Search Results

Search found 19495 results on 780 pages for 'xml parse'.

Page 142/780 | < Previous Page | 138 139 140 141 142 143 144 145 146 147 148 149  | Next Page >

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Java XMLRPC request-String

    - by Philip
    Hi, I'm using Apache XML-RPC 3.1.2 to talk to an online-service. They have something special, they need a hash over the whole XML with a secret key for some kind of security, like this: String hash = md5(xmlRequest + secretKey); String requestURL = "http://foo.bar/?authHash=" + hash; So I need the XML-request like this: <?xml version="1.0"?> <methodCall> <methodName>foo.bar</methodName> <params> <param> <value><struct> <member><name>bla</name> <value><int>1</int></value> </member> <member><name>blubb</name> <value><int>2</int></value> </member> </struct></value> </param> </params> </methodCall> But how do I get this String-representation of the XMLRPC-Request with the lib Apache XML-RPC?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Populate textboxes with XmlNode.Attributes

    - by Doug
    I have Data.xml: <?xml version="1.0" encoding="utf-8" ?> <data> <album> <slide title="Autum Leaves" description="Leaves from the fall of 1986" source="images/Autumn Leaves.jpg" thumbnail="images/Autumn Leaves_thumb.jpg" /> <slide title="Creek" description="Creek in Alaska" source="images/Creek.jpg" thumbnail="images/Creek_thumb.jpg" /> </album> </data> I'd like to be able to edit the attributes of each Slide node via GridView (that has a "Select" column added.) And so far I have: protected void GridView1_SelectedIndexChanged(object sender, EventArgs e) { int selectedIndex = GridView1.SelectedIndex; LoadXmlData(selectedIndex); } private void LoadXmlData(int selectedIndex) { XmlDocument xmldoc = new XmlDocument(); xmldoc.Load(MapPath(@"..\photo_gallery\Data.xml")); XmlNodeList nodelist = xmldoc.DocumentElement.ChildNodes; XmlNode xmlnode = nodelist.Item(selectedIndex); titleTextBox.Text = xmlnode.Attributes["title"].InnerText; descriptionTextBox.Text = xmlnode.Attributes["description"].InnerText; sourceTextBox.Text = xmlnode.Attributes["source"].InnerText; thumbTextBox.Text = xmlnode.Attributes["thumbnail"].InnerText; } The code for LoadXmlData is just a guess on my part - I'm new to working with xml in this way. I'd like have the user to slected the row from the gridview, then populate a set of text boxes with each slide attributed for updating back to the Data.xml file. The error I'm getting is Object reference not set to an instance of an object" at the line: titleTextBox.Text = xmlnode.Attributes["@title"].InnerText; so I'm not reaching the attribute "title" of the slide node. Thanks for any ideas you may have.

    Read the article

  • Still confuse parse JSON in GWT

    - by graybow
    Please help meee. I create a project named 'tesdb3' in eclipse. I create the PHP side to access the database, and made the output as JSON.. I create the userdata.php in folder war. then I compile tesdb3 project. Folder tesdb3 and the userdata.php in war moved in local server(I use WAMP). I put the PHP in folder tesdb3. This is the result from my localhost/phpmyadmin/tesdb3/userdata.php [{"kode":"002","nama":"bambang gentolet"},{"kode":"012","nama":"Algiz"}] From that result I think the PHP side was working good.Then I create UserData.java as JSNI overlay like this: package com.tesdb3.client; import com.google.gwt.core.client.JavaScriptObject; class UserData extends JavaScriptObject{ protected UserData() {} public final native String getKode() /*-{ return this.kode; }-*/; public final native String getNama() /*-{ return this.nama; }-*/; public final String getFullData() { return getKode() + ":" + getNama(); } } Then Finally in the tesdb3.java: public class Tesdb3 implements EntryPoint { String url= "http://localhost/phpmyadmin/tesdb3/datauser.php"; private native JsArray<UserData> getuserdata(String json) /*-{ return eval(json); }-*/; public void LoadData() throws RequestException{ RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(url)); builder.sendRequest(null, new RequestCallback(){ @Override public void onError(Request request, Throwable exception) { Window.alert("error " + exception); } public void onResponseReceived(Request request, Response response) { Window.alert("betul" + response.getText()); //data(getuserdata(response.getText())); } }); } public void data(JsArray<UserData> data){ for (int i = 0; i < data.length(); i++) { String lkode =data.get(i).getKode(); String lname =data.get(i).getNama(); Label l = new Label(lkode+" "+lname); tb.setWidget(i, 0, l); } RootPanel.get().add(new HTML("my data")); RootPanel.get().add(tb); } public void onModuleLoad() { try { LoadData(); } catch (RequestException e) { } } } The result just showing string "my data". And the Window.alert(response.getText()) showing nothing. Whyy?

