Search Results

Search found 814 results on 33 pages for 'chinna 82'.

Page 14/33 | < Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >

  • How do I set up my home server to go directly to a port other than 80

    - by Kevin
    I'm using dyndns, a lynksis wt54g router, and tomcat 7 with spring to set up a web server. This is my first time to attempt this. I'm sure this is a very common question, but I don't know enough to find the answer after quite a bit searching. Dyndns is successfully forwarding to my ip. The main problem is, the router admin login is coming up when my url is used. I'm hosting my site on port 8080. I have port forwarding set up for port 8080 but my request times out when I attempt to use my url like this www.myurl1234.com:8080. I don't want users to have to type the port anyway. I also tried changing the management port to 82 and hosting on port 80, but I still get the router admin login when I use my url. Where am I going wrong? Can I set it up so that www.myurl1234.com goes straight to port 8080?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • why in /proc file system have this infomation

    - by liutaihua
    run: lsof|grep delete can find some process open fd, but system dis that it had to delete: mingetty 2031 root txt REG 8,2 15256 49021039 /sbin/mingetty (deleted) I look the /proce filesystem: ls -l /proc/[pid] lrwxrwxrwx 1 root root 0 9? 17 16:12 exe -> /sbin/mingetty (deleted) but actually, the executable(/sbin/mingetty) is normal at /sbin/mingetty path. and some soket like this situation: ls -l /proc/[pid]/fd 82 -> socket:[23716953] but, use the commands: netstat -ae|grep [socket id] can find it. why the OS display this infomation??

    Read the article

  • Wifi Hotspot not created in ubuntu 12.04

    - by user2406568
    I am using Hp Pavillion g4 with braodcom wireledd adpater. I have the following hardware configuration, for lan and wifi eth0 Link encap:Ethernet HWaddr 10:1f:74:b2:61:cc inet addr:10.3.10.45 Bcast:10.3.11.255 Mask:255.255.252.0 inet6 addr: fe80::121f:74ff:feb2:61cc/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:190855 errors:0 dropped:0 overruns:0 frame:0 TX packets:133209 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:77642990 (77.6 MB) TX bytes:25290447 (25.2 MB) Interrupt:44 Base address:0x6000 eth1 Link encap:Ethernet HWaddr 38:59:f9:7d:d6:b2 inet addr:10.3.9.180 Bcast:10.3.11.255 Mask:255.255.252.0 inet6 addr: fe80::3a59:f9ff:fe7d:d6b2/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:245562 errors:82 dropped:0 overruns:0 frame:408011 TX packets:90383 errors:260 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:140772881 (140.7 MB) TX bytes:13041542 (13.0 MB) Interrupt:16 lo Link encap:Local Loopback inet addr:127.0.0.1 Mask:255.0.0.0 inet6 addr: ::1/128 Scope:Host UP LOOPBACK RUNNING MTU:16436 Metric:1 RX packets:3230 errors:0 dropped:0 overruns:0 frame:0 TX packets:3230 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:0 RX bytes:435198 (435.1 KB) TX bytes:435198 (435.1 KB) whenever I click on create hotspot nothing happens. Any solution???

    Read the article

  • Unable to mount location ubuntu 12.10

    - by Rajesh
    I'm new to Ubuntu. I installed Ubuntu 12.10 replacing windows. Now I'm getting Unable to mount location error while opening the drive. $ cat /etc/fstab # /etc/fstab: static file system information. # # Use 'blkid' to print the universally unique identifier for a # device; this may be used with UUID= as a more robust way to name devices # that works even if disks are added and removed. See fstab(5). # # <file system> <mount point> <type> <options> <dump> <pass> # / was on /dev/sda1 during installation UUID=5fa63194-c19e-4117-95c6-679eb6453d3b / ext4 errors=remount-ro 0 1 # swap was on /dev/sda5 during installation UUID=70f1ec8d-aa45-4de7-a206-747dccd2472b none swap sw 0 0 $ sudo fdisk -l Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976773168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0001f10f Device Boot Start End Blocks Id System /dev/sda1 * 2048 970561535 485279744 83 Linux /dev/sda2 970563582 976771071 3103745 5 Extended /dev/sda5 970563584 976771071 3103744 82 Linux swap / Solaris

    Read the article

  • How do I get 12.04 to recognize swap partition so that I can hibernate?

    - by Kayla
    I justed installed 12.04 and used gparted to erase and enlarge my swap partition. When I rebooted, gparted said that the file partition for the swap was unknown. Gparted doesn't let me change the file partition to "linux-swap". It does let me change it to NTFS, but when I reboot, it goes back to "unknown". Thanks in advance for your help. Output from sudo swapon -s: Filename Type Size Used Priority /dev/mapper/cryptswap1 partition 9025532 0 -1 Output from sudo fdisk -l: Disk /dev/sda: 250.1 GB, 250059350016 bytes 255 heads, 63 sectors/track, 30401 cylinders, total 488397168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x9d63ac84 Device Boot Start End Blocks Id System /dev/sda1 * 2048 2459647 1228800 7 HPFS/NTFS/exFAT /dev/sda2 2459648 197836472 97688412+ 7 HPFS/NTFS/exFAT /dev/sda3 466890752 488395119 10752184 7 HPFS/NTFS/exFAT /dev/sda4 197836798 466890751 134526977 5 Extended /dev/sda5 197836800 448837631 125500416 83 Linux /dev/sda6 448839680 466890751 9025536 82 Linux swap / Solaris Partition table entries are not in disk order Disk /dev/mapper/cryptswap1: 9242 MB, 9242148864 bytes 255 heads, 63 sectors/track, 1123 cylinders, total 18051072 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x951b7f53 Disk /dev/mapper/cryptswap1 doesn't contain a valid partition table

    Read the article

  • How can I get rid of the motd message "*** /dev/sdb1 will be checked for errors at next reboot ***"? [duplicate]

    - by kmm
    This question already has an answer here: Persistent “disk will be checked…” in the message of the day (motd) even after reboot 3 answers My motd persistently has: *** /dev/sdb1 will be checked for errors at next reboot *** The problem is that I don't have /dev/sdb1 on my system. I only have /dev/sdb2 (mouted as /) and /dev/sda1 which mounts to /media/backup. I delete that line from /etc/motd, but it reappears after reboot. Here's my df output: Filesystem Size Used Avail Use% Mounted on /dev/sdb2 73G 3.7G 66G 6% / udev 490M 4.0K 490M 1% /dev tmpfs 200M 760K 199M 1% /run none 5.0M 0 5.0M 0% /run/lock none 498M 0 498M 0% /run/shm /dev/sda1 1.9T 429G 1.4T 25% /media/backup Update Here is the output of sudo fdisk -l Disk /dev/sda: 2000.4 GB, 2000398934016 bytes 255 heads, 63 sectors/track, 243201 cylinders, total 3907029168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0003dfc2 Device Boot Start End Blocks Id System /dev/sda1 63 3907024064 1953512001 83 Linux Disk /dev/sdb: 80.0 GB, 80026361856 bytes 255 heads, 63 sectors/track, 9729 cylinders, total 156301488 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00049068 Device Boot Start End Blocks Id System /dev/sdb1 152301568 156301311 1999872 82 Linux swap / Solaris /dev/sdb2 * 2048 152301567 76149760 83 Linux Partition table entries are not in disk order I guess /dev/sdb1 is my swap space.

    Read the article

  • why Ubuntu 12.04.1 nautilus left panel, doesn't show other partitions and usb drives?

    - by amerllica
    how do you do friends will be fine I had Ubuntu 12.04 and all thing work well but at one day i decide to change my partition tables, and done it. at now I've windows 8, Ubuntu 12.04.1 and Backtrack5 R3 on my laptop. my partitions are: /dev/sda1 * 2048 58597375 29297664 7 HPFS/NTFS/exFAT /dev/sda2 58601472 976773119 459085824 5 Extended /dev/sda5 58605120 797020159 369207520 7 HPFS/NTFS/exFAT /dev/sda6 797030400 933763071 68366336 83 Linux /dev/sda7 933765120 972834815 19534848 83 Linux /dev/sda8 972836864 976773119 1968128 82 Linux swap / Solaris at first I install windows 8 and then Backtrack5 R3, and at last I install Ubuntu 12.04.1 and I realize that my Ubuntu nautilus doesn't show other partitions or usb/cd/dvd drives. I search in Google and various Linux or Ubuntu forums, But I can't find any solution, just one thing... that is "gvfs-gdu-volume" cause nautilus left panel show other partitions which didn't mounted. but when I see top there isn't this program. who can I solve this problem? how nautilus can show other partitions or drives in its left panel once again?

    Read the article

  • domain works randomly

    - by mthenw
    Hi, I have problem with configuring bind9 on debian (lenny) server. Generaly speaking everything is working ok but sometimes I get 404 on few domains (eg. 4stopnie.com but after few refreshes in browser site loads) or I can't validate site with validator.w3.org (error '500 Can't connect to 4stopnie.com:80 (Bad hostname '4stopnie.com')'). Domains were moved from other server. After moving I changed serial number in zone file. $ttl 600 @ IN SOA ns.wpoznaniu.info. xxx.4stopnie.com. ( 2011011601 3600 600 86400 600) @ IN NS ns.wpoznaniu.info. @ IN A 80.82.21.196 www IN CNAME @

    Read the article

  • Mounting a new hard drive (sda1) to my existing filesystem

    - by shank22
    I tried to read some posts regarding mounting a new hard drive, but I am facing some problem. My new hard drive is sda1. The output of sudo fdisk -l is: sudo fdisk -l Disk /dev/sdb: 999.7 GB, 999653638144 bytes 255 heads, 63 sectors/track, 121534 cylinders, total 1952448512 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00016485 Device Boot Start End Blocks Id System /dev/sdb1 * 2048 1935822847 967910400 83 Linux /dev/sdb2 1935824894 1952446463 8310785 5 Extended /dev/sdb5 1935824896 1952446463 8310784 82 Linux swap / Solaris Disk /dev/sda: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x78dbcdc1 Device Boot Start End Blocks Id System /dev/sda1 2048 1953521663 976759808 7 HPFS/NTFS/exFAT What should be done to add this new sda1 hard drive on booting up? What should be added in the /etc/fstab file? I have not performed any partition on the new sda1 drive. I need help on how to proceed from scratch and can't afford to take any risk. Please help!

    Read the article

  • Errors rose when a Netbean Maven Project tries to run

    - by Zakaria
    Hi everybody, I installed NetBeans 6.8 on Vista and and I'm trying to execute a simple Maven Project. When I ran the project, I got this set of errors: WARNING: You are running embedded Maven builds, some build may fail due to incompatibilities with latest Maven release. To set Maven instance to use for building, click here. Scanning for projects... [#process-resources] [resources:resources] Using default encoding to copy filtered resources. [#compile] [compiler:compile] Nothing to compile - all classes are up to date [exec:exec] [EL Info]: 2010-04-04 18:22:54.907--ServerSession(15532856)--EclipseLink, version: Eclipse Persistence Services - 2.0.0.v20091127-r5931 [EL Severe]: 2010-04-04 18:22:54.929--ServerSession(15532856)--Local Exception Stack: Exception [EclipseLink-4003] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.DatabaseException Exception in thread "main" javax.persistence.PersistenceException: Exception [EclipseLink-4003] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.DatabaseException Exception Description: Configuration error. Class [org.apache.derby.jdbc.ClientDriver] not found. Exception Description: Configuration error. Class [org.apache.derby.jdbc.ClientDriver] not found. at org.eclipse.persistence.exceptions.DatabaseException.configurationErrorClassNotFound(DatabaseException.java:82) at org.eclipse.persistence.sessions.DefaultConnector.loadDriverClass(DefaultConnector.java:267) at org.eclipse.persistence.sessions.DefaultConnector.connect(DefaultConnector.java:85) at org.eclipse.persistence.internal.jpa.EntityManagerSetupImpl.deploy(EntityManagerSetupImpl.java:392) at org.eclipse.persistence.sessions.DatasourceLogin.connectToDatasource(DatasourceLogin.java:162) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.getServerSession(EntityManagerFactoryImpl.java:151) at org.eclipse.persistence.internal.sessions.DatabaseSessionImpl.loginAndDetectDatasource(DatabaseSessionImpl.java:584) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManagerImpl(EntityManagerFactoryImpl.java:207) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryProvider.login(EntityManagerFactoryProvider.java:228) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManager(EntityManagerFactoryImpl.java:195) at com.mycompany.chapter2_ex1.Main.main(Main.java:31) Caused by: Exception [EclipseLink-4003] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.DatabaseException Exception Description: Configuration error. Class [org.apache.derby.jdbc.ClientDriver] not found. at org.eclipse.persistence.internal.jpa.EntityManagerSetupImpl.deploy(EntityManagerSetupImpl.java:368) at org.eclipse.persistence.exceptions.DatabaseException.configurationErrorClassNotFound(DatabaseException.java:82) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.getServerSession(EntityManagerFactoryImpl.java:151) at org.eclipse.persistence.sessions.DefaultConnector.loadDriverClass(DefaultConnector.java:267) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManagerImpl(EntityManagerFactoryImpl.java:207) at org.eclipse.persistence.sessions.DefaultConnector.connect(DefaultConnector.java:85) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryImpl.createEntityManager(EntityManagerFactoryImpl.java:195) at org.eclipse.persistence.sessions.DatasourceLogin.connectToDatasource(DatasourceLogin.java:162) at com.mycompany.chapter2_ex1.Main.main(Main.java:31) at org.eclipse.persistence.internal.sessions.DatabaseSessionImpl.loginAndDetectDatasource(DatabaseSessionImpl.java:584) at org.eclipse.persistence.internal.jpa.EntityManagerFactoryProvider.login(EntityManagerFactoryProvider.java:228) at org.eclipse.persistence.internal.jpa.EntityManagerSetupImpl.deploy(EntityManagerSetupImpl.java:368) ... 4 more [ERROR]The following mojo encountered an error while executing: [ERROR]Group-Id: org.codehaus.mojo [ERROR]Artifact-Id: exec-maven-plugin [ERROR]Version: 1.1.1 [ERROR]Mojo: exec [ERROR]brought in via: Direct invocation [ERROR]While building project: [ERROR]Group-Id: com.mycompany [ERROR]Artifact-Id: chapter2_ex1 [ERROR]Version: 1.0-SNAPSHOT [ERROR]From file: C:\Users\Charlotte\Documents\NetBeansProjects\chapter2_ex1\pom.xml [ERROR]Reason: Result of cmd.exe /X /C ""C:\Program Files\Java\jdk1.6.0_11\bin\java.exe" -classpath C:\Users\Charlotte\Documents\NetBeansProjects\chapter2_ex1\target\classes;C:\Users\Charlotte\.m2\repository\javax\persistence\persistence-api\1.0\persistence-api-1.0.jar;C:\Users\Charlotte\.m2\repository\org\eclipse\persistence\javax.persistence\2.0.0\javax.persistence-2.0.0.jar;C:\Users\Charlotte\.m2\repository\org\eclipse\persistence\eclipselink\2.0.0-RC1\eclipselink-2.0.0-RC1.jar com.mycompany.chapter2_ex1.Main" execution is: '1'. ------------------------------------------------------------------------ For more information, run with the -e flag ------------------------------------------------------------------------ BUILD FAILED ------------------------------------------------------------------------ Total time: 3 seconds Finished at: Sun Apr 04 18:22:55 CEST 2010 Final Memory: 47M/94M ------------------------------------------------------------------------ Theses exceptions rose even if I can run the database by using the console (ij) and when I connect the Database, no errors are showing. Can you help me please? Thank you very much. Regards.

    Read the article

  • How do I send an email with embedded images AND regular attachments in JavaMail?

    - by Chris
    Hi, I'd like to know how to build an SMTP multipart message in the correct order so that it will render correctly on the iPhone mail client (rendering correctly in GMail). I'm using Javamail to build up an email containing the following parts: A body part with content type "text/html; UTF-8" An embedded image attachment. A file attachment I am sending the mail via GMail SMTP (via SSL) and the mail is sent and rendered correctly using a GMail account, however, the mail does not render correctly on the iPhone mail client. On the iPhone mail client, the image is rendered before the "Before Image" text when it should be rendered afterwards. After the "Before Image" text there is an icon with a question mark (I assume it means it couldn't find the referenced CID). I'm not sure if this is a limitation of the iPhone mail client or a bug in my mail sending code (I strongly assume the latter). I think that perhaps the headers on my parts might by incorrect or perhaps I am providing the multiparts in the wrong order. I include the text of the received mail as output by gmail (which renders the file correc Message-ID: <[email protected]> Subject: =?UTF-8?Q?Test_from_=E3=82=AF=E3=83=AA=E3=82=B9?= MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="----=_Part_0_20870565.1274154021755" ------=_Part_0_20870565.1274154021755 Content-Type: application/octet-stream Content-Transfer-Encoding: base64 Content-ID: <20100518124021763_368238_0> iVBORw0K ----- TRIMMED FOR CONCISENESS 6p1VVy4alAAAAABJRU5ErkJggg== ------=_Part_0_20870565.1274154021755 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit <html><head><title>Employees Favourite Foods</title> <style> body { font: normal 8pt arial; } th { font: bold 8pt arial; white-space: nowrap; } td { font: normal 8pt arial; white-space: nowrap; } </style></head><body> Before Image<br><img src="cid:20100518124021763_368238_0"> After Image<br><table border="0"> <tr> <th colspan="4">Employees Favourite Foods</th> </tr> <tr> <th align="left">Name</th><th align="left">Age</th><th align="left">Tel.No</th><th align="left">Fav.Food</th> </tr> <tr style="background-color:#e0e0e0"> <td>Chris</td><td>34</td><td>555-123-4567</td><td>Pancakes</td> </tr> </table></body></html> ------=_Part_0_20870565.1274154021755 Content-Type: text/plain; charset=us-ascii; name=textfile.txt Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=textfile.txt This is a textfile with numbers counting from one to ten beneath this line: one two three four five six seven eight nine ten(no trailing carriage return) ------=_Part_0_20870565.1274154021755-- Even if you can't assist me with this, I would appreciate it if any members of the forum could forward me a (non-personal) mail that includes inline images (not external hyperlinked images though). I just need to find a working sample then I can move past this. Thanks, Chris.

    Read the article

  • Order of parts in SMTP multipart messages

    - by Chris
    Hi, I'd like to know how to build an SMTP multipart message in the correct order so that it will render correctly on the iPhone mail client (rendering correctly in GMail). I'm using Javamail to build up an email containing the following parts: A body part with content type "text/html; UTF-8" An embedded image attachment. A file attachment I am sending the mail via GMail SMTP (via SSL) and the mail is sent and rendered correctly using a GMail account, however, the mail does not render correctly on the iPhone mail client. On the iPhone mail client, the image is rendered before the "Before Image" text when it should be rendered afterwards. After the "Before Image" text there is an icon with a question mark (I assume it means it couldn't find the referenced CID). I'm not sure if this is a limitation of the iPhone mail client or a bug in my mail sending code (I strongly assume the latter). I think that perhaps the headers on my parts might by incorrect or perhaps I am providing the multiparts in the wrong order. I include the text of the received mail as output by gmail (which renders the file correc Message-ID: <[email protected]> Subject: =?UTF-8?Q?Test_from_=E3=82=AF=E3=83=AA=E3=82=B9?= MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="----=_Part_0_20870565.1274154021755" ------=_Part_0_20870565.1274154021755 Content-Type: application/octet-stream Content-Transfer-Encoding: base64 Content-ID: <20100518124021763_368238_0> iVBORw0K ----- TRIMMED FOR CONCISENESS 6p1VVy4alAAAAABJRU5ErkJggg== ------=_Part_0_20870565.1274154021755 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit <html><head><title>Employees Favourite Foods</title> <style> body { font: normal 8pt arial; } th { font: bold 8pt arial; white-space: nowrap; } td { font: normal 8pt arial; white-space: nowrap; } </style></head><body> Before Image<br><img src="cid:20100518124021763_368238_0"> After Image<br><table border="0"> <tr> <th colspan="4">Employees Favourite Foods</th> </tr> <tr> <th align="left">Name</th><th align="left">Age</th><th align="left">Tel.No</th><th align="left">Fav.Food</th> </tr> <tr style="background-color:#e0e0e0"> <td>Chris</td><td>34</td><td>555-123-4567</td><td>Pancakes</td> </tr> </table></body></html> ------=_Part_0_20870565.1274154021755 Content-Type: text/plain; charset=us-ascii; name=textfile.txt Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=textfile.txt This is a textfile with numbers counting from one to ten beneath this line: one two three four five six seven eight nine ten(no trailing carriage return) ------=_Part_0_20870565.1274154021755-- Even if you can't assist me with this, I would appreciate it if any members of the forum could forward me a (non-personal) mail that includes inline images (not external hyperlinked images though). I just need to find a working sample then I can move past this. Thanks, Chris.

