Search Results

Search found 3861 results on 155 pages for 'assignment operator'.

Page 153/155 | < Previous Page | 149 150 151 152 153 154 155  | Next Page >

  • std::basic_stringstream<unsigned char> won't compile with MSVC 10

    - by Michael J
    I'm trying to get UTF-8 chars to co-exist with ANSI 8-bit chars. My strategy has been to represent utf-8 chars as unsigned char so that appropriate overloads of functions can be used for the two character types. e.g. namespace MyStuff { typedef uchar utf8_t; typedef std::basic_string<utf8_t> U8string; } void SomeFunc(std::string &s); void SomeFunc(std::wstring &s); void SomeFunc(MyStuff::U8string &s); This all works pretty well until I try to use a stringstream. std::basic_ostringstream<MyStuff::utf8_t> ostr; ostr << 1; MSVC Visual C++ Express V10 won't compile this: c:\program files\microsoft visual studio 10.0\vc\include\xlocmon(213): warning C4273: 'id' : inconsistent dll linkage c:\program files\microsoft visual studio 10.0\vc\include\xlocnum(65) : see previous definition of 'public: static std::locale::id std::numpunct<unsigned char>::id' c:\program files\microsoft visual studio 10.0\vc\include\xlocnum(65) : while compiling class template static data member 'std::locale::id std::numpunct<_Elem>::id' with [ _Elem=Tk::utf8_t ] c:\program files\microsoft visual studio 10.0\vc\include\xlocnum(1149) : see reference to function template instantiation 'const _Facet &std::use_facet<std::numpunct<_Elem>>(const std::locale &)' being compiled with [ _Facet=std::numpunct<Tk::utf8_t>, _Elem=Tk::utf8_t ] c:\program files\microsoft visual studio 10.0\vc\include\xlocnum(1143) : while compiling class template member function 'std::ostreambuf_iterator<_Elem,_Traits> std::num_put<_Elem,_OutIt>:: do_put(_OutIt,std::ios_base &,_Elem,std::_Bool) const' with [ _Elem=Tk::utf8_t, _Traits=std::char_traits<Tk::utf8_t>, _OutIt=std::ostreambuf_iterator<Tk::utf8_t,std::char_traits<Tk::utf8_t>> ] c:\program files\microsoft visual studio 10.0\vc\include\ostream(295) : see reference to class template instantiation 'std::num_put<_Elem,_OutIt>' being compiled with [ _Elem=Tk::utf8_t, _OutIt=std::ostreambuf_iterator<Tk::utf8_t,std::char_traits<Tk::utf8_t>> ] c:\program files\microsoft visual studio 10.0\vc\include\ostream(281) : while compiling class template member function 'std::basic_ostream<_Elem,_Traits> & std::basic_ostream<_Elem,_Traits>::operator <<(int)' with [ _Elem=Tk::utf8_t, _Traits=std::char_traits<Tk::utf8_t> ] c:\program files\microsoft visual studio 10.0\vc\include\sstream(526) : see reference to class template instantiation 'std::basic_ostream<_Elem,_Traits>' being compiled with [ _Elem=Tk::utf8_t, _Traits=std::char_traits<Tk::utf8_t> ] c:\users\michael\dvl\tmp\console\console.cpp(23) : see reference to class template instantiation 'std::basic_ostringstream<_Elem,_Traits,_Alloc>' being compiled with [ _Elem=Tk::utf8_t, _Traits=std::char_traits<Tk::utf8_t>, _Alloc=std::allocator<uchar> ] . c:\program files\microsoft visual studio 10.0\vc\include\xlocmon(213): error C2491: 'std::numpunct<_Elem>::id' : definition of dllimport static data member not allowed with [ _Elem=Tk::utf8_t ] Any ideas? ** Edited 19 June 2012 ** OK, I've gotten closer to understanding this, but not how to solve it. As we all know, static class variables get defined twice: once in the class definition and once outside the class definition which establishes storage space. e.g. // in .h file class CFoo { // ... static int x; }; // in .cpp file int CFoo::x = 42; Now in the VC10 headers we get something like this: template<class _Elem> class numpunct : public locale::facet { // ... _CRTIMP2_PURE static locale::id id; // ... } When the header is included in an application, _CRTIMP2_PURE is defined as __declspec(dllimport), which means that the variable is imported from a dll. Now the header also contains the following template<class _Elem> locale::id numpunct<_Elem>::id; Note the absence of the __declspec(dllimport) qualifier. i.e. The class declaration says that the static linkage of the id variable is in the dll, but for the general case, it gets declared outside the dll. For the known cases, there are specialisations. template locale::id numpunct<char>::id; template locale::id numpunct<wchar_t>::id; These are protected by #ifs so that they are only included when building the DLL. They are excluded otherwise. i.e. the char and wchar_t versions of numpunct ARE inside the dll So we have the class definition saying that id's storage is in the DLL, but that is only true for the char and wchar_t specialisations, meaning that my unsigned char version is doomed. :-( The only way forward that I can think of is to create my own specialisation: basically copying it from the header file and fixing it. This raises many issues. Anybody have a better idea?