    Read the article

  • Force close message when preferences are called via menu button

    - by Dan T
    I see no problem in the code. Help? preferences.xml <?xml version="1.0" encoding="utf-8"?> <PreferenceScreen xmlns:android="http://schemas.android.com/apk/res/android"> <ListPreference android:title="Gender" android:summary="Are you male or female?" android:key="genderPref" android:defaultValue="male" android:entries="@array/genderArray" android:entryValues="@array/genderValues" /> <ListPreference android:title="Weight" android:summary="How much do you weigh?" android:key="weightPref" android:defaultValue="180" android:entries="@array/weightArray" android:entryValues="@array/weightValues" /> </PreferenceScreen> arrays.xml <?xml version="1.0" encoding="utf-8"?> <resources> <string-array name="genderArray"> <item>Male</item> <item>Female</item> </string-array> <string-array name="genderValues"> <item>male</item> <item>female</item> </string-array> <string-array name="weightArray"> <item>120</item> <item>150</item> <item>180</item> <item>210</item> <item>240</item> <item>270</item> </string-array> <string-array name="weightValues"> <item>120</item> <item>150</item> <item>180</item> <item>210</item> <item>240</item> <item>270</item> </string-array> </resources> Preferences.java: package com.dantoth.drinkingbuddy; import android.os.Bundle; import android.preference.PreferenceActivity; public class Preferences extends PreferenceActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); addPreferencesFromResource(R.xml.preferences); }; } butts.xml (idk why it's butts but I've gotten used to it now. really just sets up the menu button) <?xml version="1.0" encoding="utf-8"?> <menu xmlns:android="http://schemas.android.com/apk/res/android"> <item android:id="@+id/settings" android:title="Settings" android:icon="@drawable/ic_menu_settings" /> <item android:id="@+id/archive" android:title="Archive" android:icon="@drawable/ic_menu_archive" /> <item android:id="@+id/new_session" android:title="New Session" android:icon="@drawable/ic_menu_new" /> <item android:id="@+id/about" android:title="About" android:icon="@drawable/ic_menu_about" /> </menu> within DrinkingBuddy.java: @Override public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case R.id.settings: startActivity(new Intent(this, Preferences.class)); return true; case R.id.archive: Toast.makeText(this, "Expect to see your old drinking sessions here.", Toast.LENGTH_LONG).show(); return true; //ETC. } return false; That's it. I can press the menu button on the phone and see the menu items I created, but when I click on the "Settings" (r.id.settings) it FC. Do I have to do anything to the manifest/other thing to get this to work??

    Read the article

  • Parse multiple named command line parameters

    - by scholzr
    I need to add the ability to a program to accept multiple named parameters when opening the program via the command line. i.e. program.exe /param1=value /param2=value and then be able to utilize these parameters as variables in the program. I have found a couple of ways to accomplish pieces of this, but can't seem to figure out how to put it all together. I have been able to pass one named parameter and recover it using the code below, and while I could duplicate it for every possible named parameter, I know that can't be the preffered way to do this. Dim inputArgument As String = "/input=" Dim inputName As String = "" For Each s As String In My.Application.CommandLineArgs If s.ToLower.StartsWith(inputArgument) Then inputName = s.Remove(0, inputArgument.Length) End If Next Alternatively, I can get multiple unnamed parameters from the command line using My.Application.CommandLineArgs But this requires that the parameters all be passed in the same order/format each time. I need to be able to pass a random subset of parameters each time. Ultimately, what I would like to be able to do, is separate each argument and value, and load it into a multidimentional array for later use. I know that I could find a way to do this by separating the string at the "=" and stripping the "/", but as I am somewhat new to this, I wanted to see if there was a "preffered" way for dealing with multiple named parameters?

