Search Results

Search found 6257 results on 251 pages for 'columns'.

Page 145/251 | < Previous Page | 141 142 143 144 145 146 147 148 149 150 151 152  | Next Page >

  • Convert SQL Query results to Active Directory Groups

    - by antgiant
    Are there any quality products (ideally open source) that allow me to run an arbitrary SQL query that results in 2 columns (username, group name) and they adds that username in AD to a group of that name in AD? If the username doesn't exist it is ignored. If the group name doesn't exist ideally it gets created. Updated for Clarity: I have a MSSQL based system that is the authoritative source for some of the Active Directory Security groups, and their members. I want to be able to to have those Active Directory Security Groups populated by a one-way sync originating from MSSQL. Sadly the MSSQL based system does not have a good API, so I will have to do this with direct SQL calls. Is there anything that does this well?

    Read the article

  • Macro - maintain paste link if new row is added to master spreadsheet

    - by Ross McLaughlin
    I have a master spreadsheet that has a portion of data (say columns a to e) that paste links to a report. Each row paste links to its own report. If I add a new row to the master spreadsheet I now have the wrong data linking into my reports. I know if I have the reports open when a change is made to the master it will update the reports. However, with the number of reports I will soon have this will no longer be practical. Is there a macro or formula that can be added to maintain the correct data link. I have no real knowledge on such matters and as much information as possible would be greatly appreciated. Many thanks in advance.

    Read the article

  • What is the best free or low-cost Java reporting library (e.g. BIRT, JasperReports, etc.) for making

    - by Max3000
    I want to print, email and write to PDF very simple reports. The reports are basically a list of items, divided in various sections/columns. The sections are not necessarily identical. Think newspaper. I just wasted a solid 2 days of work trying to make this kind of reports using JasperReports. I find that Jasper is great for outputing "normalized" data. The kind that would come out of a database for instance, each row neatly describing an item and each item printed on a line. I'm simplifying a bit but that's the idea. However, given what I want to do I always ended up completely lost. Data not being displayed for no apparent reason, columns of texts never the correct size, column positioning always ending up incorrect, pagination not sanely possible (I was never able to figure it out; the FAQ gives an obscure workaround), etc. I came to the conclusion that Jasper is really not built to make the kind of reports I want. Am I missing something? I'm ready to pay for a tool, as long as the price is reasonable. By reasonable I mean a few $100s. Thanks. EDIT: To answer cetus, here is more information about the report I made in Jasper. What I want is something like this: text text text text ------------------- text | text text |---------- text | text text | text --------| text text |---------- text | text What I made in jasper is this: (detail band) subreport | subreport ------------------------------------ subreport | subreport ------------------------------------ subreport | subreport The subreports are all the same actual report. This report has one field (called "field") and basically just prints this field in a detail band. Hence, running a single subreport simply lists all items from the datasource. The datasource itself is a simple custom JRDatasource containing a collection of strings in the field "field". The datasource iterates over the collection until there are no more strings. Each subreport has its own datasource. I tried many different variations of the above, with all sorts of different properties for the report, subreports, etc. IMO, this is fairly simple stuff. However, the problems I encounter are as follows: Subreports starting from the 3rd don't show up when their position type is 'float'. They do show up when they have 'fix relative to top'. However, I don't want to do this because the first two subreports can be of any length. I can't make each subreport to stretch according to its own length. Instead, they either don't stretch at all (which is not desirable because they have different lenghts) or they stretch according to the longest subreport. This makes a weird layout for sure. Pagination doesn't happen. If some subreports fall outside the page, they simple don't show. One alternative is to increase the 'page height' considerably and the 'detail band height' accordingly. However, in this case it is not really possibly to know the total height in advance. So I'm stuck with calculating/guessing it myself, before the report is even generated. More importantly, long reports end up on one page and this is not acceptable (the printout text is too small, it's ugly/non-professional to have different reports with different PDF page lengths, etc.). BTW, I used iReport so it's possibly limitations of iReport I'm listing here and not of Jasper itself. That's one of the things I'm trying to find out asking this question here. One alternative would be to generate the jrxml myself with just static text but I'm afraid I'll encounter the very same limitations. Anyway, I just generally wasted so much time getting anything done with Jasper that I can't help thinking its not the right tool for the job. (Not to say that Jasper doesn't excel in what it's good at).