    Read the article

  • form submitting with mechanize and Python

    - by MATELIN Alexis
    I'm trying to scrap a website that requires to submit two forms : a first one to loggin and a second one to specify my research. I'm using Python and the mechanize package. No problem with the first one, but i just can't figure out how to pass through the second one. Here is the part of my code related to the firm above-mentionned agemin=18 agemax=25 by='region' country='France' region=2 newcustomers=1 browser.select_form(nr=0) browser['age[min]']=agemin browser['age[max]']=agemax browser['country']=country browser['region']=region browser['by']=by browser['new-customers']=newcustomers response=browser.submit() content=response.read() but when I submit the variable 'age[min]' by example, I get the following error message : TypeError: object of type 'int' has no len() to give you some more informations, here is what I get with 'print br.form' <POST http://www.adopteunmec.com/qsearch/ajax_quick application/x-www-form-urlencoded <SelectControl(age[min]=[, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, *30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99])> <SelectControl(age[max]=[, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, *45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99])> <SelectControl(by=[*region, distance])> <SelectControl(country=[*fr, be, ch, ca])> <SelectControl(region=[*1, 2, 3, 4, 5, 6, 7, 8, 22, 23, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 11])> <SelectControl(distance[min]=[*, 0, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000])> <SelectControl(distance[max]=[, 0, 10, 20, 30, 40, 50, 60, 70, *80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000])> <CheckboxControl(new=[*1])>> My guess is that the form needs an object (like a list) containing all the variables to accept it ; that's why it refuses the variables submited one by one. Thank you in advance for any help ! Alexis

    Read the article

  • Can't make AWUS036H work in Ubuntu 12.10

    - by sfrj
    I am using 64 bit Ubuntu 12.10. This is my kernel version: Linux 3.5.0-19-generic #30-Ubuntu SMP Tue Nov 13 17:48:01 UTC 2012 x86_64 x86_64 x86_64 GNU/Linux My wireless card is an AWUSU36H The first thing I do to install the driver is copy the driver from the CD to the Downloads folder. cd /media/me/AWUS036H/Drivers/RTL8187L/Unix (Linux)/Linux driver for kernel 2.6.X$ cp rtl8187_linux_26.1025.0328.2007.tar.gz ~/Downloads/ Then I extract the tar tar xvfz rtl8187_linux_26.1025.0328.2007.tar.gz I navigate into the extracted folder, and I try to follow the instructions in the Readme.txt cd rtl8187_linux_26.1025.0328.2007 This are the contents of the folder: drv.tar.gz makedrv stack.tar.gz wlan0rmv ieee80211 ReadMe.txt wlan0dhcp wlan0up ifcfg-wlan0 rtl8187 wlan0down wpa_supplicant-0.4.9 This is what the Readme.txt says: Release Date: 2006-02-09, ver 1.2^M RTL8187 Linux driver version 1.2^M ^M --This driver supports RealTek RTL8187 Wireless LAN driver for ^M Fedora Core 2/3/4/5, Debian 3.1, Mandrake 10.2/Mandriva 2006, ^M SUSE 9.3/10.1/10.2, Gentoo 3.1, etc.^M - Support Client mode for either infrastructure or adhoc mode^M - Support WEP and WPAPSK connection^M ^M < Component >^M The driver is composed of several parts:^M 1. Module source code^M stack.tar.gz^M drv.tar.gz^M ^M 2. Script ot build the modules^M makedrv^M ^M 3. Script to load/unload modules^M wlan0up^M wlan0down ^M ^M 4. Script and configuration for DHCP^M "ReadMe.txt" [readonly] 140 lines, 4590 characters So what I do know is extract both of the compressed files: sudo tar xvfz drv.tar.gz sudo tar xvfz stack.tar.gz This 2 commands will add some data to the folders ieee80211 and rtl8187 At this point I get lost, and I don't know what to do. If I go in each of this 2 folders and I run the sudo make command then I get errors like this one: sudo makemake -C /lib/modules/3.5.0-19-generic/build M=/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187 modules make[1]: Entering directory `/usr/src/linux-headers-3.5.0-19-generic' CC [M] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187_core.o In file included from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187_core.c:64:0: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187.h:29:26: fatal error: linux/config.h: No such file or directory compilation terminated. make[2]: *** [/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187_core.o] Error 1 make[1]: *** [_module_/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.5.0-19-generic' make: *** [modules] Error 2 If I try to run any of the script ./makedrv that the instructions describe, then I also get an error: ~/Downloads/rtl8187_linux_26.1025.0328.2007$ sudo ./makedrv [sudo] password for me: ieee80211/ ieee80211/license ieee80211/ieee80211_crypt.c ieee80211/ieee80211_tx.c ieee80211/ieee80211_softmac.c ieee80211/ieee80211_softmac_wx.c ieee80211/ieee80211_module.c ieee80211/ieee80211_crypt_ccmp.c ieee80211/ieee80211_rx.c ieee80211/tags ieee80211/ieee80211_crypt_tkip.c ieee80211/Makefile ieee80211/readme ieee80211/.tmp_versions/ ieee80211/.tmp_versions/ieee80211-rtl.mod ieee80211/.tmp_versions/ieee80211_crypt_wep-rtl.mod ieee80211/.tmp_versions/ieee80211_crypt_tkip-rtl.mod ieee80211/.tmp_versions/ieee80211_crypt-rtl.mod ieee80211/.tmp_versions/ieee80211_crypt_ccmp-rtl.mod ieee80211/ieee80211_crypt_wep.c ieee80211/ieee80211.h ieee80211/ieee80211_wx.c ieee80211/ieee80211_crypt.h rtl8187/ rtl8187/license rtl8187/r8180_rtl8225z2.c rtl8187/r8180_rtl8225.h rtl8187/r8187_led.c rtl8187/r8180_93cx6.h rtl8187/r8180_wx.h rtl8187/r8180_hw.h rtl8187/copying rtl8187/r8187_led.h rtl8187/r8180_pm.h rtl8187/tags rtl8187/r8187.h rtl8187/Makefile rtl8187/r8180_rtl8225.c rtl8187/readme rtl8187/install rtl8187/.tmp_versions/ rtl8187/.tmp_versions/r8187.mod rtl8187/changes rtl8187/r8180_wx.c rtl8187/r8180_pm.c rtl8187/r8187_core.c rtl8187/r8180_93cx6.c rtl8187/authors rtl8187/ieee80211.h rtl8187/ieee80211_crypt.h rm -f *.mod.c *.mod *.o .*.cmd *.ko *~ rm -rf /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/tmp make -C /lib/modules/3.5.0-19-generic/build M=/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211 modules make[1]: Entering directory `/usr/src/linux-headers-3.5.0-19-generic' CC [M] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.o In file included from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17:0: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:1019:24: error: field ‘ps_task’ has incomplete type /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_softmac_scan_wq’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:421:2: warning: passing argument 2 of ‘queue_delayed_work’ from incompatible pointer type [enabled by default] In file included from include/linux/srcu.h:32:0, from include/linux/notifier.h:15, from /usr/src/linux-headers-3.5.0-19-generic/arch/x86/include/asm/uprobes.h:26, from include/linux/uprobes.h:35, from include/linux/mm_types.h:15, from include/linux/kmemcheck.h:4, from include/linux/skbuff.h:18, from include/linux/if_ether.h:134, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:26, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17: include/linux/workqueue.h:371:12: note: expected ‘struct delayed_work *’ but argument is of type ‘struct work_struct *’ /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_softmac_stop_scan’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:495:3: warning: passing argument 1 of ‘cancel_delayed_work’ from incompatible pointer type [enabled by default] In file included from include/linux/srcu.h:32:0, from include/linux/notifier.h:15, from /usr/src/linux-headers-3.5.0-19-generic/arch/x86/include/asm/uprobes.h:26, from include/linux/uprobes.h:35, from include/linux/mm_types.h:15, from include/linux/kmemcheck.h:4, from include/linux/skbuff.h:18, from include/linux/if_ether.h:134, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:26, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17: include/linux/workqueue.h:410:20: note: expected ‘struct delayed_work *’ but argument is of type ‘struct work_struct *’ /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_associate_abort’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:915:2: warning: passing argument 2 of ‘queue_delayed_work’ from incompatible pointer type [enabled by default] In file included from include/linux/srcu.h:32:0, from include/linux/notifier.h:15, from /usr/src/linux-headers-3.5.0-19-generic/arch/x86/include/asm/uprobes.h:26, from include/linux/uprobes.h:35, from include/linux/mm_types.h:15, from include/linux/kmemcheck.h:4, from include/linux/skbuff.h:18, from include/linux/if_ether.h:134, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:26, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17: include/linux/workqueue.h:371:12: note: expected ‘struct delayed_work *’ but argument is of type ‘struct work_struct *’ /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_rx_frame_softmac’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:1527:3: error: implicit declaration of function ‘tasklet_schedule’ [-Werror=implicit-function-declaration] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_stop_protocol_rtl’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2120:2: warning: passing argument 1 of ‘cancel_delayed_work’ from incompatible pointer type [enabled by default] In file included from include/linux/srcu.h:32:0, from include/linux/notifier.h:15, from /usr/src/linux-headers-3.5.0-19-generic/arch/x86/include/asm/uprobes.h:26, from include/linux/uprobes.h:35, from include/linux/mm_types.h:15, from include/linux/kmemcheck.h:4, from include/linux/skbuff.h:18, from include/linux/if_ether.h:134, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:26, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17: include/linux/workqueue.h:410:20: note: expected ‘struct delayed_work *’ but argument is of type ‘struct work_struct *’ /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_softmac_init’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2229:78: error: macro "INIT_WORK" passed 3 arguments, but takes just 2 /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2229:2: error: ‘INIT_WORK’ undeclared (first use in this function) /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2229:2: note: each undeclared identifier is reported only once for each function it appears in /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2230:88: error: macro "INIT_WORK" passed 3 arguments, but takes just 2 /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2231:94: error: macro "INIT_WORK" passed 3 arguments, but takes just 2 /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2232:96: error: macro "INIT_WORK" passed 3 arguments, but takes just 2 /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2233:82: error: macro "INIT_WORK" passed 3 arguments, but takes just 2 /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2234:82: error: macro "INIT_WORK" passed 3 arguments, but takes just 2 /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2244:2: error: implicit declaration of function ‘tasklet_init’ [-Werror=implicit-function-declaration] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_softmac_free’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2255:2: warning: passing argument 1 of ‘cancel_delayed_work’ from incompatible pointer type [enabled by default] In file included from include/linux/srcu.h:32:0, from include/linux/notifier.h:15, from /usr/src/linux-headers-3.5.0-19-generic/arch/x86/include/asm/uprobes.h:26, from include/linux/uprobes.h:35, from include/linux/mm_types.h:15, from include/linux/kmemcheck.h:4, from include/linux/skbuff.h:18, from include/linux/if_ether.h:134, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:26, from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17: include/linux/workqueue.h:410:20: note: expected ‘struct delayed_work *’ but argument is of type ‘struct work_struct *’ /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: In function ‘ieee80211_wpa_set_encryption’: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2489:3: error: implicit declaration of function ‘request_module’ [-Werror=implicit-function-declaration] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2518:3: error: implicit declaration of function ‘try_module_get’ [-Werror=implicit-function-declaration] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c: At top level: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2663:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2663:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2663:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2664:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2664:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2664:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2665:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2665:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2665:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2666:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2666:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2666:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2667:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2667:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2667:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2668:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2668:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2668:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2669:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2669:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2669:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2670:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2670:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2670:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2671:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2671:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2671:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2672:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2672:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2672:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2673:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2673:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2673:1: warning: parameter names (without types) in function declaration [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2674:1: warning: data definition has no type or storage class [enabled by default] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2674:1: warning: type defaults to ‘int’ in declaration of ‘EXPORT_SYMBOL’ [-Wimplicit-int] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:2674:1: warning: parameter names (without types) in function declaration [enabled by default] In file included from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.c:17:0: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211.h:1212:37: warning: ‘netdev_priv’ is static but used in inline function ‘ieee80211_priv’ which is not static [enabled by default] cc1: some warnings being treated as errors make[2]: *** [/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211/ieee80211_softmac.o] Error 1 make[1]: *** [_module_/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/ieee80211] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.5.0-19-generic' make: *** [modules] Error 2 rm -f *.mod.c *.mod *.o .*.cmd *.ko *~ rm -rf /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/tmp make -C /lib/modules/3.5.0-19-generic/build M=/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187 modules make[1]: Entering directory `/usr/src/linux-headers-3.5.0-19-generic' CC [M] /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187_core.o In file included from /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187_core.c:64:0: /home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187.h:29:26: fatal error: linux/config.h: No such file or directory compilation terminated. make[2]: *** [/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187/r8187_core.o] Error 1 make[1]: *** [_module_/home/me/Downloads/rtl8187_linux_26.1025.0328.2007/rtl8187] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.5.0-19-generic' make: *** [modules] Error 2 Can somebody give me a hand finding out what I need to do to make my wifi card work? Update This is the output of the lsusb command lsusb Bus 003 Device 002: ID 147e:1000 Upek Biometric Touchchip/Touchstrip Fingerprint Sensor Bus 001 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub Bus 002 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub Bus 003 Device 001: ID 1d6b:0001 Linux Foundation 1.1 root hub Bus 004 Device 001: ID 1d6b:0001 Linux Foundation 1.1 root hub

    Read the article

  • Exalogic 2.0.1 Tea Break Snippets - Scripting Asset Creation

    - by The Old Toxophilist
    So far in this series we have looked at creating asset within the EMOC BUI but the Exalogic 2.0.1 installation also provide the Iaas cli as an alternative to most of the common functionality available within EMOC. The IaaS cli interface provides access to the functions that are available to a user logged into the BUI with the CloudUser Role. As such not all functionality is available from the command line interface however having said that the IaaS cli provides all the functionality required to create the Assets within a specific Account (Tenure). Because these action are common and repeatable I decided to wrap the functionality within a simple script that takes a simple input file and creates the Asset. Following the Script through will show us the required steps needed to create the various Assets within an Account and hence I will work through the various functions within the script below describing the steps. You will note from the various steps within the script that it is designed to pause between actions allowing the proceeding action to complete. The reason for this is because we could swamp EMOC with a series of actions and may end up with a situation where we are trying to action a Volume attached before the creation of the vServer and Volume have completed. processAssets() This function simply reads through the passed input file identifying what assets need to be created. An example of the input file can be found below. It can be seen that the input file can be used to create Assets in multiple Accounts during a single run. The order of the entries define the functions that need to be actioned as follows: Input Command Iaas Actions Parameters Production:Connect akm-describe-accounts akm-create-access-key iaas-create-key-pair iaas-describe-vnets iaas-describe-vserver-types iaas-describe-server-templates Username Password Production:Create|vServer iaas-run-vserver vServer Name vServer Type Name Template Name Comma separated list of network names which the vServer will connect to. Comma separated list of IPs for the specified networks. Production:Create|Volume iaas-create-volume Volume Name Volume Size Production:Attach|Volume iaas-attach-volumes-to-vserver vServer Name Comma separated list of volume names Production:Disconnect iaas-delete-key-pair akm-delete-access-key None connectToAccount() It can be seen from the connectToAccount function that before we can execute any Asset creation we must first connect to the appropriate account. To do this we will need the ID associated with the Account. This can be found by executing the akm-describe-accounts cli command which will return a list of all Accounts and there IDs. Once we have the Account ID we generate and Access key using the akm-create-access-key command and then a keypair with the iaas-create-key-pair command. At this point we now have all the information we need to access the specific named account. createVServer() This function simply retrieved the information from the input line and then will create the vServer using the iaas-run-vserver cli command. Reading the function you will notice that it takes the various input names for vServer Type, Template and Networks and converts them into the appropriate IDs. The IaaS cli will not work directly with component names and hence all IDs need to be found. createVolume() Function that simply takes the Volume name and Size then executes the iaas-create-volume command to create the volume. attachVolume() Takes the name of the Volume, which we may have just created, and a Volume then identifies the appropriate IDs before assigning the Volume to the vServer with the iaas-attach-volumes-to-vserver. disconnectFromAccount() Once we have finished connecting to the Account we simply remove the key pair with iaas-delete-key-pair and the access key with akm-delete-access-key although it may be useful to keep this if ssh is required and you do not subsequently modify the sshd information to allow unsecured access. By default the key is required for ssh access when a vServer is created from the command-line. CreateAssets.sh 1 export OCCLI=/opt/sun/occli/bin 2 export IAAS_HOME=/opt/oracle/iaas/cli 3 export JAVA_HOME=/usr/java/latest 4 export IAAS_BASE_URL=https://127.0.0.1 5 export IAAS_ACCESS_KEY_FILE=iaas_access.key 6 export KEY_FILE=iaas_access.pub 7 #CloudUser used to create vServers & Volumes 8 export IAAS_USER=exaprod 9 export IAAS_PASSWORD_FILE=root.pwd 10 export KEY_NAME=cli.recreate 11 export INPUT_FILE=CreateAssets.in 12 13 export ACCOUNTS_FILE=accounts.out 14 export VOLUMES_FILE=volumes.out 15 export DISTGRPS_FILE=distgrp.out 16 export VNETS_FILE=vnets.out 17 export VSERVER_TYPES_FILE=vstype.out 18 export VSERVER_FILE=vserver.out 19 export VSERVER_TEMPLATES=template.out 20 export KEY_PAIRS=keypairs.out 21 22 PROCESSING_ACCOUNT="" 23 24 function cleanTempFiles() { 25 rm -f $ACCOUNTS_FILE $VOLUMES_FILE $DISTGRPS_FILE $VNETS_FILE $VSERVER_TYPES_FILE $VSERVER_FILE $VSERVER_TEMPLATES $KEY_PAIRS $IAAS_PASSWORD_FILE $KEY_FILE $IAAS_ACCESS_KEY_FILE 26 } 27 28 function connectToAccount() { 29 if [[ "$ACCOUNT" != "$PROCESSING_ACCOUNT" ]] 30 then 31 if [[ "" != "$PROCESSING_ACCOUNT" ]] 32 then 33 $IAAS_HOME/bin/iaas-delete-key-pair --key-name $KEY_NAME --access-key-file $IAAS_ACCESS_KEY_FILE 34 $IAAS_HOME/bin/akm-delete-access-key $AK 35 fi 36 PROCESSING_ACCOUNT=$ACCOUNT 37 IAAS_USER=$ACCOUNT_USER 38 echo "$ACCOUNT_PASSWORD" > $IAAS_PASSWORD_FILE 39 $IAAS_HOME/bin/akm-describe-accounts --sep "|" > $ACCOUNTS_FILE 40 while read line 41 do 42 ACCOUNT_ID=${line%%|*} 43 line=${line#*|} 44 ACCOUNT_NAME=${line%%|*} 45 # echo "Id = $ACCOUNT_ID" 46 # echo "Name = $ACCOUNT_NAME" 47 if [[ "$ACCOUNT_NAME" == "$ACCOUNT" ]] 48 then 49 echo "Found Production Account $line" 50 AK=`$IAAS_HOME/bin/akm-create-access-key --account $ACCOUNT_ID --access-key-file $IAAS_ACCESS_KEY_FILE` 51 KEYPAIR=`$IAAS_HOME/bin/iaas-create-key-pair --key-name $KEY_NAME --key-file $KEY_FILE` 52 echo "Connected to $ACCOUNT_NAME" 53 break 54 fi 55 done < $ACCOUNTS_FILE 56 fi 57 } 58 59 function disconnectFromAccount() { 60 $IAAS_HOME/bin/iaas-delete-key-pair --key-name $KEY_NAME --access-key-file $IAAS_ACCESS_KEY_FILE 61 $IAAS_HOME/bin/akm-delete-access-key $AK 62 PROCESSING_ACCOUNT="" 63 } 64 65 function getNetworks() { 66 $IAAS_HOME/bin/iaas-describe-vnets --sep "|" > $VNETS_FILE 67 } 68 69 function getVSTypes() { 70 $IAAS_HOME/bin/iaas-describe-vserver-types --sep "|" > $VSERVER_TYPES_FILE 71 } 72 73 function getTemplates() { 74 $IAAS_HOME/bin/iaas-describe-server-templates --sep "|" > $VSERVER_TEMPLATES 75 } 76 77 function getVolumes() { 78 $IAAS_HOME/bin/iaas-describe-volumes --sep "|" > $VOLUMES_FILE 79 } 80 81 function getVServers() { 82 $IAAS_HOME/bin/iaas-describe-vservers --sep "|" > $VSERVER_FILE 83 } 84 85 function getNetworkId() { 86 while read line 87 do 88 NETWORK_ID=${line%%|*} 89 line=${line#*|} 90 NAME=${line%%|*} 91 if [[ "$NAME" == "$NETWORK_NAME" ]] 92 then 93 break 94 fi 95 done < $VNETS_FILE 96 } 97 98 function getVSTypeId() { 99 while read line 100 do 101 VSTYPE_ID=${line%%|*} 102 line=${line#*|} 103 NAME=${line%%|*} 104 if [[ "$VSTYPE_NAME" == "$NAME" ]] 105 then 106 break 107 fi 108 done < $VSERVER_TYPES_FILE 109 } 110 111 function getTemplateId() { 112 while read line 113 do 114 TEMPLATE_ID=${line%%|*} 115 line=${line#*|} 116 NAME=${line%%|*} 117 if [[ "$TEMPLATE_NAME" == "$NAME" ]] 118 then 119 break 120 fi 121 done < $VSERVER_TEMPLATES 122 } 123 124 function getVolumeId() { 125 while read line 126 do 127 export VOLUME_ID=${line%%|*} 128 line=${line#*|} 129 NAME=${line%%|*} 130 if [[ "$NAME" == "$VOLUME_NAME" ]] 131 then 132 break; 133 fi 134 done < $VOLUMES_FILE 135 } 136 137 function getVServerId() { 138 while read line 139 do 140 VSERVER_ID=${line%%|*} 141 line=${line#*|} 142 NAME=${line%%|*} 143 if [[ "$VSERVER_NAME" == "$NAME" ]] 144 then 145 break; 146 fi 147 done < $VSERVER_FILE 148 } 149 150 function getVServerState() { 151 getVServers 152 while read line 153 do 154 VSERVER_ID=${line%%|*} 155 line=${line#*|} 156 NAME=${line%%|*} 157 line=${line#*|} 158 line=${line#*|} 159 VSERVER_STATE=${line%%|*} 160 if [[ "$VSERVER_NAME" == "$NAME" ]] 161 then 162 break; 163 fi 164 done < $VSERVER_FILE 165 } 166 167 function pauseUntilVServerRunning() { 168 # Wait until the Server is running before creating the next 169 getVServerState 170 while [[ "$VSERVER_STATE" != "RUNNING" ]] 171 do 172 getVServerState 173 echo "$NAME $VSERVER_STATE" 174 if [[ "$VSERVER_STATE" != "RUNNING" ]] 175 then 176 echo "Sleeping......." 177 sleep 60 178 fi 179 if [[ "$VSERVER_STATE" == "FAILED" ]] 180 then 181 echo "Will Delete $NAME in 5 Minutes....." 182 sleep 300 183 deleteVServer 184 echo "Deleted $NAME waiting 5 Minutes....." 185 sleep 300 186 break 187 fi 188 done 189 # Lets pause for a minute or two 190 echo "Just Chilling......" 191 sleep 60 192 echo "Ahhhhh we're getting there......." 193 sleep 60 194 echo "I'm almost at one with the universe......." 195 sleep 60 196 echo "Bong Reality Check !" 197 } 198 199 function deleteVServer() { 200 $IAAS_HOME/bin/iaas-terminate-vservers --force --vserver-ids $VSERVER_ID 201 } 202 203 function createVServer() { 204 VSERVER_NAME=${ASSET_DETAILS%%|*} 205 ASSET_DETAILS=${ASSET_DETAILS#*|} 206 VSTYPE_NAME=${ASSET_DETAILS%%|*} 207 ASSET_DETAILS=${ASSET_DETAILS#*|} 208 TEMPLATE_NAME=${ASSET_DETAILS%%|*} 209 ASSET_DETAILS=${ASSET_DETAILS#*|} 210 NETWORK_NAMES=${ASSET_DETAILS%%|*} 211 ASSET_DETAILS=${ASSET_DETAILS#*|} 212 IP_ADDRESSES=${ASSET_DETAILS%%|*} 213 # Get Ids associated with names 214 getVSTypeId 215 getTemplateId 216 # Convert Network Names to Ids 217 NETWORK_IDS="" 218 while true 219 do 220 NETWORK_NAME=${NETWORK_NAMES%%,*} 221 NETWORK_NAMES=${NETWORK_NAMES#*,} 222 getNetworkId 223 if [[ "$NETWORK_IDS" != "" ]] 224 then 225 NETWORK_IDS="$NETWORK_IDS,$NETWORK_ID" 226 else 227 NETWORK_IDS=$NETWORK_ID 228 fi 229 if [[ "$NETWORK_NAME" == "$NETWORK_NAMES" ]] 230 then 231 break 232 fi 233 done 234 # Create vServer 235 echo "About to execute : $IAAS_HOME/bin/iaas-run-vserver --name $VSERVER_NAME --key-name $KEY_NAME --vserver-type $VSTYPE_ID --server-template-id $TEMPLATE_ID --vnets $NETWORK_IDS --ip-addresses $IP_ADDRESSES" 236 $IAAS_HOME/bin/iaas-run-vserver --name $VSERVER_NAME --key-name $KEY_NAME --vserver-type $VSTYPE_ID --server-template-id $TEMPLATE_ID --vnets $NETWORK_IDS --ip-addresses $IP_ADDRESSES 237 pauseUntilVServerRunning 238 } 239 240 function createVolume() { 241 VOLUME_NAME=${ASSET_DETAILS%%|*} 242 ASSET_DETAILS=${ASSET_DETAILS#*|} 243 VOLUME_SIZE=${ASSET_DETAILS%%|*} 244 # Create Volume 245 echo "About to execute : $IAAS_HOME/bin/iaas-create-volume --name $VOLUME_NAME --size $VOLUME_SIZE" 246 $IAAS_HOME/bin/iaas-create-volume --name $VOLUME_NAME --size $VOLUME_SIZE 247 # Lets pause 248 echo "Just Waiting 30 Seconds......" 249 sleep 30 250 } 251 252 function attachVolume() { 253 VSERVER_NAME=${ASSET_DETAILS%%|*} 254 ASSET_DETAILS=${ASSET_DETAILS#*|} 255 VOLUME_NAMES=${ASSET_DETAILS%%|*} 256 # Get vServer Id 257 getVServerId 258 # Convert Volume Names to Ids 259 VOLUME_IDS="" 260 while true 261 do 262 VOLUME_NAME=${VOLUME_NAMES%%,*} 263 VOLUME_NAMES=${VOLUME_NAMES#*,} 264 getVolumeId 265 if [[ "$VOLUME_IDS" != "" ]] 266 then 267 VOLUME_IDS="$VOLUME_IDS,$VOLUME_ID" 268 else 269 VOLUME_IDS=$VOLUME_ID 270 fi 271 if [[ "$VOLUME_NAME" == "$VOLUME_NAMES" ]] 272 then 273 break 274 fi 275 done 276 # Attach Volumes 277 echo "About to execute : $IAAS_HOME/bin/iaas-attach-volumes-to-vserver --vserver-id $VSERVER_ID --volume-ids $VOLUME_IDS" 278 $IAAS_HOME/bin/iaas-attach-volumes-to-vserver --vserver-id $VSERVER_ID --volume-ids $VOLUME_IDS 279 # Lets pause 280 echo "Just Waiting 30 Seconds......" 281 sleep 30 282 } 283 284 function processAssets() { 285 while read line 286 do 287 ACCOUNT=${line%%:*} 288 line=${line#*:} 289 ACTION=${line%%|*} 290 line=${line#*|} 291 if [[ "$ACTION" == "Connect" ]] 292 then 293 ACCOUNT_USER=${line%%|*} 294 line=${line#*|} 295 ACCOUNT_PASSWORD=${line%%|*} 296 connectToAccount 297 298 ## Account Info 299 getNetworks 300 getVSTypes 301 getTemplates 302 303 continue 304 fi 305 if [[ "$ACTION" == "Create" ]] 306 then 307 ASSET=${line%%|*} 308 line=${line#*|} 309 ASSET_DETAILS=$line 310 if [[ "$ASSET" == "vServer" ]] 311 then 312 createVServer 313 314 continue 315 fi 316 if [[ "$ASSET" == "Volume" ]] 317 then 318 createVolume 319 320 continue 321 fi 322 fi 323 if [[ "$ACTION" == "Attach" ]] 324 then 325 ASSET=${line%%|*} 326 line=${line#*|} 327 ASSET_DETAILS=$line 328 if [[ "$ASSET" == "Volume" ]] 329 then 330 getVolumes 331 getVServers 332 attachVolume 333 334 continue 335 fi 336 fi 337 if [[ "$ACTION" == "Connect" ]] 338 then 339 disconnectFromAccount 340 341 continue 342 fi 343 done < $INPUT_FILE 344 } 345 346 # Should Parameterise this 347 348 while [ $# -gt 0 ] 349 do 350 case "$1" in 351 -a) INPUT_FILE="$2"; shift;; 352 *) echo ""; echo >&2 \ 353 "usage: $0 [-a <Asset Definition File>] (Default is CreateAssets.in)" 354 echo""; exit 1;; 355 *) break;; 356 esac 357 shift 358 done 359 360 361 362 363 processAssets 364 365 echo "**************************************" 366 echo "***** Finished Creating Assets *****" 367 echo "**************************************" 368 CreateAssetsProd.in Production:Connect|exaprod|welcome1 Production:Create|vServer|VS006|VSTProduction|BaseOEL56ServerTemplate|EoIB-otd-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.223.13,192.168.0.13,10.117.81.67,172.17.0.14 Production:Create|vServer|VS007|VSTProduction|BaseOEL56ServerTemplate|EoIB-otd-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.223.14,192.168.0.14,10.117.81.68,172.17.0.15 Production:Create|vServer|VS008|VSTProduction|BaseOEL56ServerTemplate|EoIB-wls-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.225.61,192.168.0.61,10.117.81.61,172.17.0.16 Production:Create|vServer|VS009|VSTProduction|BaseOEL56ServerTemplate|EoIB-wls-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.225.62,192.168.0.62,10.117.81.62,172.17.0.17 Production:Create|vServer|VS000|VSTProduction|BaseOEL56ServerTemplate|EoIB-wls-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.225.63,192.168.0.63,10.117.81.63,172.17.0.18 Production:Create|vServer|VS001|VSTProduction|BaseOEL56ServerTemplate|EoIB-wls-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.225.64,192.168.0.64,10.117.81.64,172.17.0.19 Production:Create|vServer|VS002|VSTProduction|BaseOEL56ServerTemplate|EoIB-wls-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.225.65,192.168.0.65,10.117.81.65,172.17.0.20 Production:Create|vServer|VS003|VSTProduction|BaseOEL56ServerTemplate|EoIB-wls-prod,vn-prod-web,IPoIB-default,IPoIB-vserver-shared-storage|10.51.225.66,192.168.0.66,10.117.81.66,172.17.0.21 Production:Create|Volume|VS006|50 Production:Create|Volume|VS007|50 Production:Create|Volume|VS008|50 Production:Create|Volume|VS009|50 Production:Create|Volume|VS000|50 Production:Create|Volume|VS001|50 Production:Create|Volume|VS002|50 Production:Create|Volume|VS003|50 Production:Attach|Volume|VS006|VS006 Production:Attach|Volume|VS007|VS007 Production:Attach|Volume|VS008|VS008 Production:Attach|Volume|VS009|VS009 Production:Attach|Volume|VS000|VS000 Production:Attach|Volume|VS001|VS001 Production:Attach|Volume|VS002|VS002 Production:Attach|Volume|VS003|VS003 Production:Disconnect Development:Connect|exadev|welcome1 Development:Create|vServer|VS014|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.24,10.117.81.71,172.17.0.24 Development:Create|vServer|VS015|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.25,10.117.81.72,172.17.0.25 Development:Create|vServer|VS016|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.26,10.117.81.73,172.17.0.26 Development:Create|vServer|VS017|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.27,10.117.81.74,172.17.0.27 Development:Create|vServer|VS018|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.28,10.117.81.75,172.17.0.28 Development:Create|vServer|VS019|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.29,10.117.81.76,172.17.0.29 Development:Create|vServer|VS020|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.30,10.117.81.77,172.17.0.30 Development:Create|vServer|VS021|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.31,10.117.81.78,172.17.0.31 Development:Create|vServer|VS022|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.32,10.117.81.79,172.17.0.32 Development:Create|vServer|VS023|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.33,10.117.81.80,172.17.0.33 Development:Create|vServer|VS024|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.34,10.117.81.81,172.17.0.34 Development:Create|vServer|VS025|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.35,10.117.81.82,172.17.0.35 Development:Create|vServer|VS026|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.36,10.117.81.83,172.17.0.36 Development:Create|vServer|VS027|VSTDevelopment|BaseOEL56ServerTemplate|EoIB-development,IPoIB-default,IPoIB-vserver-shared-storage|10.51.224.37,10.117.81.84,172.17.0.37 Development:Create|Volume|VS014|50 Development:Create|Volume|VS015|50 Development:Create|Volume|VS016|50 Development:Create|Volume|VS017|50 Development:Create|Volume|VS018|50 Development:Create|Volume|VS019|50 Development:Create|Volume|VS020|50 Development:Create|Volume|VS021|50 Development:Create|Volume|VS022|50 Development:Create|Volume|VS023|50 Development:Create|Volume|VS024|50 Development:Create|Volume|VS025|50 Development:Create|Volume|VS026|50 Development:Create|Volume|VS027|50 Development:Attach|Volume|VS014|VS014 Development:Attach|Volume|VS015|VS015 Development:Attach|Volume|VS016|VS016 Development:Attach|Volume|VS017|VS017 Development:Attach|Volume|VS018|VS018 Development:Attach|Volume|VS019|VS019 Development:Attach|Volume|VS020|VS020 Development:Attach|Volume|VS021|VS021 Development:Attach|Volume|VS022|VS022 Development:Attach|Volume|VS023|VS023 Development:Attach|Volume|VS024|VS024 Development:Attach|Volume|VS025|VS025 Development:Attach|Volume|VS026|VS026 Development:Attach|Volume|VS027|VS027 Development:Disconnect This entry was originally posted on the The Old Toxophilist Site.