    Read the article

  • AS2 attaching or duplicating the MC

    - by ortho
    var myXML:XML = new XML(); myXML.ignoreWhite=true; myXML.load("tekst.xml"); myXML.onLoad = function(success){ var yC:Number = 65; if (success){ var myTxt:Array = Array(0); var myNode = this.firstChild.childNodes; for (i=0; i } } var c:Number = 70 for(hiThere=1;hiThere<5;hiThere++){ kropka1.duplicateMovieClip("circleCopy"+hiThere, c); this["circleCopy"+hiThere]._y=c; c += 20; } So my problem is that I want to create it dynamicaly as text fields above, now it creates only 4 MovieClips and I would like to specify the Y value from xml file and number of loops (here 5), but it should be the same condition as loop above. Please help

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

  • Dumping an ADODB recordset to XML, then back to a recordset, then saving to the db

    - by Mark Biek
    I've created an XML file using the .Save() method of an ADODB recordset in the following manner. dim res dim objXML: Set objXML = Server.CreateObject("MSXML2.DOMDocument") 'This returns an ADODB recordset set res = ExecuteReader("SELECT * from some_table) With res Call .Save(objXML, 1) Call .Close() End With Set res = nothing Let's assume that the XML generated above then gets saved to a file. I'm able to read the XML back into a recordset like this: dim res : set res = Server.CreateObject("ADODB.recordset") res.open server.mappath("/admin/tbl_some_table.xml") And I can loop over the records without any problem. However what I really want to do is save all of the data in res to a table in a completely different database. We can assume that some_table already exists in this other database and has the exact same structure as the table I originally queried to make the XML. I started by creating a new recordset and using AddNew to add all of the rows from res to the new recordset dim outRes : set outRes = Server.CreateObject("ADODB.recordset") dim outConn : set outConn = Server.CreateObject("ADODB.Connection") dim testConnStr : testConnStr = "DRIVER={SQL Server};SERVER=dev-windows\sql2000;UID=myuser;PWD=mypass;DATABASE=Testing" outConn.open testConnStr outRes.activeconnection = outConn outRes.cursortype = adOpenDynamic outRes.locktype = adLockOptimistic outRes.source = "product_accessories" outRes.open while not res.eof outRes.addnew for i=0 to res.fields.count-1 outRes(res.fields(i).name) = res(res.fields(i).name) next outRes.movefirst res.movenext wend outRes.updatebatch But this bombs the first time I try to assign the value from res to outRes. Microsoft OLE DB Provider for ODBC Drivers error '80040e21' Multiple-step OLE DB operation generated errors. Check each OLE DB status value, if available. No work was done. Can someone tell me what I'm doing wrong or suggest a better way for me to copy the data loaded from XML to a different database?

    Read the article

  • SL4: Root element is missing

    - by Number8
    Hello, I know this has been asked elsewhere, but none of the questions or answers helped. I open an xml file in my SL 4 app: StreamResouceInfo sri = Application.GetResourceStream(new System.Uri("z.xml", UriKind.Relative)); if (null != sri) { XDocument xDoc = XDocument.Load(sri.Stream); } "Root element is missing" exception. The xml: Hmm, can't seem to post the xml... It is well-formed and valid, with a single root node and all tags closed. Thanks for any hints...

    Read the article

  • svg data visualizations

    - by garymlewis
    I'd like to experiment with SVG as a way of displaying data-driven graphs, charts, etc. The data exists as xml, and I'll use XQuery to produce the xml. What options (eg, graphics libraries) should I consider for creating the SVG from the xml? Many thanks.