    Read the article

  • Create a super user in MySQL 5.5 not working: Permission denied for root@localhost

    - by GHarping
    Using CentOS 6, logged in to MySQL as root, entering the command: create user 'user123' identified by 'pass123'; works fine. But when I try and give that user super user privileges with: grant all on *.* to 'user123' identified by 'pass123'; I get the error: ERROR 1045 (28000): Access denied for user 'root'@'localhost' (using password: YES) Then select * from mysql.user; shows that root has Y in all columns, so should have all privileges. I'd be very grateful if anyone could help me find why root is unable to grant privileges as I can't see why it wouldn't be working. Thanks

    Read the article

  • Ranking tables from Excel data

    - by Joe
    Hi all (asking here because this meta question told me to). I have some data in an excel spreadsheet here. It's no more than a table with about five columns. Year Purchased Manufacturer Model Num Unit Price Total Price 2007 SMARTBOX FuturePad XP 1 £2,915.00 £2,915.00 2007 Attainment Company Inc Go Talk 9+ 1 £104.00 £104.00 2007 Attainment Company Inc Go Talk 20+ 1 £114.00 £114.00 I'd like to be able to build a 'top ten' of either manufacturers or models (and I'd like to be able to do it by either most mentioned, most sales, or highest value of sales) - but I've got no idea what the best method is in excel. Any suggestions...? The ideal output might be a set of sells that says something like Company Units A 5342 B 232 C 2 D 1

    Read the article

  • Comparing two strings in excel, add value for common variables

    - by overtime
    I'm comparing two large datasets containing strings in excel. Column A contains the numbers 1-1,000,000. Column B contains 1,000,000 strings, neatly organized in the desired order. Column C contains 100,000 randomly organized strings, that have identical values somewhere in column B. Example: A B C D 1 String1 String642 2 String2 String11 3 String3 String8000 4 String4 String78 What I'd like to do is find duplicate values in columns B and C then output the Column A value that corresponds with the string in Column C into Column D. Desired Output: A B C D 1 String1 String642 642 2 String2 String11 11 3 String3 String8000 8000 4 String4 String78 78

    Read the article

  • Excel - Disable AutoFormatting on Import

    - by Philip Wales
    How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

    Read the article

  • how to call javascript function

    - by Manu Jaggi
    when i click on the textbox which is inside the item template of gridview then onclick event should fire and then call the javascript function but my problem is that there no onclick event option in item template's textbox plz hel p me. <asp:GridView ID="GridView2" runat="server" AutoGenerateColumns="False" OnRowCommand="GridView2_RowCommand" Width="100%" GridLines="None" style="font-family: Tahoma; font-size: xx-small" Font-Names="Tahoma" Font-Size="XX-Small"> <Columns> <asp:BoundField HeaderText="Status" DataField="Status" HeaderStyle-HorizontalAlign="Left" ItemStyle-HorizontalAlign="Left"> <HeaderStyle HorizontalAlign="Left"></HeaderStyle> <ItemStyle HorizontalAlign="Left"></ItemStyle> </asp:BoundField> <asp:TemplateField HeaderText="Order" > <ItemTemplate> <asp:TextBox ID="TextBox1" Text='<%#Eval("ArticleOrder")%>' ReadOnly="true" runat="server" Height="18px" Width="16px" onclick="hello();" > </asp:TextBox> </ItemTemplate> <HeaderStyle HorizontalAlign="Left" /> </asp:TemplateField> <%--<asp:BoundField HeaderText="Order" DataField="ArticleOrder" HeaderStyle-HorizontalAlign="Center" ItemStyle-HorizontalAlign="Center"> <HeaderStyle HorizontalAlign="Center"></HeaderStyle> <ItemStyle HorizontalAlign="Center"></ItemStyle> </asp:BoundField>--%> <asp:BoundField HeaderText="Title" DataField="ArticleTitle" HeaderStyle-HorizontalAlign="Left" ItemStyle-HorizontalAlign="Left"> <HeaderStyle HorizontalAlign="Left"></HeaderStyle> <ItemStyle HorizontalAlign="Left"></ItemStyle> </asp:BoundField> <asp:TemplateField HeaderText="Edit" HeaderStyle-HorizontalAlign="Center" ItemStyle-HorizontalAlign="Center"> <ItemTemplate> <asp:ImageButton ID="ImageButtonedt" runat="server" ImageUrl="~/images/newspaper_go.png" CommandName="edt" CommandArgument='<%#Eval("ArticleID")%>' /> </ItemTemplate> <HeaderStyle HorizontalAlign="Center"></HeaderStyle> <ItemStyle HorizontalAlign="Center"></ItemStyle> </asp:TemplateField> <asp:TemplateField HeaderText="Delete" HeaderStyle-HorizontalAlign="Center" ItemStyle-HorizontalAlign="Center"> <ItemTemplate> <asp:ImageButton ID="ImageButtondel" runat="server" ImageUrl="~/images/newspaper_delete.png" CommandName="del" OnClientClick='return confirm("Are you sure you want to delete ?");' CommandArgument='<%#Eval("ArticleID")%>' /> </ItemTemplate> <HeaderStyle HorizontalAlign="Center"></HeaderStyle> <ItemStyle HorizontalAlign="Center"></ItemStyle> </asp:TemplateField> </Columns> </asp:GridView> javascript function: hello() { var divName = document.getElementById('div1'); var divFade = document.getElementById('fade'); divName.style.display = 'block'; divFade.style.display = 'block'; }

