Search Results

Search found 19495 results on 780 pages for 'xml parse'.

Page 142/780 | < Previous Page | 138 139 140 141 142 143 144 145 146 147 148 149  | Next Page >

  • Xsl mime type problem

    - by savruk
    Hi, I have a busybox with lighttpd running on as http server. My problem is while firefox and opera can get the page with applied xsl, Arora(webkit) can not. Here is the script I use to get it work: <html> <head> <script> function loadXMLDoc(dname) { if (window.XMLHttpRequest) { xhttp=new XMLHttpRequest(); } else { xhttp=new ActiveXObject("Microsoft.XMLHTTP"); } xhttp.open("GET",dname,false); xhttp.send(""); return xhttp.responseXML; } function querySt(ji) { hu = window.location.search.substring(1); gy = hu.split("&"); for (i=0;i<gy.length;i++) { ft = gy[i].split("="); if (ft[0] == ji) { return ft[1]; } } } function displayResult() { xml=loadXMLDoc("sample.xml"); alert(xml)//Gives [object Document] $scan=querySt("scan"); $sub = querySt("sub"); xsl=loadXMLDoc("sample.xsl"); alert(xsl)//Gives Null // code for IE if (window.ActiveXObject) { ex=xml.transformNode(xsl); document.getElementById("example").innerHTML=ex; } // code for Mozilla, Firefox, Opera, etc. else if (document.implementation && document.implementation.createDocument) { xsltProcessor=new XSLTProcessor(); xsltProcessor.importStylesheet(xsl); xsltProcessor.setParameter(null,"scan",$scan) if($sub != ""){ xsltProcessor.setParameter(null,"sub",$sub) } resultDocument = xsltProcessor.transformToFragment(xml,document); document.getElementById("example").appendChild(resultDocument); } } </script> </head> <body onload="displayResult()"> <div id="example" ></div> </body> </html> I tried to see if it load xsl well and put an alert(xsl) but it gives null. Other browser can get xml and xsl files perfectly. What can be the problem? Thanks P.S: It runs well on my local server with all browser.

    Read the article

  • Dumping an ADODB recordset to XML, then back to a recordset, then saving to the db

    - by Mark Biek
    I've created an XML file using the .Save() method of an ADODB recordset in the following manner. dim res dim objXML: Set objXML = Server.CreateObject("MSXML2.DOMDocument") 'This returns an ADODB recordset set res = ExecuteReader("SELECT * from some_table) With res Call .Save(objXML, 1) Call .Close() End With Set res = nothing Let's assume that the XML generated above then gets saved to a file. I'm able to read the XML back into a recordset like this: dim res : set res = Server.CreateObject("ADODB.recordset") res.open server.mappath("/admin/tbl_some_table.xml") And I can loop over the records without any problem. However what I really want to do is save all of the data in res to a table in a completely different database. We can assume that some_table already exists in this other database and has the exact same structure as the table I originally queried to make the XML. I started by creating a new recordset and using AddNew to add all of the rows from res to the new recordset dim outRes : set outRes = Server.CreateObject("ADODB.recordset") dim outConn : set outConn = Server.CreateObject("ADODB.Connection") dim testConnStr : testConnStr = "DRIVER={SQL Server};SERVER=dev-windows\sql2000;UID=myuser;PWD=mypass;DATABASE=Testing" outConn.open testConnStr outRes.activeconnection = outConn outRes.cursortype = adOpenDynamic outRes.locktype = adLockOptimistic outRes.source = "product_accessories" outRes.open while not res.eof outRes.addnew for i=0 to res.fields.count-1 outRes(res.fields(i).name) = res(res.fields(i).name) next outRes.movefirst res.movenext wend outRes.updatebatch But this bombs the first time I try to assign the value from res to outRes. Microsoft OLE DB Provider for ODBC Drivers error '80040e21' Multiple-step OLE DB operation generated errors. Check each OLE DB status value, if available. No work was done. Can someone tell me what I'm doing wrong or suggest a better way for me to copy the data loaded from XML to a different database?