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

  • When does a Tumbling Window Start in StreamInsight

    Whilst getting some courseware ready I was playing around writing some code and I decided to very simply show when a window starts and ends based on you asking for a TumblingWindow of n time units in StreamInsight.  I thought this was going to be a two second thing but what I found was something I haven’t yet found documented anywhere until now.   All this code is written in C# and will slot straight into my favourite quick-win dev tool LinqPad   Let’s first create a sample dataset   var EnumerableCollection = new [] { new {id = 1, StartTime = DateTime.Parse("2010-10-01 12:00:00 PM").ToLocalTime()}, new {id = 2, StartTime = DateTime.Parse("2010-10-01 12:20:00 PM").ToLocalTime()}, new {id = 3, StartTime = DateTime.Parse("2010-10-01 12:30:00 PM").ToLocalTime()}, new {id = 4, StartTime = DateTime.Parse("2010-10-01 12:40:00 PM").ToLocalTime()}, new {id = 5, StartTime = DateTime.Parse("2010-10-01 12:50:00 PM").ToLocalTime()}, new {id = 6, StartTime = DateTime.Parse("2010-10-01 01:00:00 PM").ToLocalTime()}, new {id = 7, StartTime = DateTime.Parse("2010-10-01 01:10:00 PM").ToLocalTime()}, new {id = 8, StartTime = DateTime.Parse("2010-10-01 02:00:00 PM").ToLocalTime()}, new {id = 9, StartTime = DateTime.Parse("2010-10-01 03:20:00 PM").ToLocalTime()}, new {id = 10, StartTime = DateTime.Parse("2010-10-01 03:30:00 PM").ToLocalTime()}, new {id = 11, StartTime = DateTime.Parse("2010-10-01 04:40:00 PM").ToLocalTime()}, new {id = 12, StartTime = DateTime.Parse("2010-10-01 04:50:00 PM").ToLocalTime()}, new {id = 13, StartTime = DateTime.Parse("2010-10-01 05:00:00 PM").ToLocalTime()}, new {id = 14, StartTime = DateTime.Parse("2010-10-01 05:10:00 PM").ToLocalTime()} };   Now let’s create a stream of point events   var inputStream = EnumerableCollection .ToPointStream(Application,evt=> PointEvent .CreateInsert(evt.StartTime,evt),AdvanceTimeSettings.StrictlyIncreasingStartTime);   Now we can create our windows over the stream.  The first window we will create is a one hour tumbling window.  We’'ll count the events in the window but what we do here is not the point, the point is our window edges.   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(1),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Now we can have a look at what we get.  I am only going to show the first non Cti event as that is enough to demonstrate what is going on   windowedStream.ToIntervalEnumerable().First(e=> e.EventKind == EventKind.Insert).Dump("First Row from Windowed Stream");   The results are below   EventKind Insert   StartTime 01/10/2010 12:00   EndTime 01/10/2010 13:00     { CountOfEntries = 5 }   Payload CountOfEntries 5   Now this makes sense and is quite often the width of window specified in examples.  So what happens if I change the windowing code now to var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(5),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()}; Now where does your window start?  What about   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromMinutes(13),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Well for the first example your window will start at 01/10/2010 10:00:00 , and for the second example it will start at  01/10/2010 11:55:00 Surprised?   Here is the reason why and thanks to the StreamInsight team for listening.   Windows start at TimeSpan.MinValue. Windows are then created from that point onwards of the size you specified in your code.  If a window contains no events they are not produced by the engine to the output.  This is why window start times can be before the first event is created.

    Read the article

  • XmlSerialize a custom collection with an Attribute

    - by roomaroo
    I've got a simple class that inherits from Collection and adds a couple of properties. I need to serialize this class to XML, but the XMLSerializer ignores my additional properties. I assume this is because of the special treatment that XMLSerializer gives ICollection and IEnumerable objects. What's the best way around this? Here's some sample code: using System.Collections.ObjectModel; using System.IO; using System.Xml.Serialization; namespace SerialiseCollection { class Program { static void Main(string[] args) { var c = new MyCollection(); c.Add("Hello"); c.Add("Goodbye"); var serializer = new XmlSerializer(typeof(MyCollection)); using (var writer = new StreamWriter("test.xml")) serializer.Serialize(writer, c); } } [XmlRoot("MyCollection")] public class MyCollection : Collection<string> { [XmlAttribute()] public string MyAttribute { get; set; } public MyCollection() { this.MyAttribute = "SerializeThis"; } } } This outputs the following XML (note MyAttribute is missing in the MyCollection element): <?xml version="1.0" encoding="utf-8"?> <MyCollection xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <string>Hello</string> <string>Goodbye</string> </MyCollection> What I want is <MyCollection MyAttribute="SerializeThis" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <string>Hello</string> <string>Goodbye</string> </MyCollection> Any ideas? The simpler the better. Thanks.