    Read the article

  • Are there any Spreadsheet apps that are as easy and powerful to use as Vim?

    - by ovatsug25
    I'd like to use a spreadsheet that lets me move around cells like I do in Vim. As well, the more commands that are attributed to keyboard shortcuts, the better. Particularly stuff like making Text-to-Columns which is one of my more frequently used features in Excel. I don't mind learning the shortcuts if they allow me to just look at the spreadsheet page and forget about everything else. edit: The way I am thinking about the Spreadsheet right now is as if every cell is its own unique file. There should be a command where I choose to open that file and edit it right on the spot within the view of the spreadsheet. So I guess I want different modes like in vim which have commands and there should be one mode that is hooked up just to do operations or formatting which would be similar to command mode in Vim.

    Read the article

  • Using pivot tables to group transactions

    - by andreas
    I have my bank account statement and what I would like to do is group the descriptions of the transactions together with their debit or credit and sum their total. I could then see that, e.g., for ebay.com my total debit was $2000, etc. Description Debit Credit A 1 B 1 A 1 B 1 C 1 D 1 A 1 What I want to do is use a pivot table Description Debit Credit A 3 B 2 C 1 D 1 I am no able to do that, as I can't group the description and have additional debit and credit columns -- I get them all in rows with blanks.

    Read the article

  • Unique string values in range

    - by Dean Smith
    I have some spreadsheets where there are large number of cells that have essentially been used for free text. There is a finite set of values for this free text and most, if not all repeat. eg. A B C D 1 Monkey Gorilla Cat Dog 2 Dog Cat Gorilla Gorilla 3 Dog Dog Dog Cat There are probably 50 or so different cell values spread over multiple sheets and hundreds of rows and columns. I need to analyse this data and count occurancies, which is not a problem other than getting a list of unique values to start with and this has been driving me up the wall. What is the best way to produce this list. So from the above we would have Monkey Dog Cat Gorilla In order of preferred solutions, as this will need to be done monthly. Dynamic formula based VB Script Other ( Advanced filtering or other manual steps )

    Read the article

  • Finding throuput of CPU and Hardrive on Solaris

    - by Jim
    How do I find the throughput of a CPU and the hard disk on an OpenSolaris machine? Using mpstat or iostat? I'm having a hard time identifying the throughput if it is given at all in the commands output. For example, in mpstat there is very little explanation as to what the columns mean. I've been using the syscl column divided by time interval to find the throughput but to be honest I have no idea what a system call truly is. I'm trying to to analyze a hardrive and CPU while writing a file to the hardisk and when at rest.