    Read the article

  • When I shutdown the computer, it restarts

    - by Prabu
    I am unable to shutdown. Whenever I try to shutdown, it reboots. I am running Ubuntu 12.10. I have run the boot-repair and this is the result: Boot Info Script 0.61.full + Boot-Repair extra info [Boot-Info November 20th 2012] ============================= Boot Info Summary: =============================== => Grub2 (v2.00) is installed in the MBR of /dev/sda and looks at sector 1 of the same hard drive for core.img. core.img is at this location and looks in partition 1 for (,msdos1)/boot/grub. sda1: __________________________________________________________________________ File system: ext4 Boot sector type: - Boot sector info: Operating System: Ubuntu 12.10 Boot files: /boot/grub/grub.cfg /etc/fstab /boot/grub/i386-pc/core.img sda2: __________________________________________________________________________ File system: Extended Partition Boot sector type: - Boot sector info: sda5: __________________________________________________________________________ File system: swap Boot sector type: - Boot sector info: ============================ Drive/Partition Info: ============================= Drive: sda _____________________________________________________________________ Disk /dev/sda: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 4096 bytes Partition Boot Start Sector End Sector # of Sectors Id System /dev/sda1 * 2,048 1,936,809,983 1,936,807,936 83 Linux /dev/sda2 1,936,812,030 1,953,523,711 16,711,682 5 Extended /dev/sda5 1,936,812,032 1,953,523,711 16,711,680 82 Linux swap / Solaris "blkid" output: ________________________________________________________________ Device UUID TYPE LABEL /dev/loop0 squashfs /dev/sda1 229a5484-7659-4ce1-98ce-2f05f61a1ffa ext4 /dev/sda5 6c6dca25-ab67-4de4-8602-26fdb6154781 swap /dev/sr0 iso9660 Ubuntu 12.10 amd64 ================================ Mount points: ================================= Device Mount_Point Type Options /dev/loop0 /rofs squashfs (ro,noatime) /dev/sr0 /cdrom iso9660 (ro,noatime) =========================== sda1/boot/grub/grub.cfg: =========================== -------------------------------------------------------------------------------- # # DO NOT EDIT THIS FILE # # It is automatically generated by grub-mkconfig using templates # from /etc/grub.d and settings from /etc/default/grub # ### BEGIN /etc/grub.d/00_header ### if [ -s $prefix/grubenv ]; then set have_grubenv=true load_env fi set default="0" if [ x"${feature_menuentry_id}" = xy ]; then menuentry_id_option="--id" else menuentry_id_option="" fi export menuentry_id_option if [ "${prev_saved_entry}" ]; then set saved_entry="${prev_saved_entry}" save_env saved_entry set prev_saved_entry= save_env prev_saved_entry set boot_once=true fi function savedefault { if [ -z "${boot_once}" ]; then saved_entry="${chosen}" save_env saved_entry fi } function recordfail { set recordfail=1 if [ -n "${have_grubenv}" ]; then if [ -z "${boot_once}" ]; then save_env recordfail; fi; fi } function load_video { if [ x$feature_all_video_module = xy ]; then insmod all_video else insmod efi_gop insmod efi_uga insmod ieee1275_fb insmod vbe insmod vga insmod video_bochs insmod video_cirrus fi } if [ x$feature_default_font_path = xy ] ; then font=unicode else insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi font="/usr/share/grub/unicode.pf2" fi if loadfont $font ; then set gfxmode=auto load_video insmod gfxterm set locale_dir=$prefix/locale set lang=en_US insmod gettext fi terminal_output gfxterm if [ "${recordfail}" = 1 ]; then set timeout=10 else set timeout=10 fi ### END /etc/grub.d/00_header ### ### BEGIN /etc/grub.d/05_debian_theme ### set menu_color_normal=white/black set menu_color_highlight=black/light-gray if background_color 44,0,30; then clear fi ### END /etc/grub.d/05_debian_theme ### ### BEGIN /etc/grub.d/10_linux ### function gfxmode { set gfxpayload="${1}" if [ "${1}" = "keep" ]; then set vt_handoff=vt.handoff=7 else set vt_handoff= fi } if [ "${recordfail}" != 1 ]; then if [ -e ${prefix}/gfxblacklist.txt ]; then if hwmatch ${prefix}/gfxblacklist.txt 3; then if [ ${match} = 0 ]; then set linux_gfx_mode=keep else set linux_gfx_mode=text fi else set linux_gfx_mode=text fi else set linux_gfx_mode=keep fi else set linux_gfx_mode=text fi export linux_gfx_mode if [ "${linux_gfx_mode}" != "text" ]; then load_video; fi menuentry 'Ubuntu' --class ubuntu --class gnu-linux --class gnu --class os $menuentry_id_option 'gnulinux-simple-229a5484-7659-4ce1-98ce-2f05f61a1ffa' { recordfail gfxmode $linux_gfx_mode insmod gzio insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi linux /boot/vmlinuz-3.5.0-19-generic root=UUID=229a5484-7659-4ce1-98ce-2f05f61a1ffa ro quiet splash acpi=force $vt_handoff initrd /boot/initrd.img-3.5.0-19-generic } submenu 'Advanced options for Ubuntu' $menuentry_id_option 'gnulinux-advanced-229a5484-7659-4ce1-98ce-2f05f61a1ffa' { menuentry 'Ubuntu, with Linux 3.5.0-19-generic' --class ubuntu --class gnu-linux --class gnu --class os $menuentry_id_option 'gnulinux-3.5.0-19-generic-advanced-229a5484-7659-4ce1-98ce-2f05f61a1ffa' { recordfail gfxmode $linux_gfx_mode insmod gzio insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi echo 'Loading Linux 3.5.0-19-generic ...' linux /boot/vmlinuz-3.5.0-19-generic root=UUID=229a5484-7659-4ce1-98ce-2f05f61a1ffa ro quiet splash acpi=force $vt_handoff echo 'Loading initial ramdisk ...' initrd /boot/initrd.img-3.5.0-19-generic } menuentry 'Ubuntu, with Linux 3.5.0-19-generic (recovery mode)' --class ubuntu --class gnu-linux --class gnu --class os $menuentry_id_option 'gnulinux-3.5.0-19-generic-recovery-229a5484-7659-4ce1-98ce-2f05f61a1ffa' { recordfail insmod gzio insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi echo 'Loading Linux 3.5.0-19-generic ...' linux /boot/vmlinuz-3.5.0-19-generic root=UUID=229a5484-7659-4ce1-98ce-2f05f61a1ffa ro recovery nomodeset echo 'Loading initial ramdisk ...' initrd /boot/initrd.img-3.5.0-19-generic } menuentry 'Ubuntu, with Linux 3.5.0-17-generic' --class ubuntu --class gnu-linux --class gnu --class os $menuentry_id_option 'gnulinux-3.5.0-17-generic-advanced-229a5484-7659-4ce1-98ce-2f05f61a1ffa' { recordfail gfxmode $linux_gfx_mode insmod gzio insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi echo 'Loading Linux 3.5.0-17-generic ...' linux /boot/vmlinuz-3.5.0-17-generic root=UUID=229a5484-7659-4ce1-98ce-2f05f61a1ffa ro quiet splash acpi=force $vt_handoff echo 'Loading initial ramdisk ...' initrd /boot/initrd.img-3.5.0-17-generic } menuentry 'Ubuntu, with Linux 3.5.0-17-generic (recovery mode)' --class ubuntu --class gnu-linux --class gnu --class os $menuentry_id_option 'gnulinux-3.5.0-17-generic-recovery-229a5484-7659-4ce1-98ce-2f05f61a1ffa' { recordfail insmod gzio insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi echo 'Loading Linux 3.5.0-17-generic ...' linux /boot/vmlinuz-3.5.0-17-generic root=UUID=229a5484-7659-4ce1-98ce-2f05f61a1ffa ro recovery nomodeset echo 'Loading initial ramdisk ...' initrd /boot/initrd.img-3.5.0-17-generic } } ### END /etc/grub.d/10_linux ### ### BEGIN /etc/grub.d/20_linux_xen ### ### END /etc/grub.d/20_linux_xen ### ### BEGIN /etc/grub.d/20_memtest86+ ### menuentry "Memory test (memtest86+)" { insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi linux16 /boot/memtest86+.bin } menuentry "Memory test (memtest86+, serial console 115200)" { insmod part_msdos insmod ext2 set root='hd0,msdos1' if [ x$feature_platform_search_hint = xy ]; then search --no-floppy --fs-uuid --set=root --hint-bios=hd0,msdos1 --hint-efi=hd0,msdos1 --hint-baremetal=ahci0,msdos1 229a5484-7659-4ce1-98ce-2f05f61a1ffa else search --no-floppy --fs-uuid --set=root 229a5484-7659-4ce1-98ce-2f05f61a1ffa fi linux16 /boot/memtest86+.bin console=ttyS0,115200n8 } ### END /etc/grub.d/20_memtest86+ ### ### BEGIN /etc/grub.d/30_os-prober ### ### END /etc/grub.d/30_os-prober ### ### BEGIN /etc/grub.d/30_uefi-firmware ### ### END /etc/grub.d/30_uefi-firmware ### ### BEGIN /etc/grub.d/40_custom ### # This file provides an easy way to add custom menu entries. Simply type the # menu entries you want to add after this comment. Be careful not to change # the 'exec tail' line above. ### END /etc/grub.d/40_custom ### ### BEGIN /etc/grub.d/41_custom ### if [ -f ${config_directory}/custom.cfg ]; then source ${config_directory}/custom.cfg elif [ -z "${config_directory}" -a -f $prefix/custom.cfg ]; then source $prefix/custom.cfg; fi ### END /etc/grub.d/41_custom ### -------------------------------------------------------------------------------- =============================== sda1/etc/fstab: ================================ -------------------------------------------------------------------------------- # /etc/fstab: static file system information. # # Use 'blkid' to print the universally unique identifier for a # device; this may be used with UUID= as a more robust way to name devices # that works even if disks are added and removed. See fstab(5). # # <file system> <mount point> <type> <options> <dump> <pass> # / was on /dev/sda1 during installation UUID=229a5484-7659-4ce1-98ce-2f05f61a1ffa / ext4 errors=remount-ro 0 1 # swap was on /dev/sda5 during installation UUID=6c6dca25-ab67-4de4-8602-26fdb6154781 none swap sw 0 0 -------------------------------------------------------------------------------- =================== sda1: Location of files loaded by Grub: ==================== GiB - GB File Fragment(s) 200.155235291 = 214.915047424 boot/grub/grub.cfg 1 40.280788422 = 43.251167232 boot/initrd.img-3.5.0-17-generic 1 2.468288422 = 2.650304512 boot/initrd.img-3.5.0-19-generic 1 200.149234772 = 214.908604416 boot/vmlinuz-3.5.0-17-generic 1 1.990135193 = 2.136891392 boot/vmlinuz-3.5.0-19-generic 1 2.468288422 = 2.650304512 initrd.img 1 1.990135193 = 2.136891392 vmlinuz 1 1.990135193 = 2.136891392 vmlinuz.old 1 =============================== StdErr Messages: =============================== cat: write error: Broken pipe File descriptor 8 (/proc/6297/mounts) leaked on lvscan invocation. Parent PID 13390: bash No volume groups found ADDITIONAL INFORMATION : =================== log of boot-repair 2012-12-17__01h53 =================== boot-repair version : 3.197~ppa1~quantal boot-sav version : 3.197~ppa1~quantal glade2script version : 3.2.2~ppa45~quantal boot-sav-extra version : 3.197~ppa1~quantal boot-repair is executed in live-session (Ubuntu 12.10, quantal, Ubuntu, x86_64) CPU op-mode(s): 32-bit, 64-bit file=/cdrom/preseed/ubuntu.seed boot=casper initrd=/casper/initrd.lz quiet splash -- maybe-ubiquity =================== os-prober: /dev/sda1:Ubuntu 12.10 (12.10):Ubuntu:linux =================== blkid: /dev/loop0: TYPE="squashfs" /dev/sr0: LABEL="Ubuntu 12.10 amd64" TYPE="iso9660" /dev/sda1: UUID="229a5484-7659-4ce1-98ce-2f05f61a1ffa" TYPE="ext4" /dev/sda5: UUID="6c6dca25-ab67-4de4-8602-26fdb6154781" TYPE="swap" 1 disks with OS, 1 OS : 1 Linux, 0 MacOS, 0 Windows, 0 unknown type OS. Warning: extended partition does not start at a cylinder boundary. DOS and Linux will interpret the contents differently. =================== sda1/etc/default/grub : # If you change this file, run 'update-grub' afterwards to update # /boot/grub/grub.cfg. # For full documentation of the options in this file, see: # info -f grub -n 'Simple configuration' GRUB_DEFAULT=0 GRUB_HIDDEN_TIMEOUT=0 GRUB_HIDDEN_TIMEOUT_QUIET=true GRUB_TIMEOUT=10 GRUB_DISTRIBUTOR=`lsb_release -i -s 2> /dev/null || echo Debian` GRUB_CMDLINE_LINUX_DEFAULT="quiet splash acpi=force" GRUB_CMDLINE_LINUX="" # Uncomment to enable BadRAM filtering, modify to suit your needs # This works with Linux (no patch required) and with any kernel that obtains # the memory map information from GRUB (GNU Mach, kernel of FreeBSD ...) #GRUB_BADRAM="0x01234567,0xfefefefe,0x89abcdef,0xefefefef" # Uncomment to disable graphical terminal (grub-pc only) #GRUB_TERMINAL=console # The resolution used on graphical terminal # note that you can use only modes which your graphic card supports via VBE # you can see them in real GRUB with the command `vbeinfo' #GRUB_GFXMODE=640x480 # Uncomment if you don't want GRUB to pass "root=UUID=xxx" parameter to Linux #GRUB_DISABLE_LINUX_UUID=true # Uncomment to disable generation of recovery mode menu entries #GRUB_DISABLE_RECOVERY="true" # Uncomment to get a beep at grub start #GRUB_INIT_TUNE="480 440 1" =================== sda1/etc/grub.d/ : drwxr-xr-x 2 root root 4096 Oct 17 14:59 grub.d total 72 -rwxr-xr-x 1 root root 7541 Oct 14 17:36 00_header -rwxr-xr-x 1 root root 5488 Oct 4 09:30 05_debian_theme -rwxr-xr-x 1 root root 10891 Oct 14 17:36 10_linux -rwxr-xr-x 1 root root 10258 Oct 14 17:36 20_linux_xen -rwxr-xr-x 1 root root 1688 Oct 11 14:10 20_memtest86+ -rwxr-xr-x 1 root root 10976 Oct 14 17:36 30_os-prober -rwxr-xr-x 1 root root 1426 Oct 14 17:36 30_uefi-firmware -rwxr-xr-x 1 root root 214 Oct 14 17:36 40_custom -rwxr-xr-x 1 root root 216 Oct 14 17:36 41_custom -rw-r--r-- 1 root root 483 Oct 14 17:36 README =================== UEFI/Legacy mode: This live-session is not in EFI-mode. SecureBoot maybe enabled. =================== PARTITIONS & DISKS: sda1 : sda, not-sepboot, grubenv-ok grub2, grub-pc , update-grub, 64, with-boot, is-os, not--efi--part, fstab-without-boot, fstab-without-efi, no-nt, no-winload, no-recov-nor-hid, no-bmgr, notwinboot, apt-get, grub-install, with--usr, fstab-without-usr, not-sep-usr, standard, farbios, /mnt/boot-sav/sda1. sda : not-GPT, BIOSboot-not-needed, has-no-EFIpart, not-usb, has-os, 2048 sectors * 512 bytes =================== parted -l: Model: ATA ST1000DM003-1CH1 (scsi) Disk /dev/sda: 1000GB Sector size (logical/physical): 512B/4096B Partition Table: msdos Number Start End Size Type File system Flags 1 1049kB 992GB 992GB primary ext4 boot 2 992GB 1000GB 8556MB extended 5 992GB 1000GB 8556MB logical linux-swap(v1) Warning: Unable to open /dev/sr0 read-write (Read-only file system). /dev/sr0 has been opened read-only. Error: Can't have a partition outside the disk! =================== parted -lm: BYT; /dev/sda:1000GB:scsi:512:4096:msdos:ATA ST1000DM003-1CH1; 1:1049kB:992GB:992GB:ext4::boot; 2:992GB:1000GB:8556MB:::; 5:992GB:1000GB:8556MB:linux-swap(v1)::; Warning: Unable to open /dev/sr0 read-write (Read-only file system). /dev/sr0 has been opened read-only. Error: Can't have a partition outside the disk! =================== mount: /cow on / type overlayfs (rw) proc on /proc type proc (rw,noexec,nosuid,nodev) sysfs on /sys type sysfs (rw,noexec,nosuid,nodev) udev on /dev type devtmpfs (rw,mode=0755) devpts on /dev/pts type devpts (rw,noexec,nosuid,gid=5,mode=0620) tmpfs on /run type tmpfs (rw,noexec,nosuid,size=10%,mode=0755) /dev/sr0 on /cdrom type iso9660 (ro,noatime) /dev/loop0 on /rofs type squashfs (ro,noatime) none on /sys/fs/fuse/connections type fusectl (rw) none on /sys/kernel/debug type debugfs (rw) none on /sys/kernel/security type securityfs (rw) tmpfs on /tmp type tmpfs (rw,nosuid,nodev) none on /run/lock type tmpfs (rw,noexec,nosuid,nodev,size=5242880) none on /run/shm type tmpfs (rw,nosuid,nodev) none on /run/user type tmpfs (rw,noexec,nosuid,nodev,size=104857600,mode=0755) gvfsd-fuse on /run/user/ubuntu/gvfs type fuse.gvfsd-fuse (rw,nosuid,nodev,user=ubuntu) /dev/sda1 on /mnt/boot-sav/sda1 type ext4 (rw) =================== ls: /sys/block/sda (filtered): alignment_offset bdi capability dev device discard_alignment events events_async events_poll_msecs ext_range holders inflight power queue range removable ro sda1 sda2 sda5 size slaves stat subsystem trace uevent /sys/block/sr0 (filtered): alignment_offset bdi capability dev device discard_alignment events events_async events_poll_msecs ext_range holders inflight power queue range removable ro size slaves stat subsystem trace uevent /dev (filtered): alarm ashmem autofs binder block bsg btrfs-control bus cdrom cdrw char console core cpu cpu_dma_latency disk dri dvd dvdrw ecryptfs fb0 fd full fuse fw0 hidraw0 hidraw1 hpet input kmsg kvm log mapper mcelog mei mem net network_latency network_throughput null oldmem port ppp psaux ptmx pts random rfkill rtc rtc0 sda sda1 sda2 sda5 sg0 sg1 shm snapshot snd sr0 stderr stdin stdout uinput urandom usb vga_arbiter vhost-net zero ls /dev/mapper: control =================== df -Th: Filesystem Type Size Used Avail Use% Mounted on /cow overlayfs 3.9G 100M 3.8G 3% / udev devtmpfs 3.9G 12K 3.9G 1% /dev tmpfs tmpfs 1.6G 864K 1.6G 1% /run /dev/sr0 iso9660 763M 763M 0 100% /cdrom /dev/loop0 squashfs 717M 717M 0 100% /rofs tmpfs tmpfs 3.9G 32K 3.9G 1% /tmp none tmpfs 5.0M 4.0K 5.0M 1% /run/lock none tmpfs 3.9G 176K 3.9G 1% /run/shm none tmpfs 100M 52K 100M 1% /run/user /dev/sda1 ext4 910G 26G 838G 3% /mnt/boot-sav/sda1 =================== fdisk -l: Disk /dev/sda: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x000da1e9 Device Boot Start End Blocks Id System /dev/sda1 * 2048 1936809983 968403968 83 Linux /dev/sda2 1936812030 1953523711 8355841 5 Extended Partition 2 does not start on physical sector boundary. /dev/sda5 1936812032 1953523711 8355840 82 Linux swap / Solaris Partition outside the disk detected. =================== Recommended repair Recommended-Repair This setting will reinstall the grub2 of sda1 into the MBR of sda. Additional repair will be performed: unhide-bootmenu-10s Unhide GRUB boot menu in sda1/etc/default/grub grub-install (GRUB) 2.00-7ubuntu11,grub-install (GRUB) 2. Reinstall the GRUB of sda1 into the MBR of sda Installation finished. No error reported. grub-install /dev/sda: exit code of grub-install /dev/sda:0 chroot /mnt/boot-sav/sda1 update-grub Generating grub.cfg ... Found linux image: /boot/vmlinuz-3.5.0-19-generic Found initrd image: /boot/initrd.img-3.5.0-19-generic Found linux image: /boot/vmlinuz-3.5.0-17-generic Found initrd image: /boot/initrd.img-3.5.0-17-generic Found memtest86+ image: /boot/memtest86+.bin Unhide GRUB boot menu in sda1/boot/grub/grub.cfg Boot successfully repaired. You can now reboot your computer.