    Read the article

  • jQuery: How to parse a multidemensional array?

    - by Allen G
    I'm not sure if the array is too deep or what, but I can't seem to get anything other than the keys and undefines. Help please! I'm using Codeigniter for development. Here is the PHP then the jQuery: $term = $this->input->post('search_term'); $this->db->like('book_title', $term); $search_query = $this->db->get('books'); $return = array(); $i = 0; if ($search_query->num_rows() > 1) { foreach($search_query->result() as $s) { $return['books']['book_id'] = $s->book_id; $return['books']['book_title'] = $s->book_title; $return['books']['book_price'] = $s->book_price; $i++; } } elseif ($search_query->num_rows() == 1) { echo 1; $i = 0; $return['book_id'] = $search_query->row('book_id'); $return['book_title'] = $search_query->row('book_title'); $return['book_price'] = $search_query->row('book_price'); } elseif ($search_query->num_rows() == 0) { echo 0; } echo json_encode($return); $("#search").change(function() { var searchTerm = $(this).val(); $.post("/contentcreator/search_by_term", { search_term: searchTerm }, function(data) { $("#book_scroller").empty(); var lengthHolder = data.books; for (var i = 0; i data.books.length; i++) { var row = '<li id="book_item_' + l + '">' + data.books['book_title'] +'</li>'; $("#book_scroller").append(row); }; i++; }, "json"); }); Thanks!

    Read the article

  • Force close message when preferences are called via menu button

    - by Dan T
    I see no problem in the code. Help? preferences.xml <?xml version="1.0" encoding="utf-8"?> <PreferenceScreen xmlns:android="http://schemas.android.com/apk/res/android"> <ListPreference android:title="Gender" android:summary="Are you male or female?" android:key="genderPref" android:defaultValue="male" android:entries="@array/genderArray" android:entryValues="@array/genderValues" /> <ListPreference android:title="Weight" android:summary="How much do you weigh?" android:key="weightPref" android:defaultValue="180" android:entries="@array/weightArray" android:entryValues="@array/weightValues" /> </PreferenceScreen> arrays.xml <?xml version="1.0" encoding="utf-8"?> <resources> <string-array name="genderArray"> <item>Male</item> <item>Female</item> </string-array> <string-array name="genderValues"> <item>male</item> <item>female</item> </string-array> <string-array name="weightArray"> <item>120</item> <item>150</item> <item>180</item> <item>210</item> <item>240</item> <item>270</item> </string-array> <string-array name="weightValues"> <item>120</item> <item>150</item> <item>180</item> <item>210</item> <item>240</item> <item>270</item> </string-array> </resources> Preferences.java: package com.dantoth.drinkingbuddy; import android.os.Bundle; import android.preference.PreferenceActivity; public class Preferences extends PreferenceActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); addPreferencesFromResource(R.xml.preferences); }; } butts.xml (idk why it's butts but I've gotten used to it now. really just sets up the menu button) <?xml version="1.0" encoding="utf-8"?> <menu xmlns:android="http://schemas.android.com/apk/res/android"> <item android:id="@+id/settings" android:title="Settings" android:icon="@drawable/ic_menu_settings" /> <item android:id="@+id/archive" android:title="Archive" android:icon="@drawable/ic_menu_archive" /> <item android:id="@+id/new_session" android:title="New Session" android:icon="@drawable/ic_menu_new" /> <item android:id="@+id/about" android:title="About" android:icon="@drawable/ic_menu_about" /> </menu> within DrinkingBuddy.java: @Override public boolean onOptionsItemSelected(MenuItem item) { switch (item.getItemId()) { case R.id.settings: startActivity(new Intent(this, Preferences.class)); return true; case R.id.archive: Toast.makeText(this, "Expect to see your old drinking sessions here.", Toast.LENGTH_LONG).show(); return true; //ETC. } return false; That's it. I can press the menu button on the phone and see the menu items I created, but when I click on the "Settings" (r.id.settings) it FC. Do I have to do anything to the manifest/other thing to get this to work??