    Read the article

  • Set an Excel cell's color based on multiple other cells' colors

    - by Lord Torgamus
    I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

    Read the article

  • How can i lock images to a cell in excel 2010

    - by Jamie
    Ok, so i am using microsoft excel 2010 and have a set up currently where i have 2 views expanded and deflated using the Group or +/- function. My problem is that ui have images on the workbook too. The images are over the cells which are to be "hidden" when the - button is pressed and i would like the images to disappear with them. This is not curently happening instead they are moving to the next visible cell. I have included an example below incase i wasn't clear. I wish to hide Columns M:AU and the images are in various cells suchas N5 and O5. When i colapse (hide) the column range all of the images move to "AV5" the next row along that isn't hidden. This means the workbooks is looking messy when colapsed which is the oposite of what i was trying to do. Can anyone advise on a way around this?

    Read the article

  • Windows 7 Enterprise, Service Pack 1. Software MS Office Excel 2010

    - by user327560
    In Excel I understand there is no mechanism to customise & re-label the Rows & Columns (i.e. Renaming Col. A to some text like "Item Number" and so on. My question is regarding if it's possible to start Row Numbering at zero, or to determine a pre-allocated number of rows which contain my Headers, and then the first Row with the detail is infact seen as Row 1? Reason for question is I work multiple INternational Projects and we use Excel to trsack alot of activities & issues. Oddly, many people will refer to, for example "Point 7"... Some people mean the ID 7 (which I have the first Column dedicated to ID Number), some mean Excel Row 7, which infact could be really ID 3, or 4 from Col. A.... Any easy way or workaround to just use the Excel Row Numbers but select from when Row 1 is counted?

    Read the article

  • Source File not updating Destination Files in Excel

    - by user127105
    I have one source file that holds all my input costs. I then have 30 to 40 destination files (costing sheets) that use links to data in this source file for their various formulae. I was sure when I started this system that any changes I made to the source file, including the insertion of new rows and columns was updated automatically by the destination files, such that the formula always pulled the correct input costs. Now all of a sudden if my destination files are closed and I change the structure of the source file by adding rows - the destination files go haywire? They pick up changes to their linked cells, but don't pick up changes to the source sheet that have shifted their relative positions in the sheet. Do I really need to open all 40 destination files at the same time I alter the source file structure? Further info: all the destination files are protected, and I am working on DropBox.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Many to many self join through junction table

    - by Peter
    I have an EF model that can self-reference through an intermediary class to define a parent/child relationship. I know how to do a pure many-to-many relationship using the Map command, but for some reason going through this intermediary class is causing problems with my mappings. The intermediary class provides additional properties for the relationship. See the classes, modelBinder logic and error below: public class Equipment { [Key] public int EquipmentId { get; set; } public virtual List<ChildRecord> Parents { get; set; } public virtual List<ChildRecord> Children { get; set; } } public class ChildRecord { [Key] public int ChildId { get; set; } [Required] public int Quantity { get; set; } [Required] public Equipment Parent { get; set; } [Required] public Equipment Child { get; set; } } I've tried building the mappings in both directions, though I only keep one set in at a time: modelBuilder.Entity<ChildRecord>() .HasRequired(x => x.Parent) .WithMany(x => x.Children ) .WillCascadeOnDelete(false); modelBuilder.Entity<ChildRecord>() .HasRequired(x => x.Child) .WithMany(x => x.Parents) .WillCascadeOnDelete(false); OR modelBuilder.Entity<Equipment>() .HasMany(x => x.Parents) .WithRequired(x => x.Child) .WillCascadeOnDelete(false); modelBuilder.Entity<Equipment>() .HasMany(x => x.Children) .WithRequired(x => x.Parent) .WillCascadeOnDelete(false); Regardless of which set I use, I get the error: The foreign key component 'Child' is not a declared property on type 'ChildRecord'. Verify that it has not been explicitly excluded from the model and that it is a valid primitive property. when I try do deploy my ef model to the database. If I build it without the modelBinder logic in place then I get two ID columns for Child and two ID columns for Parent in my ChildRecord table. This makes sense since it tries to auto create the navigation properties from Equipment and doesn't know that there are already properties in ChildRecord to fulfill this need. I tried using Data Annotations on the class, and no modelBuilder code, this failed with the same error as above: [Required] [ForeignKey("EquipmentId")] public Equipment Parent { get; set; } [Required] [ForeignKey("EquipmentId")] public Equipment Child { get; set; } AND [InverseProperty("Child")] public virtual List<ChildRecord> Parents { get; set; } [InverseProperty("Parent")] public virtual List<ChildRecord> Children { get; set; } I've looked at various other answers around the internet/SO, and the common difference seems to be that I am self joining where as all the answers I can find are for two different types. Entity Framework Code First Many to Many Setup For Existing Tables Many to many relationship with junction table in Entity Framework? Creating many to many junction table in Entity Framework