    Read the article

  • Wireless card power management

    - by penner
    I have noticed that when my computer in plugged in, the wireless strength increases. I'm assuming this is to do with power management. Is there a way to disable Wireless Power Management? I have found a few blog posts that show hacks to disable this but what is best practice here? Should there not be an option via the power menu that lets you toggle this? EDIT -- FILES AND LOGS AS REQUESTED /var/log/kern.log Jul 11 11:45:27 CoolBreeze kernel: [ 6.528052] postgres (1308): /proc/1308/oom_adj is deprecated, please use /proc/1308/oom_score_adj instead. Jul 11 11:45:27 CoolBreeze kernel: [ 6.532080] [fglrx] Gart USWC size:1280 M. Jul 11 11:45:27 CoolBreeze kernel: [ 6.532084] [fglrx] Gart cacheable size:508 M. Jul 11 11:45:27 CoolBreeze kernel: [ 6.532091] [fglrx] Reserved FB block: Shared offset:0, size:1000000 Jul 11 11:45:27 CoolBreeze kernel: [ 6.532094] [fglrx] Reserved FB block: Unshared offset:f8fd000, size:403000 Jul 11 11:45:27 CoolBreeze kernel: [ 6.532098] [fglrx] Reserved FB block: Unshared offset:3fff4000, size:c000 Jul 11 11:45:38 CoolBreeze kernel: [ 17.423743] eth1: no IPv6 routers present Jul 11 11:46:37 CoolBreeze kernel: [ 75.836426] warning: `proftpd' uses 32-bit capabilities (legacy support in use) Jul 11 11:46:37 CoolBreeze kernel: [ 75.884215] init: plymouth-stop pre-start process (2922) terminated with status 1 Jul 11 11:54:25 CoolBreeze kernel: [ 543.679614] eth1: no IPv6 routers present dmesg [ 1.411959] ACPI: Power Button [PWRB] [ 1.412046] input: Sleep Button as /devices/LNXSYSTM:00/device:00/PNP0C0E:00/input/input1 [ 1.412054] ACPI: Sleep Button [SLPB] [ 1.412150] input: Lid Switch as /devices/LNXSYSTM:00/device:00/PNP0C0D:00/input/input2 [ 1.412765] ACPI: Lid Switch [LID0] [ 1.412866] input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input3 [ 1.412874] ACPI: Power Button [PWRF] [ 1.412996] ACPI: Fan [FAN0] (off) [ 1.413068] ACPI: Fan [FAN1] (off) [ 1.419493] thermal LNXTHERM:00: registered as thermal_zone0 [ 1.419498] ACPI: Thermal Zone [TZ00] (27 C) [ 1.421913] thermal LNXTHERM:01: registered as thermal_zone1 [ 1.421918] ACPI: Thermal Zone [TZ01] (61 C) [ 1.421971] ACPI: Deprecated procfs I/F for battery is loaded, please retry with CONFIG_ACPI_PROCFS_POWER cleared [ 1.421986] ACPI: Battery Slot [BAT0] (battery present) [ 1.422062] ERST: Table is not found! [ 1.422067] GHES: HEST is not enabled! [ 1.422158] isapnp: Scanning for PnP cards... [ 1.422242] Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled [ 1.434620] ACPI: Battery Slot [BAT0] (battery present) [ 1.736355] Freeing initrd memory: 14352k freed [ 1.777846] isapnp: No Plug & Play device found [ 1.963650] Linux agpgart interface v0.103 [ 1.967148] brd: module loaded [ 1.968866] loop: module loaded [ 1.969134] ahci 0000:00:1f.2: version 3.0 [ 1.969154] ahci 0000:00:1f.2: PCI INT B -> GSI 19 (level, low) -> IRQ 19 [ 1.969226] ahci 0000:00:1f.2: irq 45 for MSI/MSI-X [ 1.969277] ahci: SSS flag set, parallel bus scan disabled [ 1.969320] ahci 0000:00:1f.2: AHCI 0001.0300 32 slots 6 ports 3 Gbps 0x23 impl SATA mode [ 1.969329] ahci 0000:00:1f.2: flags: 64bit ncq sntf stag pm led clo pio slum part ems sxs apst [ 1.969338] ahci 0000:00:1f.2: setting latency timer to 64 [ 1.983340] scsi0 : ahci [ 1.983515] scsi1 : ahci [ 1.983670] scsi2 : ahci [ 1.983829] scsi3 : ahci [ 1.983985] scsi4 : ahci [ 1.984145] scsi5 : ahci [ 1.984270] ata1: SATA max UDMA/133 abar m2048@0xf1005000 port 0xf1005100 irq 45 [ 1.984277] ata2: SATA max UDMA/133 abar m2048@0xf1005000 port 0xf1005180 irq 45 [ 1.984282] ata3: DUMMY [ 1.984285] ata4: DUMMY [ 1.984288] ata5: DUMMY [ 1.984292] ata6: SATA max UDMA/133 abar m2048@0xf1005000 port 0xf1005380 irq 45 [ 1.985150] Fixed MDIO Bus: probed [ 1.985192] tun: Universal TUN/TAP device driver, 1.6 [ 1.985196] tun: (C) 1999-2004 Max Krasnyansky <[email protected]> [ 1.985285] PPP generic driver version 2.4.2 [ 1.985472] ehci_hcd: USB 2.0 'Enhanced' Host Controller (EHCI) Driver [ 1.985507] ehci_hcd 0000:00:1a.0: PCI INT A -> GSI 16 (level, low) -> IRQ 16 [ 1.985534] ehci_hcd 0000:00:1a.0: setting latency timer to 64 [ 1.985541] ehci_hcd 0000:00:1a.0: EHCI Host Controller [ 1.985626] ehci_hcd 0000:00:1a.0: new USB bus registered, assigned bus number 1 [ 1.985666] ehci_hcd 0000:00:1a.0: debug port 2 [ 1.989663] ehci_hcd 0000:00:1a.0: cache line size of 64 is not supported [ 1.989690] ehci_hcd 0000:00:1a.0: irq 16, io mem 0xf1005800 [ 2.002183] ehci_hcd 0000:00:1a.0: USB 2.0 started, EHCI 1.00 [ 2.002447] hub 1-0:1.0: USB hub found [ 2.002455] hub 1-0:1.0: 3 ports detected [ 2.002607] ehci_hcd 0000:00:1d.0: PCI INT A -> GSI 23 (level, low) -> IRQ 23 [ 2.002633] ehci_hcd 0000:00:1d.0: setting latency timer to 64 [ 2.002639] ehci_hcd 0000:00:1d.0: EHCI Host Controller [ 2.002737] ehci_hcd 0000:00:1d.0: new USB bus registered, assigned bus number 2 [ 2.002775] ehci_hcd 0000:00:1d.0: debug port 2 [ 2.006780] ehci_hcd 0000:00:1d.0: cache line size of 64 is not supported [ 2.006806] ehci_hcd 0000:00:1d.0: irq 23, io mem 0xf1005c00 [ 2.022161] ehci_hcd 0000:00:1d.0: USB 2.0 started, EHCI 1.00 [ 2.022401] hub 2-0:1.0: USB hub found [ 2.022409] hub 2-0:1.0: 3 ports detected [ 2.022567] ohci_hcd: USB 1.1 'Open' Host Controller (OHCI) Driver [ 2.022599] uhci_hcd: USB Universal Host Controller Interface driver [ 2.022720] usbcore: registered new interface driver libusual [ 2.022813] i8042: PNP: PS/2 Controller [PNP0303:PS2K,PNP0f13:PS2M] at 0x60,0x64 irq 1,12 [ 2.035831] serio: i8042 KBD port at 0x60,0x64 irq 1 [ 2.035844] serio: i8042 AUX port at 0x60,0x64 irq 12 [ 2.036096] mousedev: PS/2 mouse device common for all mice [ 2.036710] rtc_cmos 00:07: RTC can wake from S4 [ 2.036881] rtc_cmos 00:07: rtc core: registered rtc_cmos as rtc0 [ 2.037143] rtc0: alarms up to one month, y3k, 242 bytes nvram, hpet irqs [ 2.037503] device-mapper: uevent: version 1.0.3 [ 2.037656] device-mapper: ioctl: 4.22.0-ioctl (2011-10-19) initialised: [email protected] [ 2.037725] EISA: Probing bus 0 at eisa.0 [ 2.037729] EISA: Cannot allocate resource for mainboard [ 2.037734] Cannot allocate resource for EISA slot 1 [ 2.037738] Cannot allocate resource for EISA slot 2 [ 2.037741] Cannot allocate resource for EISA slot 3 [ 2.037745] Cannot allocate resource for EISA slot 4 [ 2.037749] Cannot allocate resource for EISA slot 5 [ 2.037753] Cannot allocate resource for EISA slot 6 [ 2.037756] Cannot allocate resource for EISA slot 7 [ 2.037760] Cannot allocate resource for EISA slot 8 [ 2.037764] EISA: Detected 0 cards. [ 2.037782] cpufreq-nforce2: No nForce2 chipset. [ 2.038264] cpuidle: using governor ladder [ 2.039015] cpuidle: using governor menu [ 2.039019] EFI Variables Facility v0.08 2004-May-17 [ 2.040061] TCP cubic registered [ 2.041438] NET: Registered protocol family 10 [ 2.043814] NET: Registered protocol family 17 [ 2.043823] Registering the dns_resolver key type [ 2.044290] input: AT Translated Set 2 keyboard as /devices/platform/i8042/serio0/input/input4 [ 2.044336] Using IPI No-Shortcut mode [ 2.045620] PM: Hibernation image not present or could not be loaded. [ 2.045644] registered taskstats version 1 [ 2.073070] Magic number: 4:976:796 [ 2.073415] rtc_cmos 00:07: setting system clock to 2012-07-11 18:45:23 UTC (1342032323) [ 2.076654] BIOS EDD facility v0.16 2004-Jun-25, 0 devices found [ 2.076658] EDD information not available. [ 2.302111] ata1: SATA link up 3.0 Gbps (SStatus 123 SControl 300) [ 2.302587] ata1.00: ATA-9: M4-CT128M4SSD2, 000F, max UDMA/100 [ 2.302595] ata1.00: 250069680 sectors, multi 16: LBA48 NCQ (depth 31/32), AA [ 2.303143] ata1.00: configured for UDMA/100 [ 2.303453] scsi 0:0:0:0: Direct-Access ATA M4-CT128M4SSD2 000F PQ: 0 ANSI: 5 [ 2.303746] sd 0:0:0:0: Attached scsi generic sg0 type 0 [ 2.303920] sd 0:0:0:0: [sda] 250069680 512-byte logical blocks: (128 GB/119 GiB) [ 2.304213] sd 0:0:0:0: [sda] Write Protect is off [ 2.304225] sd 0:0:0:0: [sda] Mode Sense: 00 3a 00 00 [ 2.304471] sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA [ 2.306818] sda: sda1 sda2 < sda5 > [ 2.308780] sd 0:0:0:0: [sda] Attached SCSI disk [ 2.318162] Refined TSC clocksource calibration: 1595.999 MHz. [ 2.318169] usb 1-1: new high-speed USB device number 2 using ehci_hcd [ 2.318178] Switching to clocksource tsc [ 2.450939] hub 1-1:1.0: USB hub found [ 2.451121] hub 1-1:1.0: 6 ports detected [ 2.561786] usb 2-1: new high-speed USB device number 2 using ehci_hcd [ 2.621757] ata2: SATA link up 1.5 Gbps (SStatus 113 SControl 300) [ 2.636143] ata2.00: ATAPI: TSSTcorp DVD+/-RW TS-T633C, D800, max UDMA/100 [ 2.636152] ata2.00: applying bridge limits [ 2.649711] ata2.00: configured for UDMA/100 [ 2.653762] scsi 1:0:0:0: CD-ROM TSSTcorp DVD+-RW TS-T633C D800 PQ: 0 ANSI: 5 [ 2.661486] sr0: scsi3-mmc drive: 24x/24x writer dvd-ram cd/rw xa/form2 cdda tray [ 2.661494] cdrom: Uniform CD-ROM driver Revision: 3.20 [ 2.661890] sr 1:0:0:0: Attached scsi CD-ROM sr0 [ 2.662156] sr 1:0:0:0: Attached scsi generic sg1 type 5 [ 2.694649] hub 2-1:1.0: USB hub found [ 2.694840] hub 2-1:1.0: 8 ports detected [ 2.765823] usb 1-1.4: new high-speed USB device number 3 using ehci_hcd [ 2.981454] ata6: SATA link down (SStatus 0 SControl 300) [ 2.982597] Freeing unused kernel memory: 740k freed [ 2.983523] Write protecting the kernel text: 5816k [ 2.983808] Write protecting the kernel read-only data: 2376k [ 2.983811] NX-protecting the kernel data: 4424k [ 3.014594] udevd[127]: starting version 175 [ 3.068925] sdhci: Secure Digital Host Controller Interface driver [ 3.068932] sdhci: Copyright(c) Pierre Ossman [ 3.069714] sdhci-pci 0000:09:00.0: SDHCI controller found [1180:e822] (rev 1) [ 3.069742] sdhci-pci 0000:09:00.0: PCI INT A -> GSI 16 (level, low) -> IRQ 16 [ 3.069786] sdhci-pci 0000:09:00.0: Will use DMA mode even though HW doesn't fully claim to support it. [ 3.069798] sdhci-pci 0000:09:00.0: setting latency timer to 64 [ 3.069816] mmc0: no vmmc regulator found [ 3.069877] Registered led device: mmc0:: [ 3.070946] mmc0: SDHCI controller on PCI [0000:09:00.0] using DMA [ 3.071078] tg3.c:v3.121 (November 2, 2011) [ 3.071252] tg3 0000:0b:00.0: PCI INT A -> GSI 17 (level, low) -> IRQ 17 [ 3.071269] tg3 0000:0b:00.0: setting latency timer to 64 [ 3.071403] firewire_ohci 0000:09:00.3: PCI INT D -> GSI 19 (level, low) -> IRQ 19 [ 3.071417] firewire_ohci 0000:09:00.3: setting latency timer to 64 [ 3.078509] EXT4-fs (sda1): INFO: recovery required on readonly filesystem [ 3.078517] EXT4-fs (sda1): write access will be enabled during recovery [ 3.110417] tg3 0000:0b:00.0: eth0: Tigon3 [partno(BCM95784M) rev 5784100] (PCI Express) MAC address b8:ac:6f:71:02:a6 [ 3.110425] tg3 0000:0b:00.0: eth0: attached PHY is 5784 (10/100/1000Base-T Ethernet) (WireSpeed[1], EEE[0]) [ 3.110431] tg3 0000:0b:00.0: eth0: RXcsums[1] LinkChgREG[0] MIirq[0] ASF[0] TSOcap[1] [ 3.110436] tg3 0000:0b:00.0: eth0: dma_rwctrl[76180000] dma_mask[64-bit] [ 3.125492] firewire_ohci: Added fw-ohci device 0000:09:00.3, OHCI v1.10, 4 IR + 4 IT contexts, quirks 0x11 [ 3.390124] EXT4-fs (sda1): orphan cleanup on readonly fs [ 3.390135] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078710 [ 3.390232] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 2363071 [ 3.390327] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078711 [ 3.390350] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078709 [ 3.390367] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078708 [ 3.390384] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078707 [ 3.390401] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078706 [ 3.390417] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078705 [ 3.390435] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078551 [ 3.390452] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078523 [ 3.390470] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7078520 [ 3.390487] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 7077901 [ 3.390551] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 4063272 [ 3.390562] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 4063266 [ 3.390572] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 4063261 [ 3.390582] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 4063256 [ 3.390592] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 4063255 [ 3.390602] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 2363072 [ 3.390620] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 2360050 [ 3.390698] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 5250064 [ 3.390710] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 2365394 [ 3.390728] EXT4-fs (sda1): ext4_orphan_cleanup: deleting unreferenced inode 2365390 [ 3.390745] EXT4-fs (sda1): 22 orphan inodes deleted [ 3.390748] EXT4-fs (sda1): recovery complete [ 3.397636] EXT4-fs (sda1): mounted filesystem with ordered data mode. Opts: (null) [ 3.624910] firewire_core: created device fw0: GUID 464fc000110e2661, S400 [ 3.927467] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 3.929965] udevd[400]: starting version 175 [ 3.933581] Adding 6278140k swap on /dev/sda5. Priority:-1 extents:1 across:6278140k SS [ 3.945183] lp: driver loaded but no devices found [ 3.999389] wmi: Mapper loaded [ 4.016696] ite_cir: Auto-detected model: ITE8708 CIR transceiver [ 4.016702] ite_cir: Using model: ITE8708 CIR transceiver [ 4.016706] ite_cir: TX-capable: 1 [ 4.016710] ite_cir: Sample period (ns): 8680 [ 4.016713] ite_cir: TX carrier frequency (Hz): 38000 [ 4.016716] ite_cir: TX duty cycle (%): 33 [ 4.016719] ite_cir: RX low carrier frequency (Hz): 0 [ 4.016722] ite_cir: RX high carrier frequency (Hz): 0 [ 4.025684] fglrx: module license 'Proprietary. (C) 2002 - ATI Technologies, Starnberg, GERMANY' taints kernel. [ 4.025691] Disabling lock debugging due to kernel taint [ 4.027410] IR NEC protocol handler initialized [ 4.030250] lib80211: common routines for IEEE802.11 drivers [ 4.030257] lib80211_crypt: registered algorithm 'NULL' [ 4.036024] IR RC5(x) protocol handler initialized [ 4.036092] snd_hda_intel 0000:00:1b.0: PCI INT A -> GSI 22 (level, low) -> IRQ 22 [ 4.036188] snd_hda_intel 0000:00:1b.0: irq 46 for MSI/MSI-X [ 4.036307] snd_hda_intel 0000:00:1b.0: setting latency timer to 64 [ 4.036361] [Firmware Bug]: ACPI: No _BQC method, cannot determine initial brightness [ 4.039006] acpi device:03: registered as cooling_device10 [ 4.039164] input: Video Bus as /devices/LNXSYSTM:00/device:00/PNP0A08:00/device:01/LNXVIDEO:00/input/input5 [ 4.039261] ACPI: Video Device [M86] (multi-head: yes rom: no post: no) [ 4.049753] EXT4-fs (sda1): re-mounted. Opts: errors=remount-ro [ 4.050201] wl 0000:05:00.0: PCI INT A -> GSI 17 (level, low) -> IRQ 17 [ 4.050215] wl 0000:05:00.0: setting latency timer to 64 [ 4.052252] Registered IR keymap rc-rc6-mce [ 4.052432] input: ITE8708 CIR transceiver as /devices/virtual/rc/rc0/input6 [ 4.054614] IR RC6 protocol handler initialized [ 4.054787] rc0: ITE8708 CIR transceiver as /devices/virtual/rc/rc0 [ 4.054839] ite_cir: driver has been successfully loaded [ 4.057338] IR JVC protocol handler initialized [ 4.061553] IR Sony protocol handler initialized [ 4.066578] input: MCE IR Keyboard/Mouse (ite-cir) as /devices/virtual/input/input7 [ 4.066724] IR MCE Keyboard/mouse protocol handler initialized [ 4.072580] lirc_dev: IR Remote Control driver registered, major 250 [ 4.073280] rc rc0: lirc_dev: driver ir-lirc-codec (ite-cir) registered at minor = 0 [ 4.073286] IR LIRC bridge handler initialized [ 4.077849] Linux video capture interface: v2.00 [ 4.079402] uvcvideo: Found UVC 1.00 device Laptop_Integrated_Webcam_2M (0c45:640f) [ 4.085492] EDAC MC: Ver: 2.1.0 [ 4.087138] lib80211_crypt: registered algorithm 'TKIP' [ 4.091027] input: HDA Intel Mic as /devices/pci0000:00/0000:00:1b.0/sound/card0/input8 [ 4.091733] snd_hda_intel 0000:02:00.1: PCI INT B -> GSI 17 (level, low) -> IRQ 17 [ 4.091826] snd_hda_intel 0000:02:00.1: irq 47 for MSI/MSI-X [ 4.091861] snd_hda_intel 0000:02:00.1: setting latency timer to 64 [ 4.093115] EDAC i7core: Device not found: dev 00.0 PCI ID 8086:2c50 [ 4.112448] HDMI status: Codec=0 Pin=3 Presence_Detect=0 ELD_Valid=0 [ 4.112612] input: HD-Audio Generic HDMI/DP,pcm=3 as /devices/pci0000:00/0000:00:03.0/0000:02:00.1/sound/card1/input9 [ 4.113311] type=1400 audit(1342032325.540:2): apparmor="STATUS" operation="profile_load" name="/sbin/dhclient" pid=658 comm="apparmor_parser" [ 4.114501] type=1400 audit(1342032325.540:3): apparmor="STATUS" operation="profile_load" name="/usr/lib/NetworkManager/nm-dhcp-client.action" pid=658 comm="apparmor_parser" [ 4.115253] type=1400 audit(1342032325.540:4): apparmor="STATUS" operation="profile_load" name="/usr/lib/connman/scripts/dhclient-script" pid=658 comm="apparmor_parser" [ 4.121870] input: Laptop_Integrated_Webcam_2M as /devices/pci0000:00/0000:00:1a.0/usb1/1-1/1-1.4/1-1.4:1.0/input/input10 [ 4.122096] usbcore: registered new interface driver uvcvideo [ 4.122100] USB Video Class driver (1.1.1) [ 4.128729] [fglrx] Maximum main memory to use for locked dma buffers: 5840 MBytes. [ 4.129678] [fglrx] vendor: 1002 device: 68c0 count: 1 [ 4.131991] [fglrx] ioport: bar 4, base 0x2000, size: 0x100 [ 4.132015] pci 0000:02:00.0: PCI INT A -> GSI 16 (level, low) -> IRQ 16 [ 4.132024] pci 0000:02:00.0: setting latency timer to 64 [ 4.133712] [fglrx] Kernel PAT support is enabled [ 4.133747] [fglrx] module loaded - fglrx 8.96.4 [Mar 12 2012] with 1 minors [ 4.162666] eth1: Broadcom BCM4727 802.11 Hybrid Wireless Controller 5.100.82.38 [ 4.184133] device-mapper: multipath: version 1.3.0 loaded [ 4.196660] dcdbas dcdbas: Dell Systems Management Base Driver (version 5.6.0-3.2) [ 4.279897] input: Dell WMI hotkeys as /devices/virtual/input/input11 [ 4.292402] Bluetooth: Core ver 2.16 [ 4.292449] NET: Registered protocol family 31 [ 4.292454] Bluetooth: HCI device and connection manager initialized [ 4.292459] Bluetooth: HCI socket layer initialized [ 4.292463] Bluetooth: L2CAP socket layer initialized [ 4.292473] Bluetooth: SCO socket layer initialized [ 4.296333] Bluetooth: RFCOMM TTY layer initialized [ 4.296342] Bluetooth: RFCOMM socket layer initialized [ 4.296345] Bluetooth: RFCOMM ver 1.11 [ 4.313586] ppdev: user-space parallel port driver [ 4.316619] Bluetooth: BNEP (Ethernet Emulation) ver 1.3 [ 4.316625] Bluetooth: BNEP filters: protocol multicast [ 4.383980] type=1400 audit(1342032325.812:5): apparmor="STATUS" operation="profile_load" name="/usr/lib/cups/backend/cups-pdf" pid=938 comm="apparmor_parser" [ 4.385173] type=1400 audit(1342032325.812:6): apparmor="STATUS" operation="profile_load" name="/usr/sbin/cupsd" pid=938 comm="apparmor_parser" [ 4.425757] init: failsafe main process (898) killed by TERM signal [ 4.477052] type=1400 audit(1342032325.904:7): apparmor="STATUS" operation="profile_replace" name="/sbin/dhclient" pid=1011 comm="apparmor_parser" [ 4.477592] type=1400 audit(1342032325.904:8): apparmor="STATUS" operation="profile_load" name="/usr/lib/lightdm/lightdm/lightdm-guest-session-wrapper" pid=1010 comm="apparmor_parser" [ 4.478099] type=1400 audit(1342032325.904:9): apparmor="STATUS" operation="profile_load" name="/usr/sbin/tcpdump" pid=1017 comm="apparmor_parser" [ 4.479233] type=1400 audit(1342032325.904:10): apparmor="STATUS" operation="profile_load" name="/usr/lib/telepathy/mission-control-5" pid=1014 comm="apparmor_parser" [ 4.510060] vesafb: mode is 1152x864x32, linelength=4608, pages=0 [ 4.510065] vesafb: scrolling: redraw [ 4.510071] vesafb: Truecolor: size=0:8:8:8, shift=0:16:8:0 [ 4.510084] mtrr: no more MTRRs available [ 4.513081] vesafb: framebuffer at 0xd0000000, mapped to 0xf9400000, using 3904k, total 3904k [ 4.515203] Console: switching to colour frame buffer device 144x54 [ 4.515278] fb0: VESA VGA frame buffer device [ 4.590743] tg3 0000:0b:00.0: irq 48 for MSI/MSI-X [ 4.702009] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 4.704409] ADDRCONF(NETDEV_UP): eth0: link is not ready [ 4.978379] psmouse serio1: synaptics: Touchpad model: 1, fw: 7.2, id: 0x1c0b1, caps: 0xd04733/0xa40000/0xa0000 [ 5.030104] input: SynPS/2 Synaptics TouchPad as /devices/platform/i8042/serio1/input/input12 [ 5.045782] kvm: VM_EXIT_LOAD_IA32_PERF_GLOBAL_CTRL does not work properly. Using workaround [ 5.519573] [fglrx] ATIF platform detected with notification ID: 0x81 [ 6.391466] fglrx_pci 0000:02:00.0: irq 49 for MSI/MSI-X [ 6.393137] [fglrx] Firegl kernel thread PID: 1305 [ 6.393306] [fglrx] Firegl kernel thread PID: 1306 [ 6.393472] [fglrx] Firegl kernel thread PID: 1307 [ 6.393726] [fglrx] IRQ 49 Enabled [ 6.528052] postgres (1308): /proc/1308/oom_adj is deprecated, please use /proc/1308/oom_score_adj instead. [ 6.532080] [fglrx] Gart USWC size:1280 M. [ 6.532084] [fglrx] Gart cacheable size:508 M. [ 6.532091] [fglrx] Reserved FB block: Shared offset:0, size:1000000 [ 6.532094] [fglrx] Reserved FB block: Unshared offset:f8fd000, size:403000 [ 6.532098] [fglrx] Reserved FB block: Unshared offset:3fff4000, size:c000 [ 17.423743] eth1: no IPv6 routers present [ 75.836426] warning: `proftpd' uses 32-bit capabilities (legacy support in use) [ 75.884215] init: plymouth-stop pre-start process (2922) terminated with status 1 [ 543.679614] eth1: no IPv6 routers present lsmod Module Size Used by kvm_intel 127560 0 kvm 359456 1 kvm_intel joydev 17393 0 vesafb 13516 1 parport_pc 32114 0 bnep 17830 2 ppdev 12849 0 rfcomm 38139 0 bluetooth 158438 10 bnep,rfcomm dell_wmi 12601 0 sparse_keymap 13658 1 dell_wmi binfmt_misc 17292 1 dell_laptop 17767 0 dcdbas 14098 1 dell_laptop dm_multipath 22710 0 fglrx 2909855 143 snd_hda_codec_hdmi 31775 1 psmouse 72919 0 serio_raw 13027 0 i7core_edac 23382 0 lib80211_crypt_tkip 17275 0 edac_core 46858 1 i7core_edac uvcvideo 67203 0 snd_hda_codec_idt 60251 1 videodev 86588 1 uvcvideo ir_lirc_codec 12739 0 lirc_dev 18700 1 ir_lirc_codec ir_mce_kbd_decoder 12681 0 snd_seq_midi 13132 0 ir_sony_decoder 12462 0 ir_jvc_decoder 12459 0 snd_rawmidi 25424 1 snd_seq_midi ir_rc6_decoder 12459 0 wl 2646601 0 snd_seq_midi_event 14475 1 snd_seq_midi snd_seq 51567 2 snd_seq_midi,snd_seq_midi_event ir_rc5_decoder 12459 0 video 19068 0 snd_hda_intel 32765 5 snd_seq_device 14172 3 snd_seq_midi,snd_rawmidi,snd_seq snd_hda_codec 109562 3 snd_hda_codec_hdmi,snd_hda_codec_idt,snd_hda_intel rc_rc6_mce 12454 0 lib80211 14040 2 lib80211_crypt_tkip,wl snd_hwdep 13276 1 snd_hda_codec ir_nec_decoder 12459 0 snd_pcm 80845 3 snd_hda_codec_hdmi,snd_hda_intel,snd_hda_codec ite_cir 24743 0 rc_core 21263 10 ir_lirc_codec,ir_mce_kbd_decoder,ir_sony_decoder,ir_jvc_decoder,ir_rc6_decoder,ir_rc5_decoder,rc_rc6_mce,ir_nec_decoder,ite_cir snd_timer 28931 2 snd_seq,snd_pcm wmi 18744 1 dell_wmi snd 62064 20 snd_hda_codec_hdmi,snd_hda_codec_idt,snd_rawmidi,snd_seq,snd_seq_device,snd_hda_intel,snd_hda_codec,snd_hwdep,snd_pcm,snd_timer mac_hid 13077 0 soundcore 14635 1 snd snd_page_alloc 14108 2 snd_hda_intel,snd_pcm coretemp 13269 0 lp 17455 0 parport 40930 3 parport_pc,ppdev,lp tg3 141369 0 firewire_ohci 40172 0 sdhci_pci 18324 0 firewire_core 56906 1 firewire_ohci sdhci 28241 1 sdhci_pci crc_itu_t 12627 1 firewire_core lshw *-network description: Wireless interface product: BCM4313 802.11b/g/n Wireless LAN Controller vendor: Broadcom Corporation physical id: 0 bus info: pci@0000:05:00.0 logical name: eth1 version: 01 serial: 70:f1:a1:a9:54:31 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=wl0 driverversion=5.100.82.38 ip=192.168.0.117 latency=0 multicast=yes wireless=IEEE 802.11 resources: irq:17 memory:f0900000-f0903fff *-network description: Ethernet interface product: NetLink BCM5784M Gigabit Ethernet PCIe vendor: Broadcom Corporation physical id: 0 bus info: pci@0000:0b:00.0 logical name: eth0 version: 10 serial: b8:ac:6f:71:02:a6 capacity: 1Gbit/s width: 64 bits clock: 33MHz capabilities: pm vpd msi pciexpress bus_master cap_list ethernet physical tp 10bt 10bt-fd 100bt 100bt-fd 1000bt 1000bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=tg3 driverversion=3.121 firmware=sb v2.19 latency=0 link=no multicast=yes port=twisted pair resources: irq:48 memory:f0d00000-f0d0ffff