    Read the article

  • How to parse text as JavaScript?

    - by Danjah
    This question of mine (currently unanswered), drove me toward finding a better solution to what I'm attempting. My requirements: chunks of code which can be arbitrarily added into a document, without an identifier: [div class="thing"] [elements... /] [/div] the objects are scanned for and found by an external script: var things = yd.getElementsBy(function(el){ return yd.hasClass('thing'); },null,document ); the objects must be individually configurable, what I have currently is identifier-based: [div class="thing" id="thing0"] [elements... /] [script type="text/javascript"] new Thing().init({ id:'thing0'; }); [/script] [/div] So I need to ditch the identifier (id="thing0") so there are no duplicates when more than one chunk of the same code is added to a page I still need to be able to config these objects individually, without an identifier SO! All of that said, I wondered about creating a dynamic global variable within the script block of each added chunk of code, within its script tag. As each 'thing' is found, I figure it would be legit to grab the innerHTML of the script tag and somehow convert that text into a useable JS object. Discuss. Ok, don't discuss if you like, but if you get the drift then feel free to correct my wayward thinking or provide a better solution - please! d

    Read the article

  • Populating fields, input types etc using JSON

    - by Franco
    I have a form that works as follows.. Server request builds XML of the data on server side and sends xml, XSL stylesheet then transforms the XML data into the plain html page distributing the data to the relevant/desired locations of the form on the page. Person can view page and edit the populated form, submit back to DB. I think JSON is more suitable for this from what I have read. The form itself is split into 3 areas, for me this is 3 maps/associative arrays etc each with a name related to the id of an input element etc. The problem for me comes with having the JSON sent to the page, what should I do with it next in order to achieve the same result as I currently get with XML and XSL. Thanks.

    Read the article

  • Using XPath on String in Android (JAVA)

    - by Rav
    I am looking for some examples of using xpath in Android? Or if anyone can share their experiences. I have been struggeling to make tail or head of this problem :-( I have a string that contains a standard xml file. I believe I need to convert that into an xml document. I have found this code which I think will do the trick: public static Document stringToDom(String xmlSource) throws SAXException, ParserConfigurationException, IOException { DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance(); DocumentBuilder builder = factory.newDocumentBuilder(); return builder.parse(new InputSource(new StringReader(xmlSource))); } Next steps Assuming the code above is OK, I need to apply xpath to get values from cat: "/animal/mammal/feline/cat" I look at the dev doc here: http://developer.android.com/reference/javax/xml/xpath/XPath.html and also look online, but I am not sure where to start! I have tried to use the following code: XPathFactory xPathFactory = XPathFactory.newInstance(); // To get an instance of the XPathFactory object itself. XPath xPath = xPathFactory.newXPath(); // Create an instance of XPath from the factory class. String expression = "SomeXPathExpression"; XPathExpression xPathExpression = xPath.compile(expression); // Compile the expression to get a XPathExpression object. Object result = xPathExpression.evaluate(xmlDocument); // Evaluate the expression against the XML Document to get the result. But I get "Cannot be resolved". Eclipse doesn't seem to be able to fix this import. I tried manually entering: javax.xml.xpath.XPath But this did not work. Does anyone know any good source code that I can utilise, for Android platform? 1.5

    Read the article

  • How to parse a url string using mvc2 routes

    - by Lavinski
    If I have a url http://www.site.com/controllerA/actionB/idC how can i extract the RouteValueDictionary where the item with the key controller would have the value of controllerA. Note this isn't for testing so I don't want to use mocking and the solution here does not seem to be working.

    Read the article

< Previous Page | 138 139 140 141 142 143 144 145 146 147 148 149  | Next Page >