    Read the article

  • Do I need to manually create indexes for a DBIx::Class belongs_to relationship

    - by Dancrumb
    I'm using the DBIx::Class modules for an ORM approach to an application I have. I'm having some problems with my relationships. I have the following package MySchema::Result::ClusterIP; use strict; use warnings; use base qw/DBIx::Class::Core/; our $VERSION = '1.0'; __PACKAGE__->load_components(qw/InflateColumn::Object::Enum Core/); __PACKAGE__->table('cluster_ip'); __PACKAGE__->add_columns( # Columns here ); __PACKAGE__->set_primary_key('objkey'); __PACKAGE__->belongs_to( 'configuration' => 'MySchema::Result::Configuration', 'config_key'); __PACKAGE__->belongs_to( 'cluster' => 'MySchema::Result::Cluster', { 'foreign.config_key' => 'self.config_key', 'foreign.id' => 'self.cluster_id' } ); As well as package MySchema::Result::Cluster; use strict; use warnings; use base qw/DBIx::Class::Core/; our $VERSION = '1.0'; __PACKAGE__->load_components(qw/InflateColumn::Object::Enum Core/); __PACKAGE__->table('cluster'); __PACKAGE__->add_columns( # Columns here ); __PACKAGE__->set_primary_key('objkey'); __PACKAGE__->belongs_to( 'configuration' => 'MySchema::Result::Configuration', 'config_key'); __PACKAGE__->has_many('cluster_ip' => 'MySchema::Result::ClusterIP', { 'foreign.config_key' => 'self.config_key', 'foreign.cluster_id' => 'self.id' }); There are a couple of other modules, but I don't believe that they are relevant. When I attempt to deploy this schema, I get the following error: DBIx::Class::Schema::deploy(): DBI Exception: DBD::mysql::db do failed: Can't create table 'test.cluster_ip' (errno: 150) [ for Statement "CREATE TABLE `cluster_ip` ( `objkey` smallint(5) unsigned NOT NULL auto_increment, `config_key` smallint(5) unsigned NOT NULL, `cluster_id` char(16) NOT NULL, INDEX `cluster_ip_idx_config_key_cluster_id` (`config_key`, `cluster_id`), INDEX `cluster_ip_idx_config_key` (`config_key`), PRIMARY KEY (`objkey`), CONSTRAINT `cluster_ip_fk_config_key_cluster_id` FOREIGN KEY (`config_key`, `cluster_id`) REFERENCES `cluster` (`config_key`, `id`) ON DELETE CASCADE ON UPDATE CASCADE, CONSTRAINT `cluster_ip_fk_config_key` FOREIGN KEY (`config_key`) REFERENCES `configuration` (`config_key`) ON DELETE CASCADE ON UPDATE CASCADE ) ENGINE=InnoDB"] at test_deploy.pl line 18 (running "CREATE TABLE `cluster_ip` ( `objkey` smallint(5) unsigned NOT NULL auto_increment, `config_key` smallint(5) unsigned NOT NULL, `cluster_id` char(16) NOT NULL, INDEX `cluster_ip_idx_config_key_cluster_id` (`config_key`, `cluster_id`), INDEX `cluster_ip_idx_config_key` (`config_key`), PRIMARY KEY (`objkey`), CONSTRAINT `cluster_ip_fk_config_key_cluster_id` FOREIGN KEY (`config_key`, `cluster_id`) REFERENC ES `cluster` (`config_key`, `id`) ON DELETE CASCADE ON UPDATE CASCADE, CONSTRAINT `cluster_ip_fk_config_key` FOREIGN KEY (`config_key`) REFERENCES `configuration` (`conf ig_key`) ON DELETE CASCADE ON UPDATE CASCADE ) ENGINE=InnoDB") at test_deploy.pl line 18 From what I can tell, MySQL is complaining about the FOREIGN KEY constraint, in particular, the REFERENCE to (config_key, id) in the cluster table. From my reading of the MySQL documentation, this seems like a reasonable complaint, especially in regards to the third bullet point on this doc page. Here's my question. Am I missing something in the DBIx::Class module? I realize that I could explicitly create the necessary index to match up with this foreign key constraint, but that seems to be repetitive work. Is there something I should be doing to make this occur implicitly?