    Read the article

  • Grub 'Read Error' - Only Loads with LiveCD

    - by Ryan Sharp
    Problem After installing Ubuntu to complete my Windows 7/Ubuntu 12.04 dual-boot setup, Grub just wouldn't load at all unless I boot from the LiveCD. Afterwards, everything works completely normal. However, this workaround isn't a solution and I'd like to be able to boot without the aid of a disc. Fdisk -l Using the fdisk -l command, I am given the following: Disk /dev/sda: 64.0 GB, 64023257088 bytes 255 heads, 63 sectors/track, 7783 cylinders, total 125045424 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x324971d1 Device Boot Start End Blocks Id System /dev/sda1 2048 206847 102400 7 HPFS/NTFS/exFAT /dev/sda2 208896 48957439 24374272 7 HPFS/NTFS/exFAT /dev/sda3 * 48959486 124067839 37554177 5 Extended /dev/sda5 48959488 124067839 37554176 83 Linux Disk /dev/sdb: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0xc0ee6a69 Device Boot Start End Blocks Id System /dev/sdb1 1024208894 1953523711 464657409 5 Extended /dev/sdb3 * 2048 1024206847 512102400 7 HPFS/NTFS/exFAT /dev/sdb5 1024208896 1937897471 456844288 83 Linux /dev/sdb6 1937899520 1953523711 7812096 82 Linux swap / Solaris Partition table entries are not in disk order Disk /dev/sdc: 320.1 GB, 320072933376 bytes 255 heads, 63 sectors/track, 38913 cylinders, total 625142448 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x292eee23 Device Boot Start End Blocks Id System /dev/sdc1 2048 625141759 312569856 7 HPFS/NTFS/exFAT Bootinfoscript I've used the BootInfoScript, and received the following output: Boot Info Script 0.61 [1 April 2012] ============================= Boot Info Summary: =============================== => Grub2 (v1.99) is installed in the MBR of /dev/sda and looks at sector 1 of the same hard drive for core.img. core.img is at this location and looks for (,msdos5)/boot/grub on this drive. => Grub2 (v1.99) is installed in the MBR of /dev/sdb and looks at sector 1 of the same hard drive for core.img. core.img is at this location and looks for (,msdos5)/boot/grub on this drive. => Windows is installed in the MBR of /dev/sdc. sda1: __________________________________________________________________________ File system: ntfs Boot sector type: Windows Vista/7: NTFS Boot sector info: No errors found in the Boot Parameter Block. Operating System: Boot files: /bootmgr /Boot/BCD sda2: __________________________________________________________________________ File system: ntfs Boot sector type: Windows Vista/7: NTFS Boot sector info: No errors found in the Boot Parameter Block. Operating System: Windows 7 Boot files: /bootmgr /Boot/BCD /Windows/System32/winload.exe sda3: __________________________________________________________________________ File system: Extended Partition Boot sector type: Unknown Boot sector info: sda5: __________________________________________________________________________ File system: ext4 Boot sector type: - Boot sector info: Operating System: Ubuntu 12.04.1 LTS Boot files: /boot/grub/grub.cfg /etc/fstab /boot/grub/core.img sdb1: __________________________________________________________________________ File system: Extended Partition Boot sector type: - Boot sector info: sdb5: __________________________________________________________________________ File system: ext4 Boot sector type: - Boot sector info: Operating System: Boot files: sdb6: __________________________________________________________________________ File system: swap Boot sector type: - Boot sector info: sdb3: __________________________________________________________________________ File system: ntfs Boot sector type: Windows Vista/7: NTFS Boot sector info: According to the info in the boot sector, sdb3 starts at sector 200744960. But according to the info from fdisk, sdb3 starts at sector 2048. According to the info in the boot sector, sdb3 has 823461887 sectors, but according to the info from fdisk, it has 1024204799 sectors. Operating System: Boot files: sdc1: __________________________________________________________________________ File system: ntfs Boot sector type: Windows Vista/7: NTFS Boot sector info: No errors found in the Boot Parameter Block. Operating System: Boot files: ============================ Drive/Partition Info: ============================= Drive: sda _____________________________________________________________________ Disk /dev/sda: 64.0 GB, 64023257088 bytes 255 heads, 63 sectors/track, 7783 cylinders, total 125045424 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes Partition Boot Start Sector End Sector # of Sectors Id System /dev/sda1 2,048 206,847 204,800 7 NTFS / exFAT / HPFS /dev/sda2 208,896 48,957,439 48,748,544 7 NTFS / exFAT / HPFS /dev/sda3 * 48,959,486 124,067,839 75,108,354 5 Extended /dev/sda5 48,959,488 124,067,839 75,108,352 83 Linux Drive: sdb _____________________________________________________________________ Disk /dev/sdb: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes Partition Boot Start Sector End Sector # of Sectors Id System /dev/sdb1 1,024,208,894 1,953,523,711 929,314,818 5 Extended /dev/sdb5 1,024,208,896 1,937,897,471 913,688,576 83 Linux /dev/sdb6 1,937,899,520 1,953,523,711 15,624,192 82 Linux swap / Solaris /dev/sdb3 * 2,048 1,024,206,847 1,024,204,800 7 NTFS / exFAT / HPFS Drive: sdc _____________________________________________________________________ Disk /dev/sdc: 320.1 GB, 320072933376 bytes 255 heads, 63 sectors/track, 38913 cylinders, total 625142448 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes Partition Boot Start Sector End Sector # of Sectors Id System /dev/sdc1 2,048 625,141,759 625,139,712 7 NTFS / exFAT / HPFS "blkid" output: ________________________________________________________________ Device UUID TYPE LABEL /dev/sda1 A48056DF8056B80E ntfs System Reserved /dev/sda2 A8C6D6A4C6D671D4 ntfs Windows /dev/sda5 fd71c537-3715-44e1-b1fe-07537e22b3dd ext4 /dev/sdb3 6373D03D0A3747A8 ntfs Steam /dev/sdb5 6f5a6eb3-a932-45aa-893e-045b57708270 ext4 /dev/sdb6 469848c8-867a-41b7-b0e1-b813a43c64af swap /dev/sdc1 725D7B961CF34B1B ntfs backup ================================ Mount points: ================================= Device Mount_Point Type Options /dev/sda5 / ext4 (rw,noatime,nodiratime,discard,errors=remount-ro) /dev/sdb5 /home ext4 (rw) =========================== sda5/boot/grub/grub.cfg: =========================== -------------------------------------------------------------------------------- # # DO NOT EDIT THIS FILE # # It is automatically generated by grub-mkconfig using templates # from /etc/grub.d and settings from /etc/default/grub # ### BEGIN /etc/grub.d/00_header ### if [ -s $prefix/grubenv ]; then set have_grubenv=true load_env fi set default="0" if [ "${prev_saved_entry}" ]; then set saved_entry="${prev_saved_entry}" save_env saved_entry set prev_saved_entry= save_env prev_saved_entry set boot_once=true fi function savedefault { if [ -z "${boot_once}" ]; then saved_entry="${chosen}" save_env saved_entry fi } function recordfail { set recordfail=1 if [ -n "${have_grubenv}" ]; then if [ -z "${boot_once}" ]; then save_env recordfail; fi; fi } function load_video { insmod vbe insmod vga insmod video_bochs insmod video_cirrus } insmod part_msdos insmod ext2 set root='(hd0,msdos5)' search --no-floppy --fs-uuid --set=root fd71c537-3715-44e1-b1fe-07537e22b3dd if loadfont /usr/share/grub/unicode.pf2 ; then set gfxmode=auto load_video insmod gfxterm insmod part_msdos insmod ext2 set root='(hd0,msdos5)' search --no-floppy --fs-uuid --set=root fd71c537-3715-44e1-b1fe-07537e22b3dd set locale_dir=($root)/boot/grub/locale set lang=en_GB insmod gettext fi terminal_output gfxterm if [ "${recordfail}" = 1 ]; then set timeout=-1 else set timeout=10 fi ### END /etc/grub.d/00_header ### ### BEGIN /etc/grub.d/05_debian_theme ### set menu_color_normal=white/black set menu_color_highlight=black/light-gray if background_color 44,0,30; then clear fi ### END /etc/grub.d/05_debian_theme ### ### BEGIN /etc/grub.d/10_linux ### function gfxmode { set gfxpayload="${1}" if [ "${1}" = "keep" ]; then set vt_handoff=vt.handoff=7 else set vt_handoff= fi } if [ "${recordfail}" != 1 ]; then if [ -e ${prefix}/gfxblacklist.txt ]; then if hwmatch ${prefix}/gfxblacklist.txt 3; then if [ ${match} = 0 ]; then set linux_gfx_mode=keep else set linux_gfx_mode=text fi else set linux_gfx_mode=text fi else set linux_gfx_mode=keep fi else set linux_gfx_mode=text fi export linux_gfx_mode if [ "${linux_gfx_mode}" != "text" ]; then load_video; fi menuentry 'Ubuntu, with Linux 3.2.0-29-generic' --class ubuntu --class gnu-linux --class gnu --class os { recordfail gfxmode $linux_gfx_mode insmod gzio insmod part_msdos insmod ext2 set root='(hd0,msdos5)' search --no-floppy --fs-uuid --set=root fd71c537-3715-44e1-b1fe-07537e22b3dd linux /boot/vmlinuz-3.2.0-29-generic root=UUID=fd71c537-3715-44e1-b1fe-07537e22b3dd ro quiet splash $vt_handoff initrd /boot/initrd.img-3.2.0-29-generic } menuentry 'Ubuntu, with Linux 3.2.0-29-generic (recovery mode)' --class ubuntu --class gnu-linux --class gnu --class os { recordfail insmod gzio insmod part_msdos insmod ext2 set root='(hd0,msdos5)' search --no-floppy --fs-uuid --set=root fd71c537-3715-44e1-b1fe-07537e22b3dd echo 'Loading Linux 3.2.0-29-generic ...' linux /boot/vmlinuz-3.2.0-29-generic root=UUID=fd71c537-3715-44e1-b1fe-07537e22b3dd ro recovery nomodeset echo 'Loading initial ramdisk ...' initrd /boot/initrd.img-3.2.0-29-generic } ### END /etc/grub.d/10_linux ### ### BEGIN /etc/grub.d/20_linux_xen ### ### END /etc/grub.d/20_linux_xen ### ### BEGIN /etc/grub.d/20_memtest86+ ### menuentry "Memory test (memtest86+)" { insmod part_msdos insmod ext2 set root='(hd0,msdos5)' search --no-floppy --fs-uuid --set=root fd71c537-3715-44e1-b1fe-07537e22b3dd linux16 /boot/memtest86+.bin } menuentry "Memory test (memtest86+, serial console 115200)" { insmod part_msdos insmod ext2 set root='(hd0,msdos5)' search --no-floppy --fs-uuid --set=root fd71c537-3715-44e1-b1fe-07537e22b3dd linux16 /boot/memtest86+.bin console=ttyS0,115200n8 } ### END /etc/grub.d/20_memtest86+ ### ### BEGIN /etc/grub.d/30_os-prober ### menuentry "Windows 7 (loader) (on /dev/sda1)" --class windows --class os { insmod part_msdos insmod ntfs set root='(hd0,msdos1)' search --no-floppy --fs-uuid --set=root A48056DF8056B80E chainloader +1 } menuentry "Windows 7 (loader) (on /dev/sda2)" --class windows --class os { insmod part_msdos insmod ntfs set root='(hd0,msdos2)' search --no-floppy --fs-uuid --set=root A8C6D6A4C6D671D4 chainloader +1 } ### END /etc/grub.d/30_os-prober ### ### BEGIN /etc/grub.d/40_custom ### # This file provides an easy way to add custom menu entries. Simply type the # menu entries you want to add after this comment. Be careful not to change # the 'exec tail' line above. ### END /etc/grub.d/40_custom ### ### BEGIN /etc/grub.d/41_custom ### if [ -f $prefix/custom.cfg ]; then source $prefix/custom.cfg; fi ### END /etc/grub.d/41_custom ### -------------------------------------------------------------------------------- =============================== sda5/etc/fstab: ================================ -------------------------------------------------------------------------------- # /etc/fstab: static file system information. # # Use 'blkid' to print the universally unique identifier for a # device; this may be used with UUID= as a more robust way to name devices # that works even if disks are added and removed. See fstab(5). # # <file system> <mount point> <type> <options> <dump> <pass> proc /proc proc nodev,noexec,nosuid 0 0 # / was on /dev/sda5 during installation UUID=fd71c537-3715-44e1-b1fe-07537e22b3dd / ext4 noatime,nodiratime,discard,errors=remount-ro 0 1 # /home was on /dev/sdb5 during installation UUID=6f5a6eb3-a932-45aa-893e-045b57708270 /home ext4 defaults 0 2 # swap was on /dev/sdb6 during installation UUID=469848c8-867a-41b7-b0e1-b813a43c64af none swap sw 0 0 tmpfs /tmp tmpfs defaults,noatime,mode=1777 0 0 -------------------------------------------------------------------------------- =================== sda5: Location of files loaded by Grub: ==================== GiB - GB File Fragment(s) = boot/grub/core.img 1 = boot/grub/grub.cfg 1 = boot/initrd.img-3.2.0-29-generic 2 = boot/vmlinuz-3.2.0-29-generic 1 = initrd.img 2 = vmlinuz 1 ======================== Unknown MBRs/Boot Sectors/etc: ======================== Unknown BootLoader on sda3 00000000 63 6f 70 69 61 20 65 20 63 6f 6c 61 41 63 65 64 |copia e colaAced| 00000010 65 72 20 61 20 74 6f 64 6f 20 6f 20 74 65 78 74 |er a todo o text| 00000020 6f 20 66 61 6c 61 64 6f 20 75 74 69 6c 69 7a 61 |o falado utiliza| 00000030 6e 64 6f 20 61 20 63 6f 6e 76 65 72 73 c3 a3 6f |ndo a convers..o| 00000040 20 64 65 20 74 65 78 74 6f 20 70 61 72 61 20 76 | de texto para v| 00000050 6f 7a 4d 61 6e 69 70 75 6c 61 72 20 61 73 20 64 |ozManipular as d| 00000060 65 66 69 6e 69 c3 a7 c3 b5 65 73 20 71 75 65 20 |efini....es que | 00000070 63 6f 6e 74 72 6f 6c 61 6d 20 6f 20 61 63 65 73 |controlam o aces| 00000080 73 6f 20 64 65 20 57 65 62 73 69 74 65 73 20 61 |so de Websites a| 00000090 20 63 6f 6f 6b 69 65 73 2c 20 4a 61 76 61 53 63 | cookies, JavaSc| 000000a0 72 69 70 74 20 65 20 70 6c 75 67 2d 69 6e 73 4d |ript e plug-insM| 000000b0 61 6e 69 70 75 6c 61 72 20 61 73 20 64 65 66 69 |anipular as defi| 000000c0 6e 69 c3 a7 c3 b5 65 73 20 72 65 6c 61 63 69 6f |ni....es relacio| 000000d0 6e 61 64 61 73 20 63 6f 6d 20 70 72 69 76 61 63 |nadas com privac| 000000e0 69 64 61 64 65 41 63 65 64 65 72 20 61 6f 73 20 |idadeAceder aos | 000000f0 73 65 75 73 20 70 65 72 69 66 c3 a9 72 69 63 6f |seus perif..rico| 00000100 73 20 55 53 42 55 74 69 6c 69 7a 61 72 20 6f 20 |s USBUtilizar o | 00000110 73 65 75 20 6d 69 63 72 6f 66 6f 6e 65 55 74 69 |seu microfoneUti| 00000120 6c 69 7a 61 72 20 61 20 73 75 61 20 63 c3 a2 6d |lizar a sua c..m| 00000130 61 72 61 55 74 69 6c 69 7a 61 72 20 6f 20 73 65 |araUtilizar o se| 00000140 75 20 6d 69 63 72 6f 66 6f 6e 65 20 65 20 61 20 |u microfone e a | 00000150 63 c3 a2 6d 61 72 61 4e c3 a3 6f 20 66 6f 69 20 |c..maraN..o foi | 00000160 70 6f 73 73 c3 ad 76 65 6c 20 65 6e 63 6f 6e 74 |poss..vel encont| 00000170 72 61 72 20 6f 20 63 61 6d 69 6e 68 6f 20 61 62 |rar o caminho ab| 00000180 73 6f 6c 75 74 6f 20 70 61 72 61 20 6f 20 64 69 |soluto para o di| 00000190 72 65 63 74 c3 b3 72 69 6f 20 61 20 65 6d 70 61 |rect..rio a empa| 000001a0 63 6f 74 61 72 2e 4f 20 64 69 72 65 63 74 c3 b3 |cotar.O direct..| 000001b0 72 69 6f 20 64 65 20 65 6e 74 72 61 64 61 00 fe |rio de entrada..| 000001c0 ff ff 83 fe ff ff 02 00 00 00 00 10 7a 04 00 00 |............z...| 000001d0 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 |................| * 000001f0 00 00 00 00 00 00 00 00 00 00 00 00 00 00 55 aa |..............U.| 00000200 =============================== StdErr Messages: =============================== xz: (stdin): Compressed data is corrupt xz: (stdin): Compressed data is corrupt awk: cmd. line:36: Math support is not compiled in awk: cmd. line:36: Math support is not compiled in awk: cmd. line:36: Math support is not compiled in awk: cmd. line:36: Math support is not compiled in awk: cmd. line:36: Math support is not compiled in awk: cmd. line:36: Math support is not compiled in Begging / Appreciation ;) If anything else is required to solve my problem, please ask. My only hopes are that I can solve this, and that doing so won't require re-installation of Grub due to how complicated the procedures are, or that I would be needed to reinstall the OS', as I have done so about six times already since friday due to several other issues I've encountered. Thank you, and good day. System Ubuntu 12.04 64-bit / Windows 7 SP1 64-bit 64GB SSD as boot/OS drive, 1TB HDD as /Home Swap and Steam drive.