    Read the article

  • svg data visualizations

    - by garymlewis
    I'd like to experiment with SVG as a way of displaying data-driven graphs, charts, etc. The data exists as xml, and I'll use XQuery to produce the xml. What options (eg, graphics libraries) should I consider for creating the SVG from the xml? Many thanks.

    Read the article

  • AS2 attaching or duplicating the MC

    - by ortho
    var myXML:XML = new XML(); myXML.ignoreWhite=true; myXML.load("tekst.xml"); myXML.onLoad = function(success){ var yC:Number = 65; if (success){ var myTxt:Array = Array(0); var myNode = this.firstChild.childNodes; for (i=0; i } } var c:Number = 70 for(hiThere=1;hiThere<5;hiThere++){ kropka1.duplicateMovieClip("circleCopy"+hiThere, c); this["circleCopy"+hiThere]._y=c; c += 20; } So my problem is that I want to create it dynamicaly as text fields above, now it creates only 4 MovieClips and I would like to specify the Y value from xml file and number of loops (here 5), but it should be the same condition as loop above. Please help

    Read the article

  • Still confuse parse JSON in GWT

    - by graybow
    Please help meee. I create a project named 'tesdb3' in eclipse. I create the PHP side to access the database, and made the output as JSON.. I create the userdata.php in folder war. then I compile tesdb3 project. Folder tesdb3 and the userdata.php in war moved in local server(I use WAMP). I put the PHP in folder tesdb3. This is the result from my localhost/phpmyadmin/tesdb3/userdata.php [{"kode":"002","nama":"bambang gentolet"},{"kode":"012","nama":"Algiz"}] From that result I think the PHP side was working good.Then I create UserData.java as JSNI overlay like this: package com.tesdb3.client; import com.google.gwt.core.client.JavaScriptObject; class UserData extends JavaScriptObject{ protected UserData() {} public final native String getKode() /*-{ return this.kode; }-*/; public final native String getNama() /*-{ return this.nama; }-*/; public final String getFullData() { return getKode() + ":" + getNama(); } } Then Finally in the tesdb3.java: public class Tesdb3 implements EntryPoint { String url= "http://localhost/phpmyadmin/tesdb3/datauser.php"; private native JsArray<UserData> getuserdata(String json) /*-{ return eval(json); }-*/; public void LoadData() throws RequestException{ RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(url)); builder.sendRequest(null, new RequestCallback(){ @Override public void onError(Request request, Throwable exception) { Window.alert("error " + exception); } public void onResponseReceived(Request request, Response response) { Window.alert("betul" + response.getText()); //data(getuserdata(response.getText())); } }); } public void data(JsArray<UserData> data){ for (int i = 0; i < data.length(); i++) { String lkode =data.get(i).getKode(); String lname =data.get(i).getNama(); Label l = new Label(lkode+" "+lname); tb.setWidget(i, 0, l); } RootPanel.get().add(new HTML("my data")); RootPanel.get().add(tb); } public void onModuleLoad() { try { LoadData(); } catch (RequestException e) { } } } The result just showing string "my data". And the Window.alert(response.getText()) showing nothing. Whyy?

    Read the article

  • SL4: Root element is missing

    - by Number8
    Hello, I know this has been asked elsewhere, but none of the questions or answers helped. I open an xml file in my SL 4 app: StreamResouceInfo sri = Application.GetResourceStream(new System.Uri("z.xml", UriKind.Relative)); if (null != sri) { XDocument xDoc = XDocument.Load(sri.Stream); } "Root element is missing" exception. The xml: Hmm, can't seem to post the xml... It is well-formed and valid, with a single root node and all tags closed. Thanks for any hints...

    Read the article

  • XmlSerialize a custom collection with an Attribute

    - by roomaroo
    I've got a simple class that inherits from Collection and adds a couple of properties. I need to serialize this class to XML, but the XMLSerializer ignores my additional properties. I assume this is because of the special treatment that XMLSerializer gives ICollection and IEnumerable objects. What's the best way around this? Here's some sample code: using System.Collections.ObjectModel; using System.IO; using System.Xml.Serialization; namespace SerialiseCollection { class Program { static void Main(string[] args) { var c = new MyCollection(); c.Add("Hello"); c.Add("Goodbye"); var serializer = new XmlSerializer(typeof(MyCollection)); using (var writer = new StreamWriter("test.xml")) serializer.Serialize(writer, c); } } [XmlRoot("MyCollection")] public class MyCollection : Collection<string> { [XmlAttribute()] public string MyAttribute { get; set; } public MyCollection() { this.MyAttribute = "SerializeThis"; } } } This outputs the following XML (note MyAttribute is missing in the MyCollection element): <?xml version="1.0" encoding="utf-8"?> <MyCollection xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <string>Hello</string> <string>Goodbye</string> </MyCollection> What I want is <MyCollection MyAttribute="SerializeThis" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <string>Hello</string> <string>Goodbye</string> </MyCollection> Any ideas? The simpler the better. Thanks.

    Read the article

  • Switching languages on a website with PHP

    - by jnkrois
    Hello everybody, I'm just looking for some advice. I'm creating a website that offers (at least) 2 languages. The way I'm setting it up is by using XML files for the language, PHP to retrieve the values in the XML nodes. Say you have any XML file, being loaded as follows: <?php $lang = "en"; $xmlFile = simplexml_load_file("$lang/main.xml"); ?> Once the file contents are available, I just output each node into an HTML tag like so: <li><?php echo $xmlFile->navigation->home; ?></li> which in turn is equal to : <li><a href="#">Home</a></li> as a nav bar link. Now, the way in which I'm switching languages is by changing the value of the "$lang" variable, through a "$_POST", like so: if(isset($_POST['es'])){ $lang = "es"; }elseif(isset($_POST['en'])){ $lang = "en"; } The value of the "$lang" variable is reset and the new file is loaded, loading as well all the new nodes from the new XML file, hence changing the language. I'm just wondering if there is another way to reset the "$lang" variable using something else, other than "$_POST" or "$_GET". I don't want to use query string either. I know I could use JavaScript or jQuery to achieve this, but I'd like to make the site not too dependable on JavaScript. I'd appreciate any ideas or advice. Thanks

    Read the article

  • How can i call an XSL template within a hyperlink in the XSL stylesheet

    - by AdRock
    I am making my own XSL stylesheet which will perform different views on the same XML document Because the XML document is so large, i would like some links at the top of the outputted page to call each template that will be used to display the data. At the moment I can create links that use anchors to a place in the document but it would be better if i just call each template as needed. How can i just call each template in a link? Would i have to use xlink? <?xml version="1.0" encoding="ISO-8859-1"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:template match="folktask"> <html> <body> <a href="folk.xml#organisers">Show all the users</a> <a href="folk.xml#organisers">Show all the festival organisers</a> <xsl:call-template name="show_all_users" /> <xsl:call-template name="show_all_organisers" /> </body> </html> </xsl:template> </xsl:stylesheet>

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

  • Is there a good Open Source, XSD based Web Editor?

    - by ashansky
    I'm looking for a good open source web editor that will take xsd (or some other standard XML) and from that generate web forms that will enable the end user to generate standard xml (without knowing anything about xml obliviously). I took a look at kupu, but there doesn't seem to be much documentation and the site appears to no longer exist. Is there anything out there that does this already. I could write something like this myself, but if there's something that out there that will save me some time that would be great. Thanks

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • How can I read/write data from a file?

    - by samy
    I'm writing a simple chrome extension. I need to create the ability to add sites URLs to a list, or read from the list. I use the list to open the sites in the new tabs. I'm looking for a way to have a data file I can write to, and read from. I was thinking on XML. I read there is a problem changing the content of files with Javascript. Is XML the right choice for this kinda thing? I should add that there is no web server, and the app will run locally, so maybe the problem websites are having are not same as this. Before I wrote this question, I tried one thing, and started to feel insecure because it didn't work. I made a XML file called Site.xml: <?xml version="1.0" encoding="utf-8" ?> <Sites> <site> <url> http://www.sulamacademy.com/AddMsgForum.asp?FType=273171&SBLang=0&WSUAccess=0&LocSBID=20375 </url> </site> <site> <url> http://www.wow.co.il </url> </site> <site> <url> http://www.Google.co.il </url> </site> I made this script to read the data from him, and put in on the html file. function LoadXML() { var ajaxObj = new XMLHttpRequest(); ajaxObj.open('GET', 'Sites.xml', false); ajaxObj.send(); var myXML = ajaxObj.responseXML; document.write('<table border="2">'); var prs = myXML.getElementsByTagName("site"); for (i = 0; i < prs.length; i++) { document.write("<tr><td>"); document.write(prs[i].getElementsByName("url")[0].childNode[0].nodeValue); document.write("</td></tr>"); } document.write("</table"); }

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Find/parse server-side <?abc?>-like tags in html document

    - by Iggyhopper
    I guess I need some regex help. I want to find all tags like <?abc?> so that I can replace it with whatever the results are for the code ran inside. I just need help regexing the tag/code string, not parsing the code inside :p. <b><?abc print 'test' ?></b> would result in <b>test</b> Edit: Not specifically but in general, matching (<?[chars] (code group) ?>)

    Read the article

  • Populating fields, input types etc using JSON

    - by Franco
    I have a form that works as follows.. Server request builds XML of the data on server side and sends xml, XSL stylesheet then transforms the XML data into the plain html page distributing the data to the relevant/desired locations of the form on the page. Person can view page and edit the populated form, submit back to DB. I think JSON is more suitable for this from what I have read. The form itself is split into 3 areas, for me this is 3 maps/associative arrays etc each with a name related to the id of an input element etc. The problem for me comes with having the JSON sent to the page, what should I do with it next in order to achieve the same result as I currently get with XML and XSL. Thanks.

    Read the article

  • How to parse a url string using mvc2 routes

    - by Lavinski
    If I have a url http://www.site.com/controllerA/actionB/idC how can i extract the RouteValueDictionary where the item with the key controller would have the value of controllerA. Note this isn't for testing so I don't want to use mocking and the solution here does not seem to be working.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • NSString writeToFile operation couldn't be completed

    - by Chonch
    Hey, I have an xml file in my application bundle. I want to copy it to the documents folder at installation and then, every time the app launches, get the newest version of this file from the Internet. I use this code: // Check if the file exists in the documents folder NSString *documentsPath = [NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES) objectAtIndex:0]; if (![[NSFileManager defaultManager] fileExistsAtPath:[documentsPath stringByAppendingPathComponent:@"fileName.xml"]]) // If not, copy it there (from the bundle) [[NSFileManager defaultManager] copyItemAtPath:[[[NSBundle mainBundle] resourcePath] stringByAppendingPathComponent:@"OriginalFile.xml"] toPath:[documentsPath stringByAppendingPathComponent:@"fileName.xml"] error:nil]; // Get the newest version of the file from the server NSURL *url=[[NSURL alloc] initWithString:@"http://www.sitename.com/webservice.asmx/webserviceName"]; NSString *results = [[NSString alloc] initWithContentsOfURL:url]; // Replace the current version with the newest one, only if it is valid if (results != nil) [results writeToFile:[documentsPath stringByAppendingPathComponent:@"fileName.xml"] atomically:NO encoding:NSStringEncodingConversionAllowLossy error:nil]; The problem is that the writeToFile command always returns NO and the file's contents remain identical to the original file I included in my app bundle. I checked the value of results and it's correct. I also made sure that the app does perform the writeToString command, but still, it always returns NO. Can anybody tell me what I'm doing wrong? Thanks,

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

< Previous Page | 138 139 140 141 142 143 144 145 146 147 148 149  | Next Page >