    Read the article

  • How change the layout (e.g. background-color) of autoplaylists in foobar2000?

    - by UdeF
    A nice feature of the highly customizable music player foobar2000 is to generate autoplaylists. Autoplaylists are filtered lists of music that automatically update when you add new music to your collection. You would usually generate one by searching for something and saving it as new autoplaylists, e.g.: %added% DURING LAST 4 WEEKS %genre% HAS jazz OR %genre% HAS downtempo %date% GREATER 1949 AND %date% LESS 1970 Autoplaylist playlists are locked: You can't add or delete files. You can note that thanks to the little icon in the status bar at the bottom of your screen: foobar2000 let's you customize nearly everything, so here is my question: Is there a way to change the layout of the autoplaylists? For example i want to change the background-color in my playlist view. I use the Columns UI component.

    Read the article

  • Regular expression in mySQL [migrated]

    - by Rayne
    I have a mysql table that has 2 columns - Column 1 contains a string value, and Column 2 contains the number of times that string value occurred. I'm trying to find the string abc.X.def, where the beginning of the string is "abc.", followed by one or more characters, then the string ".def". There could be more characters following ".def". How can I find such strings, then add the occurrence of such strings and display the results? For example, if I have abc.111.def23 1 abc.111.def 2 abc.22.def444 1 abc.111.def 1 Then I will get abc.111.def23 1 abc.111.def 3 abc.22.def444 1 Thank you.