    Read the article

  • Simplex Noise Help

    - by Alex Larsen
    Im Making A Minecraft Like Gae In XNA C# And I Need To Generate Land With Caves This Is The Code For Simplex I Have /// <summary> /// 1D simplex noise /// </summary> /// <param name="x"></param> /// <returns></returns> public static float Generate(float x) { int i0 = FastFloor(x); int i1 = i0 + 1; float x0 = x - i0; float x1 = x0 - 1.0f; float n0, n1; float t0 = 1.0f - x0 * x0; t0 *= t0; n0 = t0 * t0 * grad(perm[i0 & 0xff], x0); float t1 = 1.0f - x1 * x1; t1 *= t1; n1 = t1 * t1 * grad(perm[i1 & 0xff], x1); // The maximum value of this noise is 8*(3/4)^4 = 2.53125 // A factor of 0.395 scales to fit exactly within [-1,1] return 0.395f * (n0 + n1); } /// <summary> /// 2D simplex noise /// </summary> /// <param name="x"></param> /// <param name="y"></param> /// <returns></returns> public static float Generate(float x, float y) { const float F2 = 0.366025403f; // F2 = 0.5*(sqrt(3.0)-1.0) const float G2 = 0.211324865f; // G2 = (3.0-Math.sqrt(3.0))/6.0 float n0, n1, n2; // Noise contributions from the three corners // Skew the input space to determine which simplex cell we're in float s = (x + y) * F2; // Hairy factor for 2D float xs = x + s; float ys = y + s; int i = FastFloor(xs); int j = FastFloor(ys); float t = (float)(i + j) * G2; float X0 = i - t; // Unskew the cell origin back to (x,y) space float Y0 = j - t; float x0 = x - X0; // The x,y distances from the cell origin float y0 = y - Y0; // For the 2D case, the simplex shape is an equilateral triangle. // Determine which simplex we are in. int i1, j1; // Offsets for second (middle) corner of simplex in (i,j) coords if (x0 > y0) { i1 = 1; j1 = 0; } // lower triangle, XY order: (0,0)->(1,0)->(1,1) else { i1 = 0; j1 = 1; } // upper triangle, YX order: (0,0)->(0,1)->(1,1) // A step of (1,0) in (i,j) means a step of (1-c,-c) in (x,y), and // a step of (0,1) in (i,j) means a step of (-c,1-c) in (x,y), where // c = (3-sqrt(3))/6 float x1 = x0 - i1 + G2; // Offsets for middle corner in (x,y) unskewed coords float y1 = y0 - j1 + G2; float x2 = x0 - 1.0f + 2.0f * G2; // Offsets for last corner in (x,y) unskewed coords float y2 = y0 - 1.0f + 2.0f * G2; // Wrap the integer indices at 256, to avoid indexing perm[] out of bounds int ii = i % 256; int jj = j % 256; // Calculate the contribution from the three corners float t0 = 0.5f - x0 * x0 - y0 * y0; if (t0 < 0.0f) n0 = 0.0f; else { t0 *= t0; n0 = t0 * t0 * grad(perm[ii + perm[jj]], x0, y0); } float t1 = 0.5f - x1 * x1 - y1 * y1; if (t1 < 0.0f) n1 = 0.0f; else { t1 *= t1; n1 = t1 * t1 * grad(perm[ii + i1 + perm[jj + j1]], x1, y1); } float t2 = 0.5f - x2 * x2 - y2 * y2; if (t2 < 0.0f) n2 = 0.0f; else { t2 *= t2; n2 = t2 * t2 * grad(perm[ii + 1 + perm[jj + 1]], x2, y2); } // Add contributions from each corner to get the final noise value. // The result is scaled to return values in the interval [-1,1]. return 40.0f * (n0 + n1 + n2); // TODO: The scale factor is preliminary! } public static float Generate(float x, float y, float z) { // Simple skewing factors for the 3D case const float F3 = 0.333333333f; const float G3 = 0.166666667f; float n0, n1, n2, n3; // Noise contributions from the four corners // Skew the input space to determine which simplex cell we're in float s = (x + y + z) * F3; // Very nice and simple skew factor for 3D float xs = x + s; float ys = y + s; float zs = z + s; int i = FastFloor(xs); int j = FastFloor(ys); int k = FastFloor(zs); float t = (float)(i + j + k) * G3; float X0 = i - t; // Unskew the cell origin back to (x,y,z) space float Y0 = j - t; float Z0 = k - t; float x0 = x - X0; // The x,y,z distances from the cell origin float y0 = y - Y0; float z0 = z - Z0; // For the 3D case, the simplex shape is a slightly irregular tetrahedron. // Determine which simplex we are in. int i1, j1, k1; // Offsets for second corner of simplex in (i,j,k) coords int i2, j2, k2; // Offsets for third corner of simplex in (i,j,k) coords /* This code would benefit from a backport from the GLSL version! */ if (x0 >= y0) { if (y0 >= z0) { i1 = 1; j1 = 0; k1 = 0; i2 = 1; j2 = 1; k2 = 0; } // X Y Z order else if (x0 >= z0) { i1 = 1; j1 = 0; k1 = 0; i2 = 1; j2 = 0; k2 = 1; } // X Z Y order else { i1 = 0; j1 = 0; k1 = 1; i2 = 1; j2 = 0; k2 = 1; } // Z X Y order } else { // x0<y0 if (y0 < z0) { i1 = 0; j1 = 0; k1 = 1; i2 = 0; j2 = 1; k2 = 1; } // Z Y X order else if (x0 < z0) { i1 = 0; j1 = 1; k1 = 0; i2 = 0; j2 = 1; k2 = 1; } // Y Z X order else { i1 = 0; j1 = 1; k1 = 0; i2 = 1; j2 = 1; k2 = 0; } // Y X Z order } // A step of (1,0,0) in (i,j,k) means a step of (1-c,-c,-c) in (x,y,z), // a step of (0,1,0) in (i,j,k) means a step of (-c,1-c,-c) in (x,y,z), and // a step of (0,0,1) in (i,j,k) means a step of (-c,-c,1-c) in (x,y,z), where // c = 1/6. float x1 = x0 - i1 + G3; // Offsets for second corner in (x,y,z) coords float y1 = y0 - j1 + G3; float z1 = z0 - k1 + G3; float x2 = x0 - i2 + 2.0f * G3; // Offsets for third corner in (x,y,z) coords float y2 = y0 - j2 + 2.0f * G3; float z2 = z0 - k2 + 2.0f * G3; float x3 = x0 - 1.0f + 3.0f * G3; // Offsets for last corner in (x,y,z) coords float y3 = y0 - 1.0f + 3.0f * G3; float z3 = z0 - 1.0f + 3.0f * G3; // Wrap the integer indices at 256, to avoid indexing perm[] out of bounds int ii = i % 256; int jj = j % 256; int kk = k % 256; // Calculate the contribution from the four corners float t0 = 0.6f - x0 * x0 - y0 * y0 - z0 * z0; if (t0 < 0.0f) n0 = 0.0f; else { t0 *= t0; n0 = t0 * t0 * grad(perm[ii + perm[jj + perm[kk]]], x0, y0, z0); } float t1 = 0.6f - x1 * x1 - y1 * y1 - z1 * z1; if (t1 < 0.0f) n1 = 0.0f; else { t1 *= t1; n1 = t1 * t1 * grad(perm[ii + i1 + perm[jj + j1 + perm[kk + k1]]], x1, y1, z1); } float t2 = 0.6f - x2 * x2 - y2 * y2 - z2 * z2; if (t2 < 0.0f) n2 = 0.0f; else { t2 *= t2; n2 = t2 * t2 * grad(perm[ii + i2 + perm[jj + j2 + perm[kk + k2]]], x2, y2, z2); } float t3 = 0.6f - x3 * x3 - y3 * y3 - z3 * z3; if (t3 < 0.0f) n3 = 0.0f; else { t3 *= t3; n3 = t3 * t3 * grad(perm[ii + 1 + perm[jj + 1 + perm[kk + 1]]], x3, y3, z3); } // Add contributions from each corner to get the final noise value. // The result is scaled to stay just inside [-1,1] return 32.0f * (n0 + n1 + n2 + n3); // TODO: The scale factor is preliminary! } private static byte[] perm = new byte[512] { 151,160,137,91,90,15, 131,13,201,95,96,53,194,233,7,225,140,36,103,30,69,142,8,99,37,240,21,10,23, 190, 6,148,247,120,234,75,0,26,197,62,94,252,219,203,117,35,11,32,57,177,33, 88,237,149,56,87,174,20,125,136,171,168, 68,175,74,165,71,134,139,48,27,166, 77,146,158,231,83,111,229,122,60,211,133,230,220,105,92,41,55,46,245,40,244, 102,143,54, 65,25,63,161, 1,216,80,73,209,76,132,187,208, 89,18,169,200,196, 135,130,116,188,159,86,164,100,109,198,173,186, 3,64,52,217,226,250,124,123, 5,202,38,147,118,126,255,82,85,212,207,206,59,227,47,16,58,17,182,189,28,42, 223,183,170,213,119,248,152, 2,44,154,163, 70,221,153,101,155,167, 43,172,9, 129,22,39,253, 19,98,108,110,79,113,224,232,178,185, 112,104,218,246,97,228, 251,34,242,193,238,210,144,12,191,179,162,241, 81,51,145,235,249,14,239,107, 49,192,214, 31,181,199,106,157,184, 84,204,176,115,121,50,45,127, 4,150,254, 138,236,205,93,222,114,67,29,24,72,243,141,128,195,78,66,215,61,156,180, 151,160,137,91,90,15, 131,13,201,95,96,53,194,233,7,225,140,36,103,30,69,142,8,99,37,240,21,10,23, 190, 6,148,247,120,234,75,0,26,197,62,94,252,219,203,117,35,11,32,57,177,33, 88,237,149,56,87,174,20,125,136,171,168, 68,175,74,165,71,134,139,48,27,166, 77,146,158,231,83,111,229,122,60,211,133,230,220,105,92,41,55,46,245,40,244, 102,143,54, 65,25,63,161, 1,216,80,73,209,76,132,187,208, 89,18,169,200,196, 135,130,116,188,159,86,164,100,109,198,173,186, 3,64,52,217,226,250,124,123, 5,202,38,147,118,126,255,82,85,212,207,206,59,227,47,16,58,17,182,189,28,42, 223,183,170,213,119,248,152, 2,44,154,163, 70,221,153,101,155,167, 43,172,9, 129,22,39,253, 19,98,108,110,79,113,224,232,178,185, 112,104,218,246,97,228, 251,34,242,193,238,210,144,12,191,179,162,241, 81,51,145,235,249,14,239,107, 49,192,214, 31,181,199,106,157,184, 84,204,176,115,121,50,45,127, 4,150,254, 138,236,205,93,222,114,67,29,24,72,243,141,128,195,78,66,215,61,156,180 }; private static int FastFloor(float x) { return (x > 0) ? ((int)x) : (((int)x) - 1); } private static float grad(int hash, float x) { int h = hash & 15; float grad = 1.0f + (h & 7); // Gradient value 1.0, 2.0, ..., 8.0 if ((h & 8) != 0) grad = -grad; // Set a random sign for the gradient return (grad * x); // Multiply the gradient with the distance } private static float grad(int hash, float x, float y) { int h = hash & 7; // Convert low 3 bits of hash code float u = h < 4 ? x : y; // into 8 simple gradient directions, float v = h < 4 ? y : x; // and compute the dot product with (x,y). return ((h & 1) != 0 ? -u : u) + ((h & 2) != 0 ? -2.0f * v : 2.0f * v); } private static float grad(int hash, float x, float y, float z) { int h = hash & 15; // Convert low 4 bits of hash code into 12 simple float u = h < 8 ? x : y; // gradient directions, and compute dot product. float v = h < 4 ? y : h == 12 || h == 14 ? x : z; // Fix repeats at h = 12 to 15 return ((h & 1) != 0 ? -u : u) + ((h & 2) != 0 ? -v : v); } private static float grad(int hash, float x, float y, float z, float t) { int h = hash & 31; // Convert low 5 bits of hash code into 32 simple float u = h < 24 ? x : y; // gradient directions, and compute dot product. float v = h < 16 ? y : z; float w = h < 8 ? z : t; return ((h & 1) != 0 ? -u : u) + ((h & 2) != 0 ? -v : v) + ((h & 4) != 0 ? -w : w); } This Is My World Generation Code Block[,] BlocksInMap = new Block[1024, 256]; public bool IsWorldGenerated = false; Random r = new Random(); private void RunThread() { for (int BH = 0; BH <= 256; BH++) { for (int BW = 0; BW <= 1024; BW++) { Block b = new Block(); if (BH >= 192) { } BlocksInMap[BW, BH] = b; } } IsWorldGenerated = true; } public void GenWorld() { new Thread(new ThreadStart(RunThread)).Start(); } And This Is A Example Of How I Set Blocks Block b = new Block(); b.BlockType = = Block.BlockTypes.Air; This Is A Example Of How I Set Models foreach (Block b in MyWorld) { switch(b.BlockType) { case Block.BlockTypes.Dirt: b.Model = DirtModel; break; ect. } } How Would I Use These To Generate To World (The Block Array) And If Possible Thread It More? btw It's 1024 Wide And 256 Tall

