 all user interface and desktop integration for driver management rc libanalitza4abi1 4:4.10.4-0ubuntu0.1 i386 library to work with mathematical expressions rc libanalitza5 4:4.11.2-0ubuntu1 i386 library to work with mathematical expressions rc libanalitzagui4abi2 4:4.10.4-0ubuntu0.1 i386 library to work with mathematical expressions - GUI routines rc libanalitzaplot4 4:4.10.4-0ubuntu0.1 i386 library to work with mathematical expressions - plot routines rc libavcodec53:i386 6:0.8.6-1ubuntu2 i386 Libav codec library rc libavutil51:i386 6:0.8.6-1ubuntu2 i386 Libav utility library rc libbamf3-1:i386 0.4.0daily13.06.19~13.04-0ubuntu1 i386 Window matching library - shared library rc libboost-iostreams1.49.0 1.49.0-4 i386 Boost.Iostreams Library rc libboost-program-options1.49.0 1.49.0-4 i386 program options library for C++ rc libboost-python1.49.0 1.49.0-4 i386 Boost.Python Library rc libboost-thread1.49.0 1.49.0-4 i386 portable C++ multi-threading rc libbrlapi0.5:i386 4.4-8ubuntu4 i386 braille display access via BRLTTY - shared library rc libcamel-1.2-40 3.6.4-0ubuntu1.1 i386 Evolution MIME message handling library rc libcolumbus0-0 0.4.0daily13.04.16~13.04-0ubuntu1 i386 error tolerant matching engine - shared library rc libdns95 1:9.9.2.dfsg.P1-2ubuntu2.1 i386 DNS Shared Library used by BIND rc libdvbpsi7 0.2.2-1 i386 library for MPEG TS and DVB PSI tables decoding and generating rc libebackend-1.2-5 3.6.4-0ubuntu1.1 i386 Utility library for evolution data servers rc libechonest2.0:i386 2.0.2-0ubuntu1 i386 Qt library for communicating with The Echo Nest platform rc libechonest2.1:i386 2.1.0-2 i386 Qt library for communicating with The Echo Nest platform rc libedata-book-1.2-15 3.6.4-0ubuntu1.1 i386 Backend library for evolution address books rc libedata-cal-1.2-18 3.6.4-0ubuntu1.1 i386 Backend library for evolution calendars rc libftgl2 2.1.3~rc5-4ubuntu1 i386 library to render text in OpenGL using FreeType rc libgc1c3:i386 1:7.2d-0ubuntu5 i386 conservative garbage collector for C and C++ rc libgnome-desktop-3-4 3.6.3-0ubuntu1 i386 Utility library for loading .desktop files - runtime files rc libgtksourceview-3.0-0:i386 3.6.3-0ubuntu1 i386 shared libraries for the GTK+ syntax highlighting widget rc libgweather-3-1 3.6.2-0ubuntu1 i386 GWeather shared library rc libhal-storage1 0.5.14-8ubuntu1 i386 Hardware Abstraction Layer - shared library for storage devices rc libhal1 0.5.14-8ubuntu1 i386 Hardware Abstraction Layer - shared library rc libharfbuzz0:i386 0.9.13-1 i386 OpenType text shaping engine rc libhd16 16.0-2.2 i386 Hardware identification system library rc libibus-1.0-0:i386 1.4.2-0ubuntu2 i386 Intelligent Input Bus - shared library rc libical0 0.48-2 i386 iCalendar library implementation in C (runtime) rc libimobiledevice3 1.1.4-1ubuntu6.2 i386 Library for communicating with the iPhone and iPod Touch rc libisc92 1:9.9.2.dfsg.P1-2ubuntu2.1 i386 ISC Shared Library used by BIND rc libkdegamesprivate1 4:4.10.2-0ubuntu1 i386 private shared library for KDE games rc libkeybinder0 0.3.0-1ubuntu1 i386 registers global key bindings for applications rc libkgapi0:i386 0.4.4-0ubuntu1 i386 Google API library for KDE rc liblastfm1:i386 1.0.7-2 i386 Last.fm web services library rc libnetfilter-queue1 1.0.2-1 i386 Netfilter netlink-queue library rc libnl1:i386 1.1-7ubuntu1 i386 library for dealing with netlink sockets rc libossp-uuid16 1.6.2-1.3 i386 OSSP uuid ISO-C and C++ - shared library rc libpackagekit-glib2-14:i386 0.7.6-3ubuntu1 i386 Library for accessing PackageKit using GLib rc libpoppler28:i386 0.20.5-1ubuntu3 i386 PDF rendering library rc libprojectm2 2.1.0+dfsg-1build1 i386 Advanced Milkdrop-compatible music visualization library rc libqxt-core0:i386 0.6.1-7 i386 extensions to Qt core classes (LibQxt) rc libqxt-gui0:i386 0.6.1-7 i386 extensions to Qt GUI classes (LibQxt) rc libraw5:i386 0.14.7-0ubuntu1.13.04.2 i386 raw image decoder library rc librhythmbox-core6 2.98-0ubuntu5 i386 support library for the rhythmbox music player rc librhythmbox-core7 3.0.1-0~13.10~ppa1 i386 support library for the rhythmbox music player rc libsnmp15 5.4.3~dfsg-2.7ubuntu1 i386 SNMP (Simple Network Management Protocol) library rc libsqlite0 2.8.17-8fakesync1 i386 SQLite shared library rc libsyncdaemon-1.0-1 4.2.0-0ubuntu1 i386 Ubuntu One synchronization daemon library rc libtiff4:i386 3.9.7-2ubuntu1 i386 Tag Image File Format (TIFF) library (old version) rc libunity-core-6.0-5 7.0.0daily13.06.19~13.04-0ubuntu1 i386 Core library for the Unity interface. rc libva-wayland1:i386 1.2.1-0ubuntu0~raring i386 Video Acceleration (VA) API for Linux -- Wayland runtime rc libwayland0:i386 1.0.5-0ubuntu1 i386 wayland compositor infrastructure - shared libraries rc libwebp2:i386 0.1.3-3 i386 Lossy compression of digital photographic images. rc linux-image-3.8.0-19-generic 3.8.0-19.30 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-3.8.0-21-generic 3.8.0-21.32 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-3.8.0-22-generic 3.8.0-22.33 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-3.8.0-26-generic 3.8.0-26.38 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-3.8.0-27-generic 3.8.0-27.40 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-3.9.0-030900-generic 3.9.0-030900.201304291257 i386 Linux kernel image for version 3.9.0 on 32 bit x86 SMP rc linux-image-3.9.0-030900rc8-generic 3.9.0-030900rc8.201304211835 i386 Linux kernel image for version 3.9.0 on 32 bit x86 SMP rc linux-image-extra-3.8.0-19-generic 3.8.0-19.30 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-extra-3.8.0-21-generic 3.8.0-21.32 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-extra-3.8.0-22-generic 3.8.0-22.33 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-extra-3.8.0-26-generic 3.8.0-26.38 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc linux-image-extra-3.8.0-27-generic 3.8.0-27.40 i386 Linux kernel image for version 3.8.0 on 32 bit x86 SMP rc preload 0.6.4-2 i386 adaptive readahead daemon rc steam-launcher 1.0.0.39 all Launcher for the Steam software distribution service rc super-boot-manager 0.7.15 all Simple gui to configure Grub2, Burg and Plymouth. rc totem 3.6.3-0ubuntu6 i386 Simple media player for the GNOME desktop based on GStreamer rc transmission-gtk 2.77-0ubuntu1 i386 lightweight BitTorrent client (GTK interface) rc unity-common 7.0.0daily13.06.19~13.04-0ubuntu1 all Common files for the Unity interface. rc vino 3.6.2-0ubuntu4 i386 VNC server for GNOME rc wicd-daemon 1.7.2.4-4.1 all wired and wireless network manager - daemon rc wicd-gtk 1.7.2.4-4.1 all wired and wireless network manager - GTK+ client rc xscreensaver 5.15-2ubuntu1 i386 Automatic screensaver for X rc xscreensaver-data 5.15-3ubuntu1 i386 data files to be shared among screensaver frontends sudo dpkg -l | grep uget: ii uget 1.10.3-1 i386 easy-to-use download manager written in GTK+ sudo dpkg -l | grep indicator: ii gir1.2-appindicator3-0.1 12.10.1+13.10.20130920-0ubuntu2 i386 Typelib files for libappindicator3-1. ii gir1.2-syncmenu-0.1 12.10.5+13.10.20131011-0ubuntu1 i386 indicator for synchronisation processes status - bindings ii indicator-applet-complete 12.10.2+13.10.20130924.2-0ubuntu1 i386 Clone of the GNOME panel indicator applet ii indicator-application 12.10.1daily13.01.25-0ubuntu1 i386 Application Indicators ii indicator-appmenu 13.01.0+13.10.20130930-0ubuntu1 i386 Indicator for application menus. ii indicator-bluetooth 0.0.6+13.10.20131016-0ubuntu1 i386 System bluetooth indicator. ii indicator-datetime 13.10.0+13.10.20131023.2-0ubuntu1 i386 Simple clock ii indicator-keyboard 0.0.0+13.10.20131010.1-0ubuntu1 i386 Keyboard indicator ii indicator-messages 13.10.1+13.10.20131011-0ubuntu1 i386 indicator that collects messages that need a response ii indicator-multiload 0.3-0ubuntu1 i386 Graphical system load indicator for CPU, ram, etc. ii indicator-power 12.10.6+13.10.20131008-0ubuntu1 i386 Indicator showing power state. ii indicator-printers 0.1.7daily13.03.01-0ubuntu1 i386 indicator showing active print jobs ii indicator-session 12.10.5+13.10.20131023.1-0ubuntu1 i386 indicator showing session management, status and user switching ii indicator-sound 12.10.2+13.10.20131011-0ubuntu1 i386 System sound indicator. ii indicator-sync 12.10.5+13.10.20131011-0ubuntu1 i386 indicator for synchronisation processes status ii libappindicator1 12.10.1+13.10.20130920-0ubuntu2 i386 Application Indicators ii libappindicator3-1 12.10.1+13.10.20130920-0ubuntu2 i386 Application Indicators ii libindicator3-7 12.10.2+13.10.20130913-0ubuntu2 i386 panel indicator applet - shared library ii libindicator7 12.10.2+13.10.20130913-0ubuntu2 i386 panel indicator applet - shared library ii libsync-menu1:i386 12.10.5+13.10.20131011-0ubuntu1 i386 indicator for synchronisation processes status - libraries ii python-appindicator 12.10.1+13.10.20130920-0ubuntu2 i386 Python bindings for libappindicator ii sni-qt:i386 0.2.6-0ubuntu1 i386 indicator support for Qt ii telepathy-indicator 0.3.1daily13.06.19-0ubuntu1 i386 Desktop service to integrate Telepathy with the messaging menu.

    Read the article

  • Yahoo sitemap validation

    - by Joel
    Hello, I am trying to submit sitemap.xml (index) to Yahoo Site Explorer but with no luck. I tried using website feed option in the site explorer to submit the sitemap, but I got validation errors. However, when submitting the same sitemap to google webmaster tools, the sitemap was validated successfully. Could it be for the fact that I am using sitemap with image tag: <image:image> <image:loc>http://www.domain.com/pic.jpg</image:loc> <image:title>picture</image:title> </image:image> When I tried validating the sitemap with inline tools such as http://www.xml-sitemaps.com/validate-xml-sitemap.html and http://www.w3.org/2001/03/webdata/xsv the error I received was: Attempt to load a schema document from http://www.google.com/schemas/sitemap-image/1.1 (source: new namespace) for http://www.google.com/schemas/sitemap-image/1.1, failed: Not recognised as W3C XML Schema or RDDL: html However, the declaration of the sitemap I use in the top of the document is the same as suggested by Google on their official page at http://www.google.com/support/webmasters/bin/answer.py?hl=en&answer=178636 : <?xml version="1.0" encoding="UTF-8"?> <urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1"> <url> Any ideas how to resolve this issue? Thanks, Joel Thanks, Joel

    Read the article

< Previous Page | 128 129 130 131 132 133 134 135 136 137 138 139  | Next Page >