    Read the article

  • StoreGeneratedPattern T4 EntityFramework concern

    - by LoganWolfer
    Hi everyone, Here's the situation : I use SQL Server 2008 R2, SQL Replication, Visual Studio 2010, EntityFramework 4, C# 4. The course-of-action from our DBA is to use a rowguid column for SQL Replication to work with our setup. These columns need to have a StoreGeneratedPattern property set to Computed on every one of these columns. The problem : Every time the T4 template regenerate our EDMX (ADO.NET Entity Data Model) file (for example, when we update it from our database), I need to go manually in the EDMX XML file to add this property to every one of them. It has to go from this : <Property Name="rowguid" Type="uniqueidentifier" Nullable="false" /> To this : <Property Name="rowguid" Type="uniqueidentifier" Nullable="false" StoreGeneratedPattern="Computed"/> The solution : I'm trying to find a way to customize an ADO.NET EntityObject Generator T4 file to generate a StoreGeneratedPattern="Computed" to every rowguid that I have. I'm fairly new to T4, I only did customization to AddView and AddController T4 templates for ASP.NET MVC 2, like List.tt for example. I've looked through the EF T4 file, and I can't seem to find through this monster where I could do that (and how). My best guess is somewhere in this part of the file, line 544 to 618 of the original ADO.NET EntityObject Generator T4 file : //////// //////// Write PrimitiveType Properties. //////// private void WritePrimitiveTypeProperty(EdmProperty primitiveProperty, CodeGenerationTools code) { MetadataTools ef = new MetadataTools(this); #> /// <summary> /// <#=SummaryComment(primitiveProperty)#> /// </summary><#=LongDescriptionCommentElement(primitiveProperty, 1)#> [EdmScalarPropertyAttribute(EntityKeyProperty=<#=code.CreateLiteral(ef.IsKey(primitiveProperty))#>, IsNullable=<#=code.CreateLiteral(ef.IsNullable(primitiveProperty))#>)] [DataMemberAttribute()] <#=code.SpaceAfter(NewModifier(primitiveProperty))#><#=Accessibility.ForProperty(primitiveProperty)#> <#=code.Escape(primitiveProperty.TypeUsage)#> <#=code.Escape(primitiveProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(primitiveProperty))#>get { <#+ if (ef.ClrType(primitiveProperty.TypeUsage) == typeof(byte[])) { #> return StructuralObject.GetValidValue(<#=code.FieldName(primitiveProperty)#>); <#+ } else { #> return <#=code.FieldName(primitiveProperty)#>; <#+ } #> } <#=code.SpaceAfter(Accessibility.ForSetter((primitiveProperty)))#>set { <#+ if (ef.IsKey(primitiveProperty)) { if (ef.ClrType(primitiveProperty.TypeUsage) == typeof(byte[])) { #> if (!StructuralObject.BinaryEquals(<#=code.FieldName(primitiveProperty)#>, value)) <#+ } else { #> if (<#=code.FieldName(primitiveProperty)#> != value) <#+ } #> { <#+ PushIndent(CodeRegion.GetIndent(1)); } #> <#=ChangingMethodName(primitiveProperty)#>(value); ReportPropertyChanging("<#=primitiveProperty.Name#>"); <#=code.FieldName(primitiveProperty)#> = StructuralObject.SetValidValue(value<#=OptionalNullableParameterForSetValidValue(primitiveProperty, code)#>); ReportPropertyChanged("<#=primitiveProperty.Name#>"); <#=ChangedMethodName(primitiveProperty)#>(); <#+ if (ef.IsKey(primitiveProperty)) { PopIndent(); #> } <#+ } #> } } private <#=code.Escape(primitiveProperty.TypeUsage)#> <#=code.FieldName(primitiveProperty)#><#=code.StringBefore(" = ", code.CreateLiteral(primitiveProperty.DefaultValue))#>; partial void <#=ChangingMethodName(primitiveProperty)#>(<#=code.Escape(primitiveProperty.TypeUsage)#> value); partial void <#=ChangedMethodName(primitiveProperty)#>(); <#+ } Any help would be appreciated. Thanks in advance. EDIT : Didn't find answer to this problem yet, if anyone have ideas to automate this, would really be appreciated.

    Read the article

  • Ubuntu Volume overriding settings set in Alsamixer

    - by Hayek
    Problem: How do I "lock in" the volume I set through alsamixer? I'm running Ubuntu 9.10. I adjusted the bass/treble columns in alsamixer but changing the system volume resets them all back to 100% I did save the settings by running alsactl store but everything is reset once I touch Ubuntu's volume icon in the top menu bar. This is rather painful because the computer is hooked up to a 650watt system with a massive subwoofer. As much as I enjoy my music, there's no need to have the walls vibrate :) What can I do to prevent Ubuntu from overriding the settings?

    Read the article

  • How can I create matrices of data in Excel?

    - by sandeep
    I want to create a 4*4 matrix in excel 2007 by taking three or more columns or conditions for example Column index Row index Name 1 2 x 2 3 y 3 4 z 4 1 p this is how data looks and i want it for 1*1 cell as p and 1*2 cell as x and so on. and I want out put as follows matrix 1 2 3 4 1 p x y z 2 p x y z 3 p x y z 4 p x y z and I have very huge data like this some times the matrix size goes up to 60*60 also.

    Read the article

  • C# - Must declare the scalar variable "@ms_id" - Error

    - by user1075106
    I'm writing an web-app that keeps track of deadlines. With this app you have to be able to update records that are being saved in an SQL DB. However I'm having some problem with my update in my aspx-file. <asp:GridView ID="gv_editMilestones" runat="server" DataSourceID="sql_ds_milestones" CellPadding="4" ForeColor="#333333" GridLines="None" Font-Size="Small" AutoGenerateColumns="False" DataKeyNames="id" Visible="false" onrowupdated="gv_editMilestones_RowUpdated" onrowupdating="gv_editMilestones_RowUpdating" onrowediting="gv_editMilestones_RowEditing"> <RowStyle BackColor="#F7F6F3" ForeColor="#333333" /> <Columns> <asp:CommandField ShowEditButton="True" /> <asp:BoundField DataField="id" HeaderText="id" SortExpression="id" ReadOnly="True" Visible="false"/> <asp:BoundField DataField="ms_id" HeaderText="ms_id" SortExpression="ms_id" ReadOnly="True"/> <asp:BoundField DataField="ms_description" HeaderText="ms_description" SortExpression="ms_description"/> <%-- <asp:BoundField DataField="ms_resp_team" HeaderText="ms_resp_team" SortExpression="ms_resp_team"/>--%> <asp:TemplateField HeaderText="ms_resp_team" SortExpression="ms_resp_team"> <ItemTemplate> <%# Eval("ms_resp_team") %> </ItemTemplate> <EditItemTemplate> <asp:DropDownList ID="DDL_ms_resp_team" runat="server" DataSourceID="sql_ds_ms_resp_team" DataTextField="team_name" DataValueField="id"> <%--SelectedValue='<%# Bind("ms_resp_team") %>'--%> </asp:DropDownList> </EditItemTemplate> </asp:TemplateField> <asp:BoundField DataField="ms_focal_point" HeaderText="ms_focal_point" SortExpression="ms_focal_point" /> <asp:BoundField DataField="ms_exp_date" HeaderText="ms_exp_date" SortExpression="ms_exp_date" DataFormatString="{0:d}"/> <asp:BoundField DataField="ms_deal" HeaderText="ms_deal" SortExpression="ms_deal" ReadOnly="True"/> <asp:CheckBoxField DataField="ms_active" HeaderText="ms_active" SortExpression="ms_active"/> </Columns> <FooterStyle BackColor="#CCCC99" /> <PagerStyle BackColor="#F7F7DE" ForeColor="Black" HorizontalAlign="Right" /> <SelectedRowStyle BackColor="#CE5D5A" Font-Bold="True" ForeColor="White" /> <HeaderStyle BackColor="#5D7B9D" Font-Bold="True" ForeColor="White" /> <AlternatingRowStyle BackColor="White" /> <EditRowStyle BackColor="#999999" /> </asp:GridView> <asp:SqlDataSource ID="sql_ds_milestones" runat="server" ConnectionString="<%$ ConnectionStrings:testServer %>" SelectCommand="SELECT [id] ,[ms_id] ,[ms_description] ,(SELECT [team_name] FROM [NSBP].[dbo].[tbl_teams] as teams WHERE milestones.[ms_resp_team] = teams.[id]) as 'ms_resp_team' ,[ms_focal_point] ,[ms_exp_date] ,(SELECT [deal] FROM [NSBP].[dbo].[tbl_deals] as deals WHERE milestones.[ms_deal] = deals.[id]) as 'ms_deal' ,[ms_active] FROM [NSBP].[dbo].[tbl_milestones] as milestones" UpdateCommand="UPDATE [NSBP].[dbo].[tbl_milestones] SET [ms_description] = @ms_description ,[ms_focal_point] = @ms_focal_point ,[ms_active] = @ms_active WHERE [ms_id] = @ms_id"> <UpdateParameters> <asp:Parameter Name="ms_description" Type="String" /> <%-- <asp:Parameter Name="ms_resp_team" Type="String" />--%> <asp:Parameter Name="ms_focal_point" Type="String" /> <asp:Parameter Name="ms_exp_date" Type="DateTime" /> <asp:Parameter Name="ms_active" Type="Boolean" /> <%-- <asp:Parameter Name="ms_id" Type="String" />--%> </UpdateParameters> </asp:SqlDataSource> You can see my complete GridView-structure + my datasource bound to this GridView. There is nothing written in my onrowupdating-function in my code-behind file. Thx in advance

    Read the article

< Previous Page | 141 142 143 144 145 146 147 148 149 150 151 152  | Next Page >