    Read the article

  • Server 2012 DFS New Member Issue

    - by David
    I am trying to add a new member to our DFS topology. We have 3 DCs (VMs - VMware) running Windows server 2012, two servers are located in or Primary site and the third at our DR site. Currently the two servers at our primary site are currently replicating DFS (full mesh) and are working fine. I have tried several times to add the third DC to our DFS topology, every time i configure the replication path e.g E:\MSI and click ok the MMC snap in crashes. Below is the crash info, any idea what is causing this? What i am doing is fairly straight forward and don't see why this would be happening. Windows Crash Error: gnature: Problem Event Name: CLR20r3 Problem Signature 01: mmc.exe Problem Signature 02: 6.2.9200.16496 Problem Signature 03: 50ece2e8 Problem Signature 04: System.Windows.Forms Problem Signature 05: 4.0.30319.18046 Problem Signature 06: 51552cda Problem Signature 07: 6291 Problem Signature 08: 25 Problem Signature 09: RML5K4UDBMA5NI04CIYRWVDHKEWFDHCV OS Version: 6.2.9200.2.0.0.272.7 Locale ID: 3081 Additional Information 1: b979 Additional Information 2: b97911c958b3d076b53a1d80c1c56088 Additional Information 3: 4fee Additional Information 4: 4fee5b9baabd694859b15dfc5e1863b7      Crash Report Version=1 EventType=CLR20r3 EventTime=130165974300817209 ReportType=2 Consent=1 ReportIdentifier=d15d0d38-dd36-11e2-93fb-005056af764c IntegratorReportIdentifier=d15d0d37-dd36-11e2-93fb-005056af764c NsAppName=mmc.exe Response.type=4 Sig[0].Name=Problem Signature 01 Sig[0].Value=mmc.exe Sig[1].Name=Problem Signature 02 Sig[1].Value=6.2.9200.16496 Sig[2].Name=Problem Signature 03 Sig[2].Value=50ece2e8 Sig[3].Name=Problem Signature 04 Sig[3].Value=System.Windows.Forms Sig[4].Name=Problem Signature 05 Sig[4].Value=4.0.30319.18046 Sig[5].Name=Problem Signature 06 Sig[5].Value=51552cda Sig[6].Name=Problem Signature 07 Sig[6].Value=6291 Sig[7].Name=Problem Signature 08 Sig[7].Value=25 Sig[8].Name=Problem Signature 09 Sig[8].Value=RML5K4UDBMA5NI04CIYRWVDHKEWFDHCV DynamicSig[1].Name=OS Version DynamicSig[1].Value=6.2.9200.2.0.0.272.7 DynamicSig[2].Name=Locale ID DynamicSig[2].Value=3081 DynamicSig[22].Name=Additional Information 1 DynamicSig[22].Value=b979 DynamicSig[23].Name=Additional Information 2 DynamicSig[23].Value=b97911c958b3d076b53a1d80c1c56088 DynamicSig[24].Name=Additional Information 3 DynamicSig[24].Value=4fee DynamicSig[25].Name=Additional Information 4 DynamicSig[25].Value=4fee5b9baabd694859b15dfc5e1863b7 UI[2]=C:\Windows\system32\mmc.exe UI[3]=Microsoft Management Console has stopped working UI[4]=Windows can check online for a solution to the problem. UI[5]=Check online for a solution and close the program UI[6]=Check online for a solution later and close the program UI[7]=Close the program LoadedModule[0]=C:\Windows\system32\mmc.exe LoadedModule[1]=C:\Windows\SYSTEM32\ntdll.dll LoadedModule[2]=C:\Windows\system32\KERNEL32.DLL LoadedModule[3]=C:\Windows\system32\KERNELBASE.dll LoadedModule[4]=C:\Windows\system32\GDI32.dll LoadedModule[5]=C:\Windows\system32\USER32.dll LoadedModule[6]=C:\Windows\system32\MFC42u.dll LoadedModule[7]=C:\Windows\system32\msvcrt.dll LoadedModule[8]=C:\Windows\system32\mmcbase.DLL LoadedModule[9]=C:\Windows\system32\ole32.dll LoadedModule[10]=C:\Windows\system32\SHLWAPI.dll LoadedModule[11]=C:\Windows\system32\UxTheme.dll LoadedModule[12]=C:\Windows\system32\DUser.dll LoadedModule[13]=C:\Windows\system32\OLEAUT32.dll LoadedModule[14]=C:\Windows\system32\ODBC32.dll LoadedModule[15]=C:\Windows\SYSTEM32\combase.dll LoadedModule[16]=C:\Windows\system32\RPCRT4.dll LoadedModule[17]=C:\Windows\SYSTEM32\sechost.dll LoadedModule[18]=C:\Windows\system32\ADVAPI32.dll LoadedModule[19]=C:\Windows\system32\SHCORE.DLL LoadedModule[20]=C:\Windows\system32\IMM32.DLL LoadedModule[21]=C:\Windows\system32\MSCTF.dll LoadedModule[22]=C:\Windows\system32\DUI70.dll LoadedModule[23]=C:\Windows\WinSxS\amd64_microsoft.windows.common-controls_6595b64144ccf1df_6.0.9200.16579_none_418ab7ef718b27ef\Comctl32.dll LoadedModule[24]=C:\Windows\system32\SHELL32.dll LoadedModule[25]=C:\Windows\system32\CRYPTBASE.dll LoadedModule[26]=C:\Windows\system32\bcryptPrimitives.dll LoadedModule[27]=C:\Windows\system32\urlmon.dll LoadedModule[28]=C:\Windows\system32\iertutil.dll LoadedModule[29]=C:\Windows\system32\WININET.dll LoadedModule[30]=C:\Windows\SYSTEM32\clbcatq.dll LoadedModule[31]=C:\Windows\system32\mmcndmgr.dll LoadedModule[32]=C:\Windows\System32\msxml6.dll LoadedModule[33]=C:\Windows\system32\profapi.dll LoadedModule[34]=C:\Windows\system32\apphelp.dll LoadedModule[35]=C:\Windows\system32\dwmapi.dll LoadedModule[36]=C:\Windows\System32\oleacc.dll LoadedModule[37]=C:\Windows\system32\CRYPTSP.dll LoadedModule[38]=C:\Windows\system32\rsaenh.dll LoadedModule[39]=C:\Windows\system32\NetworkExplorer.dll LoadedModule[40]=C:\Windows\system32\PROPSYS.dll LoadedModule[41]=C:\Windows\system32\SETUPAPI.dll LoadedModule[42]=C:\Windows\system32\CFGMGR32.dll LoadedModule[43]=C:\Windows\system32\DEVOBJ.dll LoadedModule[44]=C:\Windows\system32\mlang.dll LoadedModule[45]=C:\Windows\system32\xmllite.dll LoadedModule[46]=C:\Windows\system32\VERSION.dll LoadedModule[47]=C:\Windows\SYSTEM32\mscoree.dll LoadedModule[48]=C:\Windows\Microsoft.NET\Framework64\v4.0.30319\mscoreei.dll LoadedModule[49]=C:\Windows\Microsoft.NET\Framework64\v4.0.30319\clr.dll LoadedModule[50]=C:\Windows\SYSTEM32\MSVCR110_CLR0400.dll LoadedModule[51]=C:\Windows\assembly\NativeImages_v4.0.30319_64\mscorlib\fa44d07a6b592198dfeae841489f295b\mscorlib.ni.dll LoadedModule[52]=C:\Windows\system32\sxs.dll LoadedModule[53]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System\577825eedb03a45fd7327050e85d0c44\System.ni.dll LoadedModule[54]=C:\Windows\assembly\NativeImages_v4.0.30319_64\MMCEx\9b714b187bfb304526df6d4e6160e15c\MMCEx.ni.dll LoadedModule[55]=C:\Windows\assembly\NativeImages_v4.0.30319_64\MMCFxCommon\3804721e3998fdf29b06e86bcfe92eb8\MMCFxCommon.ni.dll LoadedModule[56]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Configuration\e3873005e8829578178618d41d012849\System.Configuration.ni.dll LoadedModule[57]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Xml\aea95442f7e98cffc3c849fe3b0658d6\System.Xml.ni.dll LoadedModule[58]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Drawing\f28da0d8140095c5c86e9f2443878807\System.Drawing.ni.dll LoadedModule[59]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Windows.Forms\c2f5f2174cecd9faaf74a0cdeebfdd49\System.Windows.Forms.ni.dll LoadedModule[60]=C:\Windows\Microsoft.NET\Framework64\v4.0.30319\diasymreader.dll LoadedModule[61]=C:\Windows\assembly\NativeImages_v4.0.30319_64\Microsoft.Mff1be75b#\3c16df28b2935a005a7fd0da96e0ff6c\Microsoft.ManagementConsole.ni.dll LoadedModule[62]=C:\Windows\Microsoft.NET\Framework64\v4.0.30319\clrjit.dll LoadedModule[63]=C:\Windows\assembly\NativeImages_v4.0.30319_64\DfsMgmt\ed2ebd5dc4469285040f2e21c5e990dc\DfsMgmt.ni.dll LoadedModule[64]=C:\Windows\assembly\NativeImages_v4.0.30319_64\DfsObjectModel\43ed7ca19e7c26cbf27c5c8a2e0fec93\DfsObjectModel.ni.dll LoadedModule[65]=C:\Windows\assembly\NativeImages_v4.0.30319_64\CfsCommonUIFx\aea54a98ed63ebeaa6703e9f0a724ac8\CfsCommonUIFx.ni.dll LoadedModule[66]=C:\Windows\assembly\NativeImages_v4.0.30319_64\Interop.DFSRHelper\3780b83ee96c137664d8807e7042768f\Interop.DFSRHelper.ni.dll LoadedModule[67]=C:\Windows\system32\WindowsCodecs.dll LoadedModule[68]=C:\Windows\WinSxS\amd64_microsoft.windows.common-controls_6595b64144ccf1df_5.82.9200.16384_none_7762d5fd3178b04e\comctl32.dll LoadedModule[69]=C:\Windows\WinSxS\amd64_microsoft.windows.gdiplus_6595b64144ccf1df_1.1.9200.16518_none_726fbfe0cc22f012\gdiplus.dll LoadedModule[70]=C:\Windows\system32\DWrite.dll LoadedModule[71]=C:\Windows\system32\COMDLG32.dll LoadedModule[72]=C:\Windows\system32\Netapi32.dll LoadedModule[73]=C:\Windows\system32\netutils.dll LoadedModule[74]=C:\Windows\system32\srvcli.dll LoadedModule[75]=C:\Windows\system32\wkscli.dll LoadedModule[76]=C:\Windows\system32\clusapi.dll LoadedModule[77]=C:\Windows\system32\cryptdll.dll LoadedModule[78]=C:\Windows\system32\WS2_32.dll LoadedModule[79]=C:\Windows\system32\NSI.dll LoadedModule[80]=C:\Windows\system32\mswsock.dll LoadedModule[81]=C:\Windows\system32\DNSAPI.dll LoadedModule[82]=C:\Windows\System32\rasadhlp.dll LoadedModule[83]=C:\Windows\system32\IPHLPAPI.DLL LoadedModule[84]=C:\Windows\system32\WINNSI.DLL LoadedModule[85]=C:\Windows\System32\fwpuclnt.dll LoadedModule[86]=C:\Windows\system32\DFSCLI.DLL LoadedModule[87]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Dired13b18a9#\0acd265b442254788d2d1429c296558c\System.DirectoryServices.ni.dll LoadedModule[88]=C:\Windows\system32\ntdsapi.dll LoadedModule[89]=C:\Windows\system32\LOGONCLI.DLL LoadedModule[90]=C:\Windows\system32\activeds.dll LoadedModule[91]=C:\Windows\system32\adsldpc.dll LoadedModule[92]=C:\Windows\system32\WLDAP32.dll LoadedModule[93]=C:\Windows\system32\adsldp.dll LoadedModule[94]=C:\Windows\system32\SspiCli.dll LoadedModule[95]=C:\Windows\system32\DSPARSE.dll LoadedModule[96]=C:\Windows\system32\msv1_0.DLL LoadedModule[97]=C:\Windows\system32\cscapi.dll LoadedModule[98]=C:\Windows\system32\DSROLE.DLL LoadedModule[99]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Dire5d62f0a2#\819205bfacb57978948171e414993369\System.DirectoryServices.Protocols.ni.dll LoadedModule[100]=C:\Windows\System32\objsel.dll LoadedModule[101]=C:\Windows\System32\Secur32.dll LoadedModule[102]=C:\Windows\System32\credui.dll LoadedModule[103]=C:\Windows\system32\CRYPT32.dll LoadedModule[104]=C:\Windows\system32\MSASN1.dll LoadedModule[105]=C:\Windows\System32\DPAPI.DLL LoadedModule[106]=C:\Windows\system32\riched32.dll LoadedModule[107]=C:\Windows\system32\RICHED20.dll LoadedModule[108]=C:\Windows\system32\USP10.dll LoadedModule[109]=C:\Windows\system32\msls31.dll LoadedModule[110]=C:\Windows\System32\Windows.Globalization.dll LoadedModule[111]=C:\Windows\System32\Bcp47Langs.dll LoadedModule[112]=C:\Windows\assembly\NativeImages_v4.0.30319_64\System.Serv759bfb78#\e44b9230fcc7dc263820eff07cfc6353\System.ServiceProcess.ni.dll LoadedModule[113]=C:\Windows\system32\kerberos.DLL LoadedModule[114]=C:\Windows\system32\bcrypt.dll LoadedModule[115]=C:\Windows\assembly\NativeImages_v4.0.30319_64\Accessibility\e69795104b16b74fe9c1e7dff4f3f510\Accessibility.ni.dll LoadedModule[116]=C:\Windows\system32\MPR.dll LoadedModule[117]=C:\Windows\System32\drprov.dll LoadedModule[118]=C:\Windows\System32\WINSTA.dll LoadedModule[119]=C:\Windows\System32\ntlanman.dll LoadedModule[120]=C:\Windows\system32\explorerframe.dll FriendlyEventName=Stopped working ConsentKey=CLR20r3 AppName=Microsoft Management Console AppPath=C:\Windows\system32\mmc.exe NsPartner=windows NsGroup=windows8 Application Log Event ID: 1000 Faulting application name: mmc.exe, version: 6.2.9200.16496, time stamp: 0x50ece2e8 Faulting module name: KERNELBASE.dll, version: 6.2.9200.16451, time stamp: 0x50988aa6 Exception code: 0xe0434352 Fault offset: 0x000000000003811c Faulting process id: 0xd30 Faulting application start time: 0x01ce71411a7b775b Faulting application path: C:\Windows\system32\mmc.exe Faulting module path: C:\Windows\system32\KERNELBASE.dll Report Id: d15d0d37-dd36-11e2-93fb-005056af764c Faulting package full name: Faulting package-relative application ID: Application Log Event ID: 1026 Application: mmc.exe Framework Version: v4.0.30319 Description: The process was terminated due to an unhandled exception. Exception Info: System.Runtime.InteropServices.SEHException Stack: at System.Windows.Forms.UnsafeNativeMethods.ThemingScope.DeactivateActCtx(Int32 dwFlags, IntPtr lpCookie) at System.Windows.Forms.Application.ThreadContext.RunMessageLoop(Int32 reason, ApplicationContext context) at Microsoft.ManagementConsole.Internal.SnapInMessagePumpProxy.Microsoft.ManagementConsole.Internal.ISnapInMessagePumpProxy.Run() at Microsoft.ManagementConsole.Executive.SnapInThread.OnThreadStart() at System.Threading.ExecutionContext.RunInternal(System.Threading.ExecutionContext, System.Threading.ContextCallback, System.Object, Boolean) at System.Threading.ExecutionContext.Run(System.Threading.ExecutionContext, System.Threading.ContextCallback, System.Object, Boolean) at System.Threading.ExecutionContext.Run(System.Threading.ExecutionContext, System.Threading.ContextCallback, System.Object) at System.Threading.ThreadHelper.ThreadStart()

    Read the article

  • "Can't Connect to Server" from 2nd virtual host on VPS

    - by chaoskreator
    I'm using Debian 7 Wheezy and Apache 2.2.22, and I'm setting up Virtual Hosts for a number of websites on my VPS. I've successfully configured the VirtualHost directives for one of the sites, but the second one continually gives "Problem Loading Page" in Firefox. I've run configtest and it has verified all my syntax is correct, and I've checked all the permissions. Everything on the 2nd domain is pretty much copy/pasted from the first, so I'm not sure what the issue is, as there are no entries into /var/log/apache2/error.log other than where I have reloaded the configurations: /# cat /var/log/apache2/error.log [Thu May 29 01:19:00 2014] [notice] Graceful restart requested, doing restart [Thu May 29 01:19:00 2014] [info] Init: Seeding PRNG with 656 bytes of entropy [Thu May 29 01:19:00 2014] [info] Init: Generating temporary RSA private keys (512/1024 bits) [Thu May 29 01:19:00 2014] [info] Init: Generating temporary DH parameters (512/1024 bits) [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(253): shmcb_init allocated 512000 bytes of shared memory [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(272): for 511920 bytes (512000 including header), recommending 32 subcaches, 133 indexes each [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(306): shmcb_init_memory choices follow [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(308): subcache_num = 32 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(310): subcache_size = 15992 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(312): subcache_data_offset = 3208 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(314): subcache_data_size = 12784 [Thu May 29 01:19:00 2014] [debug] ssl_scache_shmcb.c(316): index_num = 133 [Thu May 29 01:19:00 2014] [info] Shared memory session cache initialised [Thu May 29 01:19:00 2014] [info] Init: Initializing (virtual) servers for SSL [Thu May 29 01:19:00 2014] [info] mod_ssl/2.2.22 compiled against Server: Apache/2.2.22, Library: OpenSSL/1.0.1e [Thu May 29 01:19:00 2014] [notice] Apache/2.2.22 (Debian) PHP/5.4.4-14+deb7u9 mod_ssl/2.2.22 OpenSSL/1.0.1e mod_perl/2.0.7 Perl/v5.14.2 configured -- resuming normal operations [Thu May 29 01:19:00 2014] [info] Server built: Mar 4 2013 22:05:16 [Thu May 29 01:19:00 2014] [debug] prefork.c(1023): AcceptMutex: sysvsem (default: sysvsem) I've ensured to enable each vhost with a2ensite {sitename.conf} with no errors there, either. Below are the contents of the configuration files... /etc/apache2/apache2.conf # Global configuration # LockFile ${APACHE_LOCK_DIR}/accept.lock PidFile ${APACHE_PID_FILE} Timeout 300 KeepAlive On MaxKeepAliveRequests 100 KeepAliveTimeout 5 ## ## Server-Pool Size Regulation (MPM specific) ## # prefork MPM # StartServers: number of server processes to start # MinSpareServers: minimum number of server processes which are kept spare # MaxSpareServers: maximum number of server processes which are kept spare # MaxClients: maximum number of server processes allowed to start # MaxRequestsPerChild: maximum number of requests a server process serves <IfModule mpm_prefork_module> StartServers 5 MinSpareServers 5 MaxSpareServers 10 MaxClients 150 MaxRequestsPerChild 0 </IfModule> # worker MPM # StartServers: initial number of server processes to start # MinSpareThreads: minimum number of worker threads which are kept spare # MaxSpareThreads: maximum number of worker threads which are kept spare # ThreadLimit: ThreadsPerChild can be changed to this maximum value during a # graceful restart. ThreadLimit can only be changed by stopping # and starting Apache. # ThreadsPerChild: constant number of worker threads in each server process # MaxClients: maximum number of simultaneous client connections # MaxRequestsPerChild: maximum number of requests a server process serves <IfModule mpm_worker_module> StartServers 2 MinSpareThreads 25 MaxSpareThreads 75 ThreadLimit 64 ThreadsPerChild 25 MaxClients 150 MaxRequestsPerChild 0 </IfModule> # event MPM # StartServers: initial number of server processes to start # MinSpareThreads: minimum number of worker threads which are kept spare # MaxSpareThreads: maximum number of worker threads which are kept spare # ThreadsPerChild: constant number of worker threads in each server process # MaxClients: maximum number of simultaneous client connections # MaxRequestsPerChild: maximum number of requests a server process serves <IfModule mpm_event_module> StartServers 2 MinSpareThreads 25 MaxSpareThreads 75 ThreadLimit 64 ThreadsPerChild 25 MaxClients 150 MaxRequestsPerChild 0 </IfModule> # These need to be set in /etc/apache2/envvars User ${APACHE_RUN_USER} Group ${APACHE_RUN_GROUP} # # AccessFileName: The name of the file to look for in each directory # for additional configuration directives. See also the AllowOverride # directive. # AccessFileName .htaccess # # The following lines prevent .htaccess and .htpasswd files from being # viewed by Web clients. # <Files ~ "^\.ht"> Order allow,deny Deny from all Satisfy all </Files> DefaultType None HostnameLookups Off ErrorLog ${APACHE_LOG_DIR}/error.log LogLevel debug # Include module configuration: Include mods-enabled/*.load Include mods-enabled/*.conf # Include list of ports to listen on and which to use for name based vhosts Include ports.conf # # The following directives define some format nicknames for use with # a CustomLog directive (see below). # If you are behind a reverse proxy, you might want to change %h into %{X-Forwarded-For}i # # LogFormat "%v:%p %h %l %u %t \"%r\" %>s %O \"%{Referer}i\" \"%{User-Agent}i\"" vhost_combined LogFormat "%h %l %u %t \"%r\" %>s %O \"%{Referer}i\" \"%{User-Agent}i\"" combined LogFormat "%h %l %u %t \"%r\" %>s %O" common LogFormat "%{Referer}i -> %U" referer LogFormat "%{User-agent}i" agent <Directory "/var/www"> Order allow,deny Allow from all Require all granted </Directory> # Include generic snippets of statements Include conf.d/ # Include the virtual host configurations: Include sites-enabled/*.conf NameVirtualHost *:80 /etc/apache2/sites-available/site1.net.conf <VirtualHost *:80> ServerName site1.net ServerAlias site1.net *.site1.net DocumentRoot "/var/www/site1" ErrorLog "/var/www/site1/logs/error.log" CustomLog "/var/www/site1/logs/access.log" vhost_combined <Directory "/var/www/site1"> Options None AllowOverride All Order allow,deny Allow from all Satisfy Any </Directory> </VirtualHost> /etc/apache2/sites-available/site2.com.conf <VirtualHost *:80> ServerName site2.com ServerAlias site2.com *.site2.com DocumentRoot "/var/www/site2" ErrorLog "/var/www/site2/logs/error.log" CustomLog "/var/www/site2/logs/access.log" vhost_combined <Directory "/var/www/site2"> Options None AllowOverride All Order allow,deny Allow from all Satisfy Any </Directory> </VirtualHost> I've also tried setting NameVirtualHost like: Listen 80 NameVirtualHost 23.88.121.82:80 NameVirtualHost 127.0.0.1:80 and the VirtualHost Directives: <VirtualHost 23.88.121.82:80> ... </VirtualHost> for both sites, but that causes the first site to fail, as well. I'm wondering if I need to set up individual IPs for each site, possibly? I have 2 more IPv4 and 3 IPv6 addresses available, if that would make a difference. Also, in the grand scheme of things, I will need to enable SSL for the first site. I've been reading that I'll need to basically just mimic the directives for listening on port 80, only on port 443, and make sure mod_ssl is enabled? EDIT: I just ran apache2 -t to test the config files that way, and got the error: apache2: bad user name ${APACHE_RUN_USER}. However, apachectl configtest returns Syntax OK. There are no other mentions of errors with the mutex anywhere else, however. I was pretty sure if there was an error with the user apache was supposed to run under, the server wouldn't start at all... EDIT 2: Restarting apache fixed the bad user name error.