    Read the article

  • Core Data error when assigning variable with one-to-one relationship

    - by Hoang Pham
    I tried to assign a managed object (C) with its property another managed object (B) (a one-to-one relationship) in which this other managed object (B) has a to-many relationship with one other managed object (A). There is an error from this assignment in which I copied as follows: #0 0x020e53a7 in ___forwarding___ #1 0x020c16c2 in __forwarding_prep_0___ #2 0x02078988 in CFRetain #3 0x0207a728 in CFSetAddValue #4 0x020c2fb2 in CFSetCreate #5 0x01e51ce8 in -[_NSFaultingMutableSet copyWithZone:] #6 0x020afcca in -[NSObject copy] #7 0x01e50d22 in -[NSManagedObject(_NSInternalMethods) _newPropertiesForRetainedTypes:andCopiedTypes:preserveFaults:] #8 0x01e51aa0 in -[NSManagedObject(_NSInternalMethods) _newAllPropertiesWithRelationshipFaultsIntact__] #9 0x01e519b4 in -[NSManagedObjectContext(_NSInternalChangeProcessing) _establishEventSnapshotsForObject:] #10 0x01e51866 in _PFFastMOCObjectWillChange #11 0x01e516c5 in _PF_ManagedObject_WillChangeValueForKeyIndex #12 0x01e51525 in _sharedIMPL_setvfk_core #13 0x01e51483 in _PF_Handler_Public_SetProperty #14 0x01e546d1 in -[NSManagedObject(_NSInternalMethods) _didChangeValue:forRelationship:named:withInverse:] #15 0x0030ec1e in NSKVONotify #16 0x002aae2a in -[NSObject(NSKeyValueObserverNotification) didChangeValueForKey:] #17 0x01e5212f in _PF_ManagedObject_DidChangeValueForKeyIndex #18 0x01e515b1 in _sharedIMPL_setvfk_core #19 0x01e55827 in _svfk_5 I don't understand very well what the exact description of this error is. Can someone explain to me what it is and how to solve this one. Note that all other assignments in which the managed object B does not have any A items do not raise this error. ObjectC *objectC = [NSEntityDescription insertNewObjectForEntityForName:@"ObjectC" inManagedObjectContext:managedObjectContext]; objectC.objectB = objectB; Thank you in advance. I added some more NSZombieEnabled/MallocStackLogging generated log: 2010-05-18 17:28:05.327 Foo[2069:207] *** -[CFSet retain]: message sent to deallocated instance 0x800c880 (gdb) shell malloc_history 207 0x800c880 malloc_history cannot examine process 207 because the process does not exist. (gdb) shell malloc_history 2069 0x800c880 ALLOC 0x800c880-0x800c884 [size=5]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlIOParseDTD | _endElementNs | -[Parser parser:didEndElement:namespaceURI:qualifiedName:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asl_set_query | strdup | malloc | malloc_zone_malloc ---- FREE 0x800c880-0x800c884 [size=5]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlIOParseDTD | _endElementNs | -[Parser parser:didEndElement:namespaceURI:qualifiedName:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asl_free | free ALLOC 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asl_set_query | asprintf | malloc | malloc_zone_malloc ---- FREE 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asl_set_query | free ALLOC 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asprintf | malloc | malloc_zone_malloc ---- FREE 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | free ALLOC 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asprintf | malloc | malloc_zone_malloc ---- FREE 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | free ALLOC 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asprintf | malloc | malloc_zone_malloc ---- FREE 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | free ALLOC 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asprintf | malloc | malloc_zone_malloc ---- FREE 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | free ALLOC 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | asprintf | malloc | malloc_zone_malloc ---- FREE 0x800c860-0x800c8df [size=128]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlParseCharData | _characters | -[Parser parser:foundCharacters:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | asl_send | _asl_send_level_message | free ALLOC 0x800c700-0x800c893 [size=404]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlIOParseDTD | _startElementNs | -[Parser parser:didStartElement:namespaceURI:qualifiedName:attributes:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | CFCalendarDecomposeAbsoluteTime | _CFCalendarDecomposeAbsoluteTimeV | __CFCalendarSetupCal | __CFCalendarCreateUCalendar | ucal_open | icu::Calendar::createInstance(icu::TimeZone*, icu::Locale const&, UErrorCode&) | malloc | malloc_zone_malloc ---- FREE 0x800c700-0x800c893 [size=404]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlIOParseDTD | _startElementNs | -[Parser parser:didStartElement:namespaceURI:qualifiedName:attributes:] | NSLog | NSLogv | _CFLogvEx | __CFLogCString | _CFRelease | free ALLOC 0x800c880-0x800c8c7 [size=72]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __NSFireDelayedPerform | -[Step2ViewController downloadData] | -[Parser downloadVariantsWithPin:forTerminal:] | -[Parser parseByNSXMLParser:] | -[NSXMLParser parse] | xmlParseChunk | xmlIOParseDTD | _startElementNs | -[Parser parser:didStartElement:namespaceURI:qualifiedName:attributes:] | +[NSEntityDescription insertNewObjectForEntityForName:inManagedObjectContext:] | +[NSManagedObject(_PFDynamicAccessorsAndPropertySupport) allocWithEntity:] | _PFAllocateObject | malloc_zone_calloc ---- FREE 0x800c880-0x800c8c7 [size=72]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __CFRunLoopDoObservers | _performRunLoopAction | -[_PFManagedObjectReferenceQueue _processReferenceQueue:] | _PFDeallocateObject | malloc_zone_free ALLOC 0x800c880-0x800c8a7 [size=40]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __CFRunLoopDoObservers | CA::Transaction::observer_callback(__CFRunLoopObserver*, unsigned long, void*) | CA::Transaction::commit() | CA::Context::commit_transaction(CA::Transaction*) | CALayerDisplayIfNeeded | -[TileLayer display] | -[CALayer _display] | CABackingStoreUpdate | backing_callback(CGContext*, void*) | WebCore::TiledSurface::drawLayer(CALayer*, CGContext*) | WKWindowDrawRect | WKViewDisplayRect | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | -[WebHTMLView drawSingleRect:] | -[WebFrame(WebInternal) _drawRect:contentsOnly:] | WebCore::FrameView::paintContents(WebCore::GraphicsContext*, WebCore::IntRect const&) | WebCore::RenderLayer::paint(WebCore::GraphicsContext*, WebCore::IntRect const&, WebCore::PaintRestriction, WebCore::RenderObject*) | WebCore::RenderLayer::paintLayer(WebCore::RenderLayer*, WebCore::GraphicsContext*, WebCore::IntRect const&, bool, WebCore::PaintRestriction, WebCore::RenderObject*, bool, bool) | WebCore::RenderLayer::paintLayer(WebCore::RenderLayer*, WebCore::GraphicsContext*, WebCore::IntRect const&, bool, WebCore::PaintRestriction, WebCore::RenderObject*, bool, bool) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintChildren(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintChildren(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintChildren(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderFlow::paintLines(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RootInlineBox::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::InlineFlowBox::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::InlineTextBox::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::paintTextWithShadows(WebCore::GraphicsContext*, WebCore::Font const&, WebCore::TextRun const&, int, int, WebCore::IntPoint const&, int, int, int, int, WebCore::ShadowData*, bool) | WebCore::GraphicsContext::drawText(WebCore::Font const&, WebCore::TextRun const&, WebCore::IntPoint const&, int, int) | WebCore::Font::drawSimpleText(WebCore::GraphicsContext*, WebCore::TextRun const&, WebCore::FloatPoint const&, int, int) const | WebCore::Font::drawGlyphBuffer(WebCore::GraphicsContext*, WebCore::GlyphBuffer const&, WebCore::TextRun const&, WebCore::FloatPoint&) const | WebCore::Font::drawGlyphs(WebCore::GraphicsContext*, WebCore::SimpleFontData const*, WebCore::GlyphBuffer const&, int, int, WebCore::FloatPoint const&, bool) const | CGGStateSetFont | maybeCopyTextState | calloc | malloc_zone_calloc ---- FREE 0x800c880-0x800c8a7 [size=40]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | __CFRunLoopDoObservers | CA::Transaction::observer_callback(__CFRunLoopObserver*, unsigned long, void*) | CA::Transaction::commit() | CA::Context::commit_transaction(CA::Transaction*) | CALayerDisplayIfNeeded | -[TileLayer display] | -[CALayer _display] | CABackingStoreUpdate | backing_callback(CGContext*, void*) | WebCore::TiledSurface::drawLayer(CALayer*, CGContext*) | WKWindowDrawRect | WKViewDisplayRect | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | _WKViewDraw(CGContext*, WKView*, CGRect) | -[WebHTMLView drawSingleRect:] | -[WebFrame(WebInternal) _drawRect:contentsOnly:] | WebCore::FrameView::paintContents(WebCore::GraphicsContext*, WebCore::IntRect const&) | WebCore::RenderLayer::paint(WebCore::GraphicsContext*, WebCore::IntRect const&, WebCore::PaintRestriction, WebCore::RenderObject*) | WebCore::RenderLayer::paintLayer(WebCore::RenderLayer*, WebCore::GraphicsContext*, WebCore::IntRect const&, bool, WebCore::PaintRestriction, WebCore::RenderObject*, bool, bool) | WebCore::RenderLayer::paintLayer(WebCore::RenderLayer*, WebCore::GraphicsContext*, WebCore::IntRect const&, bool, WebCore::PaintRestriction, WebCore::RenderObject*, bool, bool) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintChildren(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintChildren(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintChildren(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderBlock::paintObject(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RenderFlow::paintLines(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::RootInlineBox::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::InlineFlowBox::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::InlineTextBox::paint(WebCore::RenderObject::PaintInfo&, int, int) | WebCore::paintTextWithShadows(WebCore::GraphicsContext*, WebCore::Font const&, WebCore::TextRun const&, int, int, WebCore::IntPoint const&, int, int, int, int, WebCore::ShadowData*, bool) | WebCore::GraphicsContext::restorePlatformState() | CGContextRestoreGState | CGGStackRestore | CGGStateRelease | textStateRelease | free ALLOC 0x800c880-0x800c8bf [size=64]: thread_a0a8c4e0 |start | main | UIApplicationMain | GSEventRun | GSEventRunModal | CFRunLoopRunInMode | CFRunLoopRunSpecific | CA::timer_callback(__CFRunLoopTimer*, void*) | run_animation_callbacks(double, void*) | -[UIViewAnimationState animationDidStop:finished:] | -[UIViewAnimationState sendDelegateAnimationDidStop:finished:] | -[UINavigationTransitionView _navigationTransitionDidStop] | -[UIView(Hierarchy) removeFromSuperview] | -[UITextField resignFirstResponder] | -[UIFieldEditor resignFirstResponder] | -[UIKeyboardImpl setDelegate:] | -[UIKeyboardImpl setDelegate:force:] | -[UITextInteractionAssistant setGestureRecognizers] | -[UITextInteractionAssistant addTwoFingerRangedSelectRecognizer] | -[UILongPressGestureRecognizer initWithTarget:action:] | -[__NSPlaceholderSet init] | -[__NSPlaceholderSet initWithCapacity:] | __CFSetInit | _CFRuntimeCreateInstance | malloc_zone_malloc

    Read the article

  • error in coding a lexer in c

    - by mekasperasky
    #include<stdio.h> #include<ctype.h> #include<string.h> /* this is a lexer which recognizes constants , variables ,symbols, identifiers , functions , comments and also header files . It stores the lexemes in 3 different files . One file contains all the headers and the comments . Another file will contain all the variables , another will contain all the symbols. */ int main() { int i=0,j,k,count=0; char a,b[100],c[10000],d[100]; memset ( d, 0, 100 ); j=30; FILE *fp1,*fp2; fp1=fopen("source.txt","r"); //the source file is opened in read only mode which will passed through the lexer fp2=fopen("lext.txt","w"); //now lets remove all the white spaces and store the rest of the words in a file if(fp1==NULL) { perror("failed to open source.txt"); //return EXIT_FAILURE; } i=0; k=0; while(!feof(fp1)) { a=fgetc(fp1); if(a!=' '&&a!='\n') { if (!isalpha(a)) { switch(a) { case '+':{fprintf(fp2,"+ ----> PLUS \n"); i=0;break;} case '-':{fprintf(fp2,"- ---> MINUS \n"); i=0;break;} case '*':{fprintf(fp2, "* --->MULT \n"); i=0;break;} case '/':{fprintf(fp2, "/ --->DIV \n"); i=0;break;} //case '+=':fprintf(fp2, "%.20s\n", "ADD_ASSIGN"); //case '-=':fprintf(fp2, "%.20s\n", "SUB_ASSIGN"); case '=':{fprintf(fp2, "= ---> ASSIGN \n"); i=0;break;} case '%':{fprintf(fp2, "% ---> MOD \n"); i=0;break;} case '<':{fprintf(fp2, "< ---> LESSER_THAN \n"); i=0;break;} case '>':{fprintf(fp2, "> --> GREATER_THAN \n"); i=0;break;} //case '++':fprintf(fp2, "%.20s\n", "INCREMENT"); //case '--':fprintf(fp2, "%.20s\n", "DECREMENT"); //case '==':fprintf(fp2, "%.20s\n", "ASSIGNMENT"); case ';':{fprintf(fp2, "; --->SEMI_COLUMN \n"); i=0;break;} case ':':{fprintf(fp2, ": --->COLUMN \n"); i=0;break;} case '(':{fprintf(fp2, "( --->LPAR \n"); i=0;break;} case ')':{fprintf(fp2, ") --->RPAR \n"); i=0;break;} case '{':{fprintf(fp2, "{ --->LBRACE \n"); i=0;break;} case '}':{fprintf(fp2, "} ---> RBRACE \n"); i=0;break;} } } else { d[i]=a; //printf("%c\n",d[i]); i=i+1; } //} /* we can make the lexer more complex by including even more depths of checks for the symbols*/ } else { d[i+1]='\0'; printf("\n"); if((strcmp(d,"if ")==0)){fprintf(fp2,"if ----> IDENTIFIER \n"); //printf("%s \n",d); memset ( d, 0, 100 ); //printf("%s \n",d); count=count+1;} else if(strcmp(d,"then")==0){fprintf(fp2,"then ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"else")==0){fprintf(fp2,"else ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"switch")==0){fprintf(fp2,"switch ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"printf")==0){fprintf(fp2,"prtintf ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"scanf")==0){fprintf(fp2,"scanf ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"NULL")==0){fprintf(fp2,"NULL ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"int")==0){fprintf(fp2,"INT ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"char")==0){fprintf(fp2,"char ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"float")==0){fprintf(fp2,"float ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"long")==0){fprintf(fp2,"long ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"double")==0){fprintf(fp2,"double ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"const")==0){fprintf(fp2,"const ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"continue")==0)fprintf(fp2,"continue ----> IDENTIFIER \n"); else if(strcmp(d,"size of")==0){fprintf(fp2,"size of ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"register")==0){fprintf(fp2,"register ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"short")==0){fprintf(fp2,"short ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"auto")==0){fprintf(fp2,"auto ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"while")==0){fprintf(fp2,"while ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"do")==0){fprintf(fp2,"do ----> IDENTIFIER \n"); count=count+1;} else if(strcmp(d,"case")==0){fprintf(fp2,"case ----> IDENTIFIER \n"); count=count+1;} else if (isdigit(d[i])) { fprintf(fp2,"%s ---->NUMBER",d); } else if (isalpha(a)) { fprintf(fp2,"%s ----> Variable",d); //printf("%s",d); // memset ( d, 0, 100 );} //fprintf(fp2, "s\n", b); i=0; k=k+1; continue; } i=i+1; k=k+1; } fclose(fp1); fclose(fp2); printf("%d",count); return 0; } In this code , my source.txt has if (a+b) stored . But only ( , + and ) is getting written into lext.txt and not the identifier if or the variable a and b . Any particular reason why?

    Read the article

  • HP to Cisco spanning tree root flapping

    - by Tim Brigham
    Per a recent question I recently configured both my HP (2x 2900) and Cisco (1x 3750) hardware to use MSTP for interoperability. I thought this was functional until I applied the change to the third device (HP switch 1 below) at which time the spanning tree root started flapping causing performance issues (5% packet loss) between my two HP switches. I'm not sure why. HP Switch 1 A4 connected to Cisco 1/0/1. HP Switch 2 B2 connected to Cisco 2/0/1. HP Switch 1 A2 connected to HP Switch 2 A1. I'd prefer the Cisco stack to act as the root. EDIT: There is one specific line - 'spanning-tree 1 path-cost 500000' in the HP switch 2 that I didn't add and was preexisting. I'm not sure if it could have the kind of impact that I'm describing. I'm more a security and monitoring guy then networking. EDIT 2: I'm starting to believe the problem lies in the fact that the value for my MST 0 instance on the Cisco is still at the default 32768. I worked up a diagram: This is based on every show command I could find for STP. I'll make this change after hours and see if it helps. Cisco 3750 Config: version 12.2 spanning-tree mode mst spanning-tree extend system-id spanning-tree mst configuration name mstp revision 1 instance 1 vlan 1, 40, 70, 100, 250 spanning-tree mst 1 priority 0 vlan internal allocation policy ascending interface TenGigabitEthernet1/1/1 switchport trunk encapsulation dot1q switchport mode trunk ! interface TenGigabitEthernet2/1/1 switchport trunk encapsulation dot1q switchport mode trunk ! interface Vlan1 no ip address ! interface Vlan100 ip address 192.168.100.253 255.255.255.0 ! Cisco 3750 show spanning tree: show spanning-tree MST0 Spanning tree enabled protocol mstp Root ID Priority 32768 Address 0004.ea84.5f80 Cost 200000 Port 53 (TenGigabitEthernet1/1/1) Hello Time 2 sec Max Age 20 sec Forward Delay 15 sec Bridge ID Priority 32768 (priority 32768 sys-id-ext 0) Address a44c.11a6.7c80 Hello Time 2 sec Max Age 20 sec Forward Delay 15 sec Interface Role Sts Cost Prio.Nbr Type ------------------- ---- --- --------- -------- -------------------------------- Te1/1/1 Root FWD 2000 128.53 P2p MST1 Spanning tree enabled protocol mstp Root ID Priority 1 Address a44c.11a6.7c80 This bridge is the root Hello Time 2 sec Max Age 20 sec Forward Delay 15 sec Bridge ID Priority 1 (priority 0 sys-id-ext 1) Address a44c.11a6.7c80 Hello Time 2 sec Max Age 20 sec Forward Delay 15 sec Interface Role Sts Cost Prio.Nbr Type ------------------- ---- --- --------- -------- -------------------------------- Te1/1/1 Desg FWD 2000 128.53 P2p Cisco 3750 show logging: %LINEPROTO-5-UPDOWN: Line protocol on Interface Vlan1, changed state to down %LINEPROTO-5-UPDOWN: Line protocol on Interface Vlan100, changed state to down %LINEPROTO-5-UPDOWN: Line protocol on Interface Vlan1, changed state to up %LINEPROTO-5-UPDOWN: Line protocol on Interface Vlan100, changed state to up %LINEPROTO-5-UPDOWN: Line protocol on Interface Vlan1, changed state to down %LINEPROTO-5-UPDOWN: Line protocol on Interface Vlan1, changed state to up HP Switch 1: ; J9049A Configuration Editor; Created on release #T.13.71 vlan 1 name "DEFAULT_VLAN" untagged 1-8,10,13-16,18-23,A1-A4 ip address 100.100.100.17 255.255.255.0 no untagged 9,11-12,17,24 exit vlan 100 name "192.168.100" untagged 9,11-12,17,24 tagged 1-8,10,13-16,18-23,A1-A4 no ip address exit vlan 21 name "Users_2" tagged 1,A1-A4 no ip address exit vlan 40 name "Cafe" tagged 1,4,7,A1-A4 no ip address exit vlan 250 name "Firewall" tagged 1,4,7,A1-A4 no ip address exit vlan 70 name "DMZ" tagged 1,4,7-8,13,A1-A4 no ip address exit spanning-tree spanning-tree config-name "mstp" spanning-tree config-revision 1 spanning-tree instance 1 vlan 1 40 70 100 250 password manager password operator HP Switch 1 show spanning tree: show spanning-tree Multiple Spanning Tree (MST) Information STP Enabled : Yes Force Version : MSTP-operation IST Mapped VLANs : 2-39,41-69,71-99,101-249,251-4094 Switch MAC Address : 0021f7-126580 Switch Priority : 32768 Max Age : 20 Max Hops : 20 Forward Delay : 15 Topology Change Count : 363,490 Time Since Last Change : 14 hours CST Root MAC Address : 0004ea-845f80 CST Root Priority : 32768 CST Root Path Cost : 200000 CST Root Port : 1 IST Regional Root MAC Address : 0021f7-126580 IST Regional Root Priority : 32768 IST Regional Root Path Cost : 0 IST Remaining Hops : 20 Root Guard Ports : TCN Guard Ports : BPDU Protected Ports : BPDU Filtered Ports : PVST Protected Ports : PVST Filtered Ports : | Prio | Designated Hello Port Type | Cost rity State | Bridge Time PtP Edge ----- --------- + --------- ---- ---------- + ------------- ---- --- ---- A1 | Auto 128 Disabled | A2 10GbE-CX4 | 2000 128 Forwarding | 0021f7-126580 2 Yes No A3 10GbE-CX4 | Auto 128 Disabled | A4 10GbE-SR | Auto 128 Disabled | HP Switch 1 Logging: I removed the date / time fields since they are inaccurate (no NTP configured on these switches) 00839 stp: MSTI 1 Root changed from 0:a44c11-a67c80 to 32768:0021f7-126580 00839 stp: MSTI 1 Root changed from 32768:0021f7-126580 to 0:a44c11-a67c80 00842 stp: MSTI 1 starved for an MSTI Msg Rx on port A4 from 0:a44c11-a67c80 00839 stp: MSTI 1 Root changed from 0:a44c11-a67c80 to 32768:0021f7-126580 00839 stp: MSTI 1 Root changed from 32768:0021f7-126580 to 0:a44c11-a67c80 00839 stp: MSTI 1 Root changed from 0:a44c11-a67c80 to ... HP Switch 2 Configuration: ; J9146A Configuration Editor; Created on release #W.14.49 vlan 1 name "DEFAULT_VLAN" untagged 1,3-17,21-24,A1-A2,B2 ip address 100.100.100.36 255.255.255.0 no untagged 2,18-20,B1 exit vlan 100 name "192.168.100" untagged 2,18-20 tagged 1,3-17,21-24,A1-A2,B1-B2 no ip address exit vlan 21 name "Users_2" tagged 1,A1-A2,B2 no ip address exit vlan 40 name "Cafe" tagged 1,13-14,16,A1-A2,B2 no ip address exit vlan 250 name "Firewall" tagged 1,13-14,16,A1-A2,B2 no ip address exit vlan 70 name "DMZ" tagged 1,13-14,16,A1-A2,B2 no ip address exit logging 192.168.100.18 spanning-tree spanning-tree 1 path-cost 500000 spanning-tree config-name "mstp" spanning-tree config-revision 1 spanning-tree instance 1 vlan 1 40 70 100 250 HP Switch 2 Spanning Tree: show spanning-tree Multiple Spanning Tree (MST) Information STP Enabled : Yes Force Version : MSTP-operation IST Mapped VLANs : 2-39,41-69,71-99,101-249,251-4094 Switch MAC Address : 0024a8-cd6000 Switch Priority : 32768 Max Age : 20 Max Hops : 20 Forward Delay : 15 Topology Change Count : 21,793 Time Since Last Change : 14 hours CST Root MAC Address : 0004ea-845f80 CST Root Priority : 32768 CST Root Path Cost : 200000 CST Root Port : A1 IST Regional Root MAC Address : 0021f7-126580 IST Regional Root Priority : 32768 IST Regional Root Path Cost : 2000 IST Remaining Hops : 19 Root Guard Ports : TCN Guard Ports : BPDU Protected Ports : BPDU Filtered Ports : PVST Protected Ports : PVST Filtered Ports : | Prio | Designated Hello Port Type | Cost rity State | Bridge Time PtP Edge ----- --------- + --------- ---- ---------- + ------------- ---- --- ---- A1 10GbE-CX4 | 2000 128 Forwarding | 0021f7-126580 2 Yes No A2 10GbE-CX4 | Auto 128 Disabled | B1 SFP+SR | 2000 128 Forwarding | 0024a8-cd6000 2 Yes No B2 | Auto 128 Disabled | HP Switch 2 Logging: I removed the date / time fields since they are inaccurate (no NTP configured on these switches) 00839 stp: CST Root changed from 32768:0021f7-126580 to 32768:0004ea-845f80 00839 stp: IST Root changed from 32768:0021f7-126580 to 32768:0024a8-cd6000 00839 stp: CST Root changed from 32768:0004ea-845f80 to 32768:0024a8-cd6000 00839 stp: CST Root changed from 32768:0024a8-cd6000 to 32768:0004ea-845f80 00839 stp: CST Root changed from 32768:0004ea-845f80 to 32768:0024a8-cd6000 00435 ports: port B1 is Blocked by STP 00839 stp: CST Root changed from 32768:0024a8-cd6000 to 32768:0021f7-126580 00839 stp: IST Root changed from 32768:0024a8-cd6000 to 32768:0021f7-126580 00839 stp: CST Root changed from 32768:0021f7-126580 to 32768:0004ea-845f80

    Read the article

  • Avoiding Agnostic Jagged Array Flattening in Powershell

    - by matejhowell
    Hello, I'm running into an interesting problem in Powershell, and haven't been able to find a solution to it. When I google (and find things like this post), nothing quite as involved as what I'm trying to do comes up, so I thought I'd post the question here. The problem has to do with multidimensional arrays with an outer array length of one. It appears Powershell is very adamant about flattening arrays like @( @('A') ) becomes @( 'A' ). Here is the first snippet (prompt is , btw): > $a = @( @( 'Test' ) ) > $a.gettype().isarray True > $a[0].gettype().isarray False So, I'd like to have $a[0].gettype().isarray be true, so that I can index the value as $a[0][0] (the real world scenario is processing dynamic arrays inside of a loop, and I'd like to get the values as $a[$i][$j], but if the inner item is not recognized as an array but as a string (in my case), you start indexing into the characters of the string, as in $a[0][0] -eq 'T'). I have a couple of long code examples, so I have posted them at the end. And, for reference, this is on Windows 7 Ultimate with PSv2 and PSCX installed. Consider code example 1: I build a simple array manually using the += operator. Intermediate array $w is flattened, and consequently is not added to the final array correctly. I have found solutions online for similar problems, which basically involve putting a comma before the inner array to force the outer array to not flatten, which does work, but again, I'm looking for a solution that can build arrays inside a loop (a jagged array of arrays, processing a CSS file), so if I add the leading comma to the single element array (implemented as intermediate array $y), I'd like to do the same for other arrays (like $z), but that adversely affects how $z is added to the final array. Now consider code example 2: This is closer to the actual problem I am having. When a multidimensional array with one element is returned from a function, it is flattened. It is correct before it leaves the function. And again, these are examples, I'm really trying to process a file without having to know if the function is going to come back with @( @( 'color', 'black') ) or with @( @( 'color', 'black'), @( 'background-color', 'white') ) Has anybody encountered this, and has anybody resolved this? I know I can instantiate framework objects, and I'm assuming everything will be fine if I create an object[], or a list<, or something else similar, but I've been dealing with this for a little bit and something sure seems like there has to be a right way to do this (without having to instantiate true framework objects). Code Example 1 function Display($x, [int]$indent, [string]$title) { if($title -ne '') { write-host "$title`: " -foregroundcolor cyan -nonewline } if(!$x.GetType().IsArray) { write-host "'$x'" -foregroundcolor cyan } else { write-host '' $s = new-object string(' ', $indent) for($i = 0; $i -lt $x.length; $i++) { write-host "$s[$i]: " -nonewline -foregroundcolor cyan Display $x[$i] $($indent+1) } } if($title -ne '') { write-host '' } } ### Start Program $final = @( @( 'a', 'b' ), @('c')) Display $final 0 'Initial Value' ### How do we do this part ??? ########### ## $w = @( @('d', 'e') ) ## $x = @( @('f', 'g'), @('h') ) ## # But now $w is flat, $w.length = 2 ## ## ## # Even if we put a leading comma (,) ## # in front of the array, $y will work ## # but $w will not. This can be a ## # problem inside a loop where you don't ## # know the length of the array, and you ## # need to put a comma in front of ## # single- and multidimensional arrays. ## $y = @( ,@('D', 'E') ) ## $z = @( ,@('F', 'G'), @('H') ) ## ## ## ########################################## $final += $w $final += $x $final += $y $final += $z Display $final 0 'Final Value' ### Desired final value: @( @('a', 'b'), @('c'), @('d', 'e'), @('f', 'g'), @('h'), @('D', 'E'), @('F', 'G'), @('H') ) ### As in the below: # # Initial Value: # [0]: # [0]: 'a' # [1]: 'b' # [1]: # [0]: 'c' # # Final Value: # [0]: # [0]: 'a' # [1]: 'b' # [1]: # [0]: 'c' # [2]: # [0]: 'd' # [1]: 'e' # [3]: # [0]: 'f' # [1]: 'g' # [4]: # [0]: 'h' # [5]: # [0]: 'D' # [1]: 'E' # [6]: # [0]: 'F' # [1]: 'G' # [7]: # [0]: 'H' Code Example 2 function Display($x, [int]$indent, [string]$title) { if($title -ne '') { write-host "$title`: " -foregroundcolor cyan -nonewline } if(!$x.GetType().IsArray) { write-host "'$x'" -foregroundcolor cyan } else { write-host '' $s = new-object string(' ', $indent) for($i = 0; $i -lt $x.length; $i++) { write-host "$s[$i]: " -nonewline -foregroundcolor cyan Display $x[$i] $($indent+1) } } if($title -ne '') { write-host '' } } function funA() { $ret = @() $temp = @(0) $temp[0] = @('p', 'q') $ret += $temp Display $ret 0 'Inside Function A' return $ret } function funB() { $ret = @( ,@('r', 's') ) Display $ret 0 'Inside Function B' return $ret } ### Start Program $z = funA Display $z 0 'Return from Function A' $z = funB Display $z 0 'Return from Function B' ### Desired final value: @( @('p', 'q') ) and same for r,s ### As in the below: # # Inside Function A: # [0]: # [0]: 'p' # [1]: 'q' # # Return from Function A: # [0]: # [0]: 'p' # [1]: 'q' Thanks, Matt

    Read the article

  • Erasing and modifying elements in Boost MultiIndex Container

    - by Sarah
    I'm trying to use a Boost MultiIndex container in my simulation. My knowledge of C++ syntax is very weak, and I'm concerned I'm not properly removing an element from the container or deleting it from memory. I also need to modify elements, and I was hoping to confirm the syntax and basic philosophy here too. // main.cpp ... #include <boost/multi_index_container.hpp> #include <boost/multi_index/hashed_index.hpp> #include <boost/multi_index/member.hpp> #include <boost/multi_index/ordered_index.hpp> #include <boost/multi_index/mem_fun.hpp> #include <boost/tokenizer.hpp> #include <boost/shared_ptr.hpp> ... #include "Host.h" // class Host, all members private, using get fxns to access using boost::multi_index_container; using namespace boost::multi_index; typedef multi_index_container< boost::shared_ptr< Host >, indexed_by< hashed_unique< const_mem_fun<Host,int,&Host::getID> > // ordered_non_unique< BOOST_MULTI_INDEX_MEM_FUN(Host,int,&Host::getAge) > > // end indexed_by > HostContainer; typedef HostContainer::nth_index<0>::type HostsByID; int main() { ... HostContainer allHosts; Host * newHostPtr; newHostPtr = new Host( t, DOB, idCtr, 0, currentEvents ); allHosts.insert( boost::shared_ptr<Host>(newHostPtr) ); // allHosts gets filled up int randomHostID = 4; int newAge = 50; modifyHost( randomHostID, allHosts, newAge ); killHost( randomHostID, allHosts ); } void killHost( int id, HostContainer & hmap ){ HostsByID::iterator it = hmap.find( id ); cout << "Found host id " << (*it)->getID() << "Attempting to kill. hmap.size() before is " << hmap.size() << " and "; hmap.erase( it ); // Is this really erasing (freeing from mem) the underlying Host object? cout << hmap.size() << " after." << endl; } void modifyHost( int id, HostContainer & hmap, int newAge ){ HostsByID::iterator it = hmap.find( id ); (*it) -> setAge( newAge ); // Not actually the "modify" function for MultiIndex... } My questions are In the MultiIndex container allHosts of shared_ptrs to Host objects, is calling allHosts.erase( it ) on an iterator to the object's shared_ptr enough to delete the object permanently and free it from memory? It appears to be removing the shared_ptr from the container. The allhosts container currently has one functioning index that relies on the host's ID. If I introduce an ordered second index that calls on a member function (Host::getAge()), where the age changes over the course of the simulation, is the index always going to be updated when I refer to it? What is the difference between using the MultiIndex's modify to modify the age of the underlying object versus the approach I show above? I'm vaguely confused about what is assumed/required to be constant in MultiIndex. Thanks in advance. Update Here's my attempt to get the modify syntax working, based on what I see in a related Boost example. struct update_age { update_age():(){} // have no idea what this really does... elicits error void operator() (boost::shared_ptr<Host> ptr) { ptr->incrementAge(); // incrementAge() is a member function of class Host } }; and then in modifyHost, I'd have hmap.modify(it,update_age). Even if by some miracle this turns out to be right, I'd love some kind of explanation of what's going on.

    Read the article

  • Signals and threads - good or bad design decision?

    - by Jens
    I have to write a program that performs highly computationally intensive calculations. The program might run for several days. The calculation can be separated easily in different threads without the need of shared data. I want a GUI or a web service that informs me of the current status. My current design uses BOOST::signals2 and BOOST::thread. It compiles and so far works as expected. If a thread finished one iteration and new data is available it calls a signal which is connected to a slot in the GUI class. My question(s): Is this combination of signals and threads a wise idea? I another forum somebody advised someone else not to "go down this road". Are there potential deadly pitfalls nearby that I failed to see? Is my expectation realistic that it will be "easy" to use my GUI class to provide a web interface or a QT, a VTK or a whatever window? Is there a more clever alternative (like other boost libs) that I overlooked? following code compiles with g++ -Wall -o main -lboost_thread-mt <filename>.cpp code follows: #include <boost/signals2.hpp> #include <boost/thread.hpp> #include <boost/bind.hpp> #include <iostream> #include <iterator> #include <string> using std::cout; using std::cerr; using std::string; /** * Called when a CalcThread finished a new bunch of data. */ boost::signals2::signal<void(string)> signal_new_data; /** * The whole data will be stored here. */ class DataCollector { typedef boost::mutex::scoped_lock scoped_lock; boost::mutex mutex; public: /** * Called by CalcThreads call the to store their data. */ void push(const string &s, const string &caller_name) { scoped_lock lock(mutex); _data.push_back(s); signal_new_data(caller_name); } /** * Output everything collected so far to std::out. */ void out() { typedef std::vector<string>::const_iterator iter; for (iter i = _data.begin(); i != _data.end(); ++i) cout << " " << *i << "\n"; } private: std::vector<string> _data; }; /** * Several of those can calculate stuff. * No data sharing needed. */ struct CalcThread { CalcThread(string name, DataCollector &datcol) : _name(name), _datcol(datcol) { } /** * Expensive algorithms will be implemented here. * @param num_results how many data sets are to be calculated by this thread. */ void operator()(int num_results) { for (int i = 1; i <= num_results; ++i) { std::stringstream s; s << "["; if (i == num_results) s << "LAST "; s << "DATA " << i << " from thread " << _name << "]"; _datcol.push(s.str(), _name); } } private: string _name; DataCollector &_datcol; }; /** * Maybe some VTK or QT or both will be used someday. */ class GuiClass { public: GuiClass(DataCollector &datcol) : _datcol(datcol) { } /** * If the GUI wants to present or at least count the data collected so far. * @param caller_name is the name of the thread whose data is new. */ void slot_data_changed(string caller_name) const { cout << "GuiClass knows: new data from " << caller_name << std::endl; } private: DataCollector & _datcol; }; int main() { DataCollector datcol; GuiClass mc(datcol); signal_new_data.connect(boost::bind(&GuiClass::slot_data_changed, &mc, _1)); CalcThread r1("A", datcol), r2("B", datcol), r3("C", datcol), r4("D", datcol), r5("E", datcol); boost::thread t1(r1, 3); boost::thread t2(r2, 1); boost::thread t3(r3, 2); boost::thread t4(r4, 2); boost::thread t5(r5, 3); t1.join(); t2.join(); t3.join(); t4.join(); t5.join(); datcol.out(); cout << "\nDone" << std::endl; return 0; }

    Read the article

  • PHP Form not working IE and Chrome, but fine in FF

    - by RO
    <? if(isset($_POST['accountUser']) && isset($_POST['accountPassword'])) { include("dbase.php"); include("settings.php"); if ($_POST['accountType']=="member") { $database="chatusers"; } else if ($_POST['accountType']=="model") { $database="chatmodels"; } else if ($_POST['accountType']=="studioop") { $database="chatoperators"; } $userExists=false; $result = mysql_query("SELECT id,user,password,status FROM $database WHERE status!='pending' AND status!='rejected' "); while($row = mysql_fetch_array($result)) { $tempUser=$row["user"]; $tempPass=$row["password"]; $tempId=$row["id"]; if ($_POST['accountUser']==$tempUser && md5($_POST['accountPassword'])==$tempPass) { if ($row["status"]=="blocked") { $userExists=true; $errorMsg="Account is blocked, please contact the administrator for more details"; } else { $userExists=true; $currentTime=time(); mysql_query("UPDATE $database SET lastLogIn='$currentTime' WHERE id = '$tempId' LIMIT 1"); setcookie("usertype", $database, time()+3600); setcookie("id", $tempId, time()+3600); header("Location: cp/$database/"); } } } if (!$userExists){ $errorMsg="Wrong Username or password"; } } else if (isset($_GET['from']) && $_GET['from']=="recoverpass"){ $errorMsg="Your new password has been sent to your mail"; } else { $errorMsg="Please complete username and password fields"; } ?> <? include("_main.header.php"); ?> <table width="720" height="200" border="0" align="center" cellpadding="0" cellspacing="0"> <tr> <td align="center" valign="middle"><form action="login.php" method="post" enctype="application/x-www-form-urlencoded" name="form1"> <p>&nbsp;</p> <table width="720" border="0" align="center"> <tr> <td colspan="2"><p align="left"> <span class="error"><?php if ( isset($errorMsg) && $errorMsg!=""){ echo $errorMsg; } ?></span> <br> <br> </p></td> </tr> <tr> <td width="210" align="right" valign="top" class="form_definitions"><div align="right">Username:</div></td> <td align="left" valign="top"><input name="accountUser" type="text" id="accountUser" value="<? echo $_GET[user];?>" size="24" maxlength="24"></td> </tr> <tr> <td align="right" valign="top" class="form_definitions"><div align="right">Password:</div></td> <td align="left" valign="top"><input name="accountPassword" type="password" id="accountPassword2" size="24" maxlength="24"></td> </tr> <tr> <td align="right" valign="top" class="form_definitions"><div align="right">Account type:</div></td> <td align="left" valign="top"> <select name="accountType" id="select"> <option value="member" selected>Member</option> <option value="model">Model</option> <option value="studioop">Studio Operator</option> </select> <div align="left"></div></td> </tr> <tr> <td align="