    Read the article

  • Boot log from remotely managed/hacked iPhone for analysis

    - by user1319903
    in reference to my other post. syslog captured immediately after a hard reset for analysis of foul play. Apr 8, 2012 10:08:36 PM - dataaccessd [53] (Notice): 137860|CoreDAV|Warn |Account "iCloud" couldn't reach the server at p03-contacts.icloud.com: Error Domain=NSURLErrorDomain Code=-1009 "The Internet connection appears to be offline." UserInfo=0xde63920 {NSErrorFailingURLStringKey=https://%[email protected]/159665024/principal/, NSErrorFailingURLKey=https://%[email protected]/ /principal/, NSLocalizedDescription=The Internet connection appears to be offline., NSUnderlyingError=0xde7dc00 "The Internet connection appears to be offline."} Apr 8, 2012 10:08:36 PM - UserEventAgent [12] (Warning): TRACE: connection interrupted Apr 8, 2012 10:08:36 PM - UserEventAgent [12] (Warning): DEBUG: disconnected Apr 8, 2012 10:08:36 PM - UserEventAgent [12] (Warning): TRACE: Canceling Apr 8, 2012 10:08:36 PM - UserEventAgent [12] (Warning): TRACE: connection invalid Apr 8, 2012 10:08:35 PM - kernel [0] (Debug): launchd[82] Builtin profile: container (sandbox) Apr 8, 2012 10:08:35 PM - kernel [0] (Debug): launchd[82] Container: /private/var/mobile/Applications/048D35CA-6427-4EC8-8B76-A194697A7CE9 [69] (sandbox) Apr 8, 2012 10:08:35 PM - wifid [29] (Error): WiFi:[355640915.904103]: Client dataaccessd set type to background application Apr 8, 2012 10:08:35 PM - dataaccessd [53] (Notice): 137860|DA|Warn |Delegate 5ADDBE3B-D5FD-43E1-87D4-C1153733EFAB finished a refresh but it is not registered with the refresh manager Apr 8, 2012 10:08:34 PM - timed [31] (Notice): (Note ) CoreTime: Not setting system time to 04/09/2012 05:08:34 from GPS because time is unchanged Apr 8, 2012 10:08:34 PM - timed [31] (Notice): (Note ) CoreTime: Not setting time zone to America/Los_Angeles from NITZ Apr 8, 2012 10:08:33 PM - kernel [0] (Debug): AppleKeyStore:cp_key_store_action(1) Apr 8, 2012 10:08:33 PM - kernel [0] (Debug): AppleKeyStore:Sending lock change Apr 8, 2012 10:08:32 PM - profiled [20] (Notice): (Note ) profiled: Device unlock notification received Apr 8, 2012 10:08:31 PM - softwareupdated [37] (Notice): 3e828d98 : Cleaning up unused prepared updates Apr 8, 2012 10:08:27 PM - mstreamd [43] (Warning): PSDLog: Can't return photoStreamsPublishStreamID because no Apple Account has Photo Streams enabled Apr 8, 2012 10:08:27 PM - mstreamd [43] (Notice): (Note ) mstreamd: Not listening to push notifications. Apr 8, 2012 10:08:27 PM - mstreamd [43] (Warning): PSDLog: Can't return photoStreamsPublishStreamID because no Apple Account has Photo Streams enabled Apr 8, 2012 10:08:27 PM - mstreamd [43] (Notice): (Note ) mstreamd: Not listening to push notifications. Apr 8, 2012 10:08:27 PM - mstreamd [43] (Notice): (Note ) mstreamd: Retrieved push tokens. Dev: 0, Prod: 0 Apr 8, 2012 10:08:27 PM - mstreamd [43] (Notice): (Note ) mstreamd: Media stream daemon starting... Apr 8, 2012 10:08:26 PM - SpringBoard [15] (Notice): SMSCTServer is available and ready to rock. Apr 8, 2012 10:08:26 PM - SpringBoard [15] (Error): mms: * isMmsConfigured = 1 Apr 8, 2012 10:08:26 PM - MobilePhone [79] (Warning): Connection lost, retrying with key exchange. Apr 8, 2012 10:08:26 PM - MobilePhone [79] (Warning): Connection lost, retrying with key exchange. Apr 8, 2012 10:08:26 PM - MobilePhone [79] (Warning): Connection lost, retrying with key exchange. Apr 8, 2012 10:08:26 PM - MobilePhone [79] (Warning): Connection lost, retrying with key exchange. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Warning): BT: failed to get connectable state with error 111 Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Error): WiFi: Consulting "no-sdio-devices" property. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Error): WiFi: "no-sdio-devices" property not found. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Warning): SMS Plugin initialized. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Warning): Telephony plugin initialized Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Warning): SIMToolkit plugin for SpringBoard initialized. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Error): WiFi: Consulting "no-sdio-devices" property. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Error): WiFi: "no-sdio-devices" property not found. Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Warning): WiFi picker plugin initialized Apr 8, 2012 10:08:25 PM - SpringBoard [15] (Warning): EKAlarmEngine: Region monitoring not available or enabled. Trigger ignored! Apr 8, 2012 10:08:24 PM - kernel [0] (Debug): AppleH4CamIn::setPowerStateGated: 0 Apr 8, 2012 10:08:24 PM - kernel [0] (Debug): AppleH4CamIn::power_off_hardware Apr 8, 2012 10:08:24 PM - SpringBoard [15] (Notice): IOMobileFrameBufferGetMirroringCapability returning -536870201 via kIOMFBConnectMethod_GetMirroringCapability  Apr 8, 2012 10:08:24 PM - aggregated [61] (Warning): PLAggregateState Error: Leaving state unplugged_screen_off even though we are not in it, doing nothing Apr 8, 2012 10:08:24 PM - aggregated [61] (Warning): PLAggregateState Error: Entering state unplugged_screen_on even though we are already in it, doing nothing Apr 8, 2012 10:08:24 PM - wifid [29] (Error): WiFi:[355640904.616440]: Disable WoW requested by "spd" Apr 8, 2012 10:08:24 PM - SpringBoard [15] (Warning): Application windows are expected to have a root view controller at the end of application launch Apr 8, 2012 10:08:23 PM - SpringBoard [15] (Warning): BTM: attaching to BTServer Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_LoadFirmware_gated: fw len=1232920 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_LoadFirmware_gated - firmware checksum: 0x05935019 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::power_on_hardware Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_Init - No set-file loaded for camera channel 0 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_Init - No set-file loaded for camera channel 1 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_InitialSensorDetection - found sensor on chan 0: 0x0145 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_InitialSensorDetection - found sensor on chan 1: 0x7736 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::power_off_hardware Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_LoadSetfile_gated (camChan=0) Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::ISP_LoadSetfile_gated (camChan=1) Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::setPowerStateGated: 1 Apr 8, 2012 10:08:23 PM - kernel [0] (Debug): AppleH4CamIn::power_on_hardware Apr 8, 2012 10:08:23 PM - profiled [20] (Notice): (Note ) profiled: Locking device Apr 8, 2012 10:08:22 PM - kernel [0] (Debug): HighlandParkResourceMgr::AddFirmware() {'cdma', '    '} added to resources Apr 8, 2012 10:08:22 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction Register function PTP Apr 8, 2012 10:08:22 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction all functions registered- we are ready to start usb stack Apr 8, 2012 10:08:22 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::handleUSBCableDisconnect Apr 8, 2012 10:08:22 PM - kernel [0] (Debug): HighlandParkResourceMgr::AddFirmware() {'gsm ', 'nb  '} added to resources Apr 8, 2012 10:08:22 PM - kernel [0] (Debug): HighlandParkResourceMgr::AddFirmware() {'gsm ', 'wb  '} added to resources Apr 8, 2012 10:08:22 PM - MRMLowDiskUEA [12] (Notice): MobileDelete: LowDisk Plugin: start Apr 8, 2012 10:08:22 PM - MRMLowDiskUEA [12] (Notice): kqueue registration successful Apr 8, 2012 10:08:22 PM - mediaserverd [44] (Error): 22:08:22.522867 com.apple.AVConference: /SourceCache/GameKitServices/GameKitServices-344.21/AVConference.subproj/Sources/AVConferenceServer.m:1867: AVConferenceServerStart Apr 8, 2012 10:08:22 PM - CommCenter [18] (Notice): Carrier bundle value for recipient address: 28818773 Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice - Configuration: PTP Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: PTP Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice - Configuration: iPod USB Interface Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: USBAudioControl Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: USBAudioStreaming Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: IapOverUsbHid Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice - Configuration: PTP + Apple Mobile Device Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: PTP Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: AppleUSBMux Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice - Configuration: PTP + Apple Mobile Device + Apple USB Ethernet Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: PTP Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: AppleUSBMux Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice          Interface: AppleUSBEthernet Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): IOAccessoryPortUSB::start Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction Register function USBAudioControl Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): virtual bool AppleUSBDeviceMux::start(IOService*) build: Feb  1 2012 23:16:46 Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): init_waste Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction Register function AppleUSBMux Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction Register function IapOverUsbHid Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction Register function USBAudioStreaming Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleSynopsysOTGDevice::gated_registerFunction Register function AppleUSBEthernet Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleUSBEthernetDevice::start: Host MAC address = 02:(this Mac address does not physically exist) -edit Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): AppleUSBEthernetDevice: Ethernet address  Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): BTServer[66] Builtin profile: BlueTool (sandbox) Apr 8, 2012 10:08:21 PM - kernel [0] (Debug): BTServer[66] Builtin profile: BlueTool (sandbox) Apr 8, 2012 10:08:21 PM - hpfd [50] (Notice): firmware resource loaded { 'cdma' '    ' } Apr 8, 2012 10:08:21 PM - wifid [29] (Error): WiFi:[355640901.282776]: Could not read APPLE80211_IOC_SUPPORTED_CHANNELS err=82 Apr 8, 2012 10:08:21 PM - wifid [29] (Error): WiFi:[355640901.312786]: Client itunesstored is background application Apr 8, 2012 10:08:21 PM - timed [31] (Notice): (Note ) CoreTime: Want active time in 38.24hrs. Need active time in 121.57hrs. Apr 8, 2012 10:08:21 PM - SpringBoard [15] (Notice): MultitouchHID: detection mode: 255-0 (deferring until bootloaded) Apr 8, 2012 10:08:21 PM - CLTM [12] (Error): CLTM: resetting temps: now = 1333948101, last update = -2147483648 Apr 8, 2012 10:08:21 PM - locationd [28] (Error): WiFi:[355640901.852993]: WiFiManager now available Apr 8, 2012 10:08:21 PM - OTACrashCopier [62] (Notice): (Warn ) Failed to read attributes from '/var/mobile/Library/OTALogging/.last_successful_submission_marker' Apr 8, 2012 10:08:21 PM - hpfd [50] (Notice): firmware resource loaded { 'gsm ' 'nb  ' } Apr 8, 2012 10:08:21 PM - hpfd [50] (Notice): firmware resource loaded { 'gsm ' 'wb  ' } Apr 8, 2012 10:08:20 PM - kernel [0] (Debug): AppleBCMWLANCore::initFirmware(): successful initialization Apr 8, 2012 10:08:20 PM - kernel [0] (Debug): AppleBCMWLANCore:initFirmware(): 2496 PropTxStatus feature is not enabled for this platform  Apr 8, 2012 10:08:20 PM - kernel [0] (Debug): AppleBCMWLANCore::initDongle():: creating virtual interface with prefix = ap Apr 8, 2012 10:08:20 PM - kernel [0] (Debug): AppleBCMWLANCore::initDongle(): Core Driver Initialization Time 19.38798583 Apr 8, 2012 10:08:20 PM - kernel [0] (Debug): 000019.281423 hsic-baseband::safetyNet: port is not connected Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 _create_cesm_vault: try to create blob Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 load_activation_records: This is the default record Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 _create_cesm_vault: blob written Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 ping_configd: Not setting host name, it already has one: Pete's iPod  Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 lookup_baseband_info_new: radio not ready: kCTPostponementStatusNotReady Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 load_activation_records: This is the default record Apr 8, 2012 10:08:20 PM - SpringBoard [15] (Error): WiFi: Consulting "no-sdio-devices" property. Apr 8, 2012 10:08:20 PM - SpringBoard [15] (Error): WiFi: "no-sdio-devices" property not found. Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 determine_activation_state_new: Original act. state: Activated Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 determine_activation_state_new: radio not ready, don't change activation status, wait for notification, status: kCTPostponementStatusNotReady Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 determine_activation_state_new: Activation state now is Activated Apr 8, 2012 10:08:20 PM - SpringBoard [15] (Warning): lockdown says the device is: [Activated], state is 3 Apr 8, 2012 10:08:20 PM - SpringBoard [15] (Warning): lockdown says we've previously registered: [1], state is 1 Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 notification_worker: now listening for CT notifications Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 notification_worker: we've registered for notifications, now make sure we didn't miss one... Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 load_activation_records: This is the default record Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 determine_activation_state_new: Original act. state: Activated Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 determine_activation_state_new: radio not ready, don't change activation status, wait for notification, status: kCTPostponementStatusNotReady Apr 8, 2012 10:08:20 PM - lockdownd [23] (Notice): 3e828d98 determine_activation_state_new: Activation state now is Activated Apr 8, 2012 10:08:20 PM - SpringBoard [15] (Notice): Posting 'com.apple.iokit.hid.displayStatus' notifyState=1 Apr 8, 2012 10:08:20 PM - SpringBoard [15] (Notice): __IOHIDLoadBundles: Loaded 1 HID plugin Apr 8, 2012 10:08:19 PM - wifiFirmwareLoader [30] (Warning): [    18.778 sec] Downloaded firmware, 192512 bytes Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleKeyStore:cp_key_store_action(0) Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleMultitouchN1SPI: downloaded 128 bytes of prox calibration data ("built-in") Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleMultitouchN1SPI: downloaded 1024 bytes of calibration data ("built-in") Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::attachBusGated(): Bus Driver Initialization Time 18.266927958 Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore:attachBusGated(): Starting with MAC Address: 00:f4:b9:2f:d9:8d Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANFirmwareManager::setNVRAMData(): received 778 bytes Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore: Ethernet address 00:f4:b9:2f:d9:8d Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): Loading syscfg. Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleMultitouchN1SPI: downloaded 56264 bytes of firmware data ("0x0084.bin") in 152ms. Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::apple80211_ioctl() Driver not yet initialized, cannot process ioctl Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::apple80211_ioctl() Driver not yet initialized, cannot process ioctl Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AirPort: Enabled AppleBCMWLANCore (link 0, sys 0, user 0) Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::apple80211_ioctl() Driver not yet initialized, cannot process ioctl Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::apple80211_ioctl() Driver not yet initialized, cannot process ioctl Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANBusInterfaceHSIC::loadFirmware(): DL Ver: chip 0x4330, chiprev 0x4 Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): BTServer[66] Builtin profile: BlueTool (sandbox) Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): BCMWLAN Firmware Version: wl0: Dec 22 2011 19:03:58 version 5.95.45 Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::initFirmware(): Firmware supports ap mode; enabling apsta feature (currently enabled) Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::initFirmware(): country code set to XX Apr 8, 2012 10:08:19 PM - configd [14] (Notice): network configuration changed. Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCmdManager::processResponse(): Firmware Error "BCOM Unsupported" on command "WLC_SET_VAR: bus:txglom" (263). Transaction ID 3, length 0 Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::initFirmware(): Glomming not supported on this device: BCOM Unsupported Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::initFirmware: apsta set to 1 Apr 8, 2012 10:08:19 PM - kernel [0] (Debug): AppleBCMWLANCore::handleEventPacket(): WLC_E_FIFO_CREDIT_MAP,length 6 [9 2 5 3 2] Apr 8, 2012 10:08:19 PM - iapd [49] (Error): Timed out trying to acquire capabilities data. Apr 8, 2012 10:08:19 PM - softwareupdated [37] (Notice): 3e828d98 : Cleaning up unused prepared updates Apr 8, 2012 10:08:19 PM - com.apple.misd [63] (Notice): allowing special port forwarding for test fixtures Apr 8, 2012 10:08:19 PM - hpfd [50] (Notice): resource request { 'N94 ', '    ' } Apr 8, 2012 10:08:19 PM - mstreamd [43] (Notice): (Note ) mstreamd: mstreamd starting up. Apr 8, 2012 10:08:18 PM - kernel [0] (Debug): launchd[44] Builtin profile: mediaserverd (sandbox) Apr 8, 2012 10:08:18 PM - kernel [0] (Debug): launchd[49] Builtin profile: iapd (sandbox) Apr 8, 2012 10:08:18 PM - kernel [0] (Debug): launchd[53] Builtin profile: dataaccessd (sandbox) Apr 8, 2012 10:08:18 PM - kernel [0] (Debug): launchd[60] Builtin profile: apsd (sandbox) Apr 8, 2012 10:08:18 PM - kernel [0] (Debug): launchd[66] Builtin profile: BTServer (sandbox) Apr 8, 2012 10:08:18 PM - mDNSResponder [46] (Error): mDNSResponder mDNSResponder-329.10 (Jan 15 2012 19:07:41) starting iOSVers 9 Apr 8, 2012 10:08:18 PM - mDNSResponder [46] (Error): Note: SetDomainSecrets: no keychain support Apr 8, 2012 10:08:18 PM - mDNSResponder [46] (Error): Note: Compiled without SnowLeopard Fine-Grained Power Management support Apr 8, 2012 10:08:18 PM - fseventsd [51] (Critical): event logs in /private/var/.fseventsd out of sync with volume.  destroying old logs. (10083 7 10090) Apr 8, 2012 10:08:18 PM - fseventsd [51] (Critical): log dir: /private/var/.fseventsd getting new uuid: 8778E61A-0283-4067-B7DF-F75D109983D1 Apr 8, 2012 10:08:18 PM - fseventsd [51] (Error): failed to make the directory /.fseventsd (30/Read-only file system) Apr 8, 2012 10:08:18 PM - fseventsd [51] (Critical): could not open < (No such file or directory) Apr 8, 2012 10:08:18 PM - fseventsd [51] (Critical): log dir: /tmp getting new uuid: 3919EB54-A54F-4289-864A-5158A25EF9DA Apr 8, 2012 10:08:18 PM - wifid [29] (Error): WiFi:[355640898.328610]: WiFi Preferences is up to date Apr 8, 2012 10:08:18 PM - mDNSResponder [46] (Error): D2DInitialize succeeded Apr 8, 2012 10:08:18 PM - fairplayd.N94 [52] (Notice): Vroum Apr 8, 2012 10:08:18 PM - wifid [29] (Error): WiFi:[355640898.537219]: WiFiManager starting, version: WiFiManager-260.9 Feb  4 2012 13:25:16 Apr 8, 2012 10:08:18 PM - configd [14] (Error): WiFi:[355640898.539342]: WiFiManager now available Apr 8, 2012 10:08:18 PM - keybagd [39] (Error): 3e828d98 main: System Keybag loaded Apr 8, 2012 10:08:18 PM - wifiFirmwareLoader [30] (Warning): [    18.268 sec] Found AppleBCMWLANBusInterface; downloading FW.. Apr 8, 2012 10:08:18 PM - wifiFirmwareLoader [30] (Warning): Loading "/usr/share/firmware/wifi/4330b2/bcm94330OlympicUNO3.txt", file size = 778 bytes Apr 8, 2012 10:08:18 PM - wifiFirmwareLoader [30] (Warning): [    18.276 sec] Sending NVRAM, 778 bytes Apr 8, 2012 10:08:18 PM - wifiFirmwareLoader [30] (Warning): Loading "/usr/share/firmware/wifi/4330b2/n94.trx", file size = 192512 bytes Apr 8, 2012 10:08:18 PM - wifiFirmwareLoader [30] (Warning): [    18.300 sec] Sending firmware, 192512 bytes Apr 8, 2012 10:08:18 PM - lockdownd [23] (Error): libMobileGestalt copyEthernetMacAddress: got 00:f4:b9:2f:d9:8f from syscfg Apr 8, 2012 10:08:18 PM - mediaserverd [44] (Notice): 2012-04-08 10:08:18.817015 PM [AirTunes] HAL plugin started Apr 8, 2012 10:08:18 PM - lockdownd [23] (Error): libMobileGestalt createCFStringWithCFData: Cannot convert NULL data to string Apr 8, 2012 10:08:18 PM - lockdownd [23] (Error): libMobileGestalt copyBasebandBoardSnum: Could not convert baseband board snum data to string Apr 8, 2012 10:08:18 PM - lockdownd [23] (Error): libMobileGestalt createCFStringWithCFData: Cannot convert NULL data to string Apr 8, 2012 10:08:18 PM - lockdownd [23] (Error): libMobileGestalt copyWirelessBoardSnum: Could not convert wireless board snum data to string Apr 8, 2012 10:08:18 PM - lockdownd [23] (Notice): 3e828d98 lockstart_local: Build= 9B179 Apr 8, 2012 10:08:18 PM - lockdownd [23] (Notice): 3e828d98 _load_product_type: using Raptor Certs Apr 8, 2012 10:08:17 PM - wifiFirmwareLoader [30] (Warning): [    17.590 sec] wlan AppleUSBHSICDevice found Apr 8, 2012 10:08:17 PM - wifiFirmwareLoader [30] (Warning): [    17.590 sec] WLAN Enumeration attempt 0 / 6: Apr 8, 2012 10:08:17 PM - wifiFirmwareLoader [30] (Warning): [    17.591 sec] Waiting for AppleBCMWLANBusInterface to enumerate... Apr 8, 2012 10:08:16 PM - CommCenter [18] (Notice): MMS thread running Apr 8, 2012 10:08:16 PM - CommCenter [18] (Notice): Communications Center Started. Apr 8, 2012 10:08:16 PM - CommCenter [18] (Notice): STOP LOCATION UPDATE Apr 8, 2012 10:08:16 PM - locationd [28] (Error): WiFi:[355640896.704327]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:16 PM - locationd [28] (Error): WiFi:[355640896.705542]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:16 PM - locationd [28] (Error): WiFi:[355640896.706648]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:16 PM - locationd [28] (Error): WiFi:[355640896.707418]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:15 PM - kernel [0] (Debug): bool AppleRGBOUT::power_down_hardware(), RGB_CTRL (0x00000000) clk_down_ready is not set after 60 msecs Apr 8, 2012 10:08:14 PM - lockdownd [23] (Notice): 3e828d98 main: Starting Up Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): IOReturn AppleRGBOUT::set_display_device_gated(uint32_t), 1 Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): virtual void AppleRGBOUT::do_power_state_change(): fSoft: 1 fHard: 1 swapBusy: 1  fController: 0 - 1 Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): bool AppleRGBOUT::power_up_hardware() Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): set_crc_notification_state 0 Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): virtual void AppleRGBOUT::do_power_state_change(): fSoft: 0 fHard: 1 swapBusy: 0  fController: 1 - 0 Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): bool AppleRGBOUT::power_down_hardware() Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): IOReturn IOMobileFramebufferUserClient::set_hotplug_notify(void *, void *) 0x314b3f0d 0xe215600 Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): IOReturn IOMobileFramebufferUserClient::set_hotplug_notify(void *, void *) 0x849d5000 0x876e8828 0x314b3f0d 0xe215600 Apr 8, 2012 10:08:14 PM - kernel [0] (Debug): bool AppleRGBOUT::power_down_hardware(), clock down RGBOUT Apr 8, 2012 10:08:14 PM - SpringBoard [15] (Notice): IOMobileFrameBufferGetMirroringCapability returning -536870201 via kIOMFBConnectMethod_GetMirroringCapability  Apr 8, 2012 10:08:14 PM - backupd [21] (Warning): INFO: Account changed (enabled=0, accountID=159665024) Apr 8, 2012 10:08:13 PM - kernel [0] (Debug): launchd[17] Builtin profile: ptpd (sandbox) Apr 8, 2012 10:08:13 PM - UserEventAgent [12] (Warning): Factory called Apr 8, 2012 10:08:13 PM - configd [14] (Error): WiFi:[355640893.157493]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:13 PM - configd [14] (Error): WiFi:[355640893.158197]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:13 PM - configd [14] (Error): WiFi:[355640893.158878]: bootstrap_look_up of WiFiManager server failed Apr 8, 2012 10:08:13 PM - UserEventAgent [12] (Notice): (Note ) PIH: MCUEAPlugin initialized. Apr 8, 2012 10:08:13 PM - UserEventAgent [12] (Error): Querying interface Apr 8, 2012 10:08:13 PM - configd [14] (Error): ioctl(SIOCGIFCAP) failed: Device not configured Apr 8, 2012 10:08:13 PM - configd [14] (Error): ioctl(SIOCGIFCAP) failed: Device not configured Apr 8, 2012 10:08:13 PM - configd [14] (Notice): setting hostname to "Petes-iPod" Apr 8, 2012 10:08:13 PM - configd [14] (Notice): network configuration changed. Apr 8, 2012 10:08:13 PM - UserEventAgent [12] (Warning): TRACE: sending {    command = kMBMessageAccountChanged; } Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) profiled: Service starting... Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) profiled: Performing boot time checks. Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) MC: Checking for MDM installation... Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) MC: ...finished checking for MDM installation. Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) profiled: Checking for new carrier profile... Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) profiled: Installing new carrier profile. Apr 8, 2012 10:08:13 PM - profiled [20] (Notice): (Note ) profiled: Carrier profile has already been installed. Apr 8, 2012 10:08:12 PM - com.apple.launchd [1] (Warning): (com.apple.ptpd) The exception server is already claimed! Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: mitigation behavior enabled Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: camera equations enabled Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: thermal monitoring enabled Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: registered for wake notification Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 0 to 16384 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 1 to 546 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 2 to 5461 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 3 to 6553 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 4 to 5461 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 5 to 5461 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 6 to 16384 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 9 to 5461 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set decay on sensor 10 to 5461 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: Set AppleARMPerformanceControllerDVDFactor1 dithering level to 101% Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: Set AppleARMPerformanceControllerDVDFactor0 dithering level to 100% Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: Set charge rate index to 0 Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: HID not ready cannot set BL Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: setting thermal status level to 0 (0) [-32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768] Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: set allowable transmit power limit to 24.000 dBm [-32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768, -32768] Apr 8, 2012 10:08:12 PM - CLTM [12] (Error): CLTM: Could not close relay file Apr 8, 2012 10:08:12 PM - CLTM [12] (Notice): CLTM: thermtgraphrelay is not present

    Read the article

  • CS1685 Warning causes a CS0433 error when targeting 3.5 in VS2010

    - by Adam Driscoll
    I have a 2010 project that is targeting .NET v3.5. It was working fine until I started to mess with configurations a bit and now I cannot figure out what I'm doing wrong. The project doesn't have ANY references added. It won't even let me add a reference to System.Core as it is added by the 'build system'. warning CS1685: The predefined type 'System.Func' is defined in multiple assemblies in the global alias; using definition from 'c:\Windows\Microsoft.NET\Framework\v4.0.30319\mscorlib.dll' IFilter.cs(82,49): error CS0433: The type 'System.Func' exists in both 'c:\Program Files (x86)\Reference Assemblies\Microsoft\Framework\v3.5\System.Core.dll' and 'c:\Windows\Microsoft.NET\Framework\v4.0.30319\mscorlib.dll' Looks like something is grabbing onto 4.0 but I'm not quite sure how to fix it. Any one else run into this?

    Read the article

  • RCov started analyzing loaded libs (including Rdoc itself) – when using rvm (Ruby Version Manager)

    - by phvalues
    Context rcov 0.9.8 2010-02-28 ruby 1.8.7 (2009-06-12 patchlevel 174) [i686-darwin10.3.0] rvm 0.1.38 by Wayne E. Seguin ([email protected]) [http://rvm.beginrescueend.com/] System Ruby (rvm use system): ruby 1.8.7 (2010-01-10 patchlevel 249) [i686-darwin10] Files The test setup is a 'lib' folder containing a single file which defines a class, the folders 'test' and 'test/sub_test', with 'sub_test' containing the single 'test_example_lib.rb' and a Rakefile like this: require 'rcov/rcovtask' task :default = [:rcov] desc "RCov" Rcov::RcovTask.new do | t | t.test_files = FileList[ 'test/**/test_*.rb' ] end Result #rake (in /Users/stephan/tmp/rcov_example) rm -r coverage Loaded suite /Users/stephan/.rvm/gems/ruby-1.8.7-p174/bin/rcov Started . Finished in 0.000508 seconds. 1 tests, 2 assertions, 0 failures, 0 errors +----------------------------------------------------+-------+-------+--------+ | File | Lines | LOC | COV | +----------------------------------------------------+-------+-------+--------+ |...ms/rcov-0.9.8/lib/rcov/code_coverage_analyzer.rb | 271 | 156 | 5.1% | |...ems/rcov-0.9.8/lib/rcov/differential_analyzer.rb | 116 | 82 | 9.8% | |lib/example_lib.rb | 16 | 11 | 72.7% | +----------------------------------------------------+-------+-------+--------+ |Total | 403 | 249 | 9.6% | +----------------------------------------------------+-------+-------+--------+ 9.6% 3 file(s) 403 Lines 249 LOC Question Why is RCov itself analysed here? I'd expect that (and it doesn't happen when using 'rvm use system'). In fact it seems to be due to me using a Ruby installed via rvm.

    Read the article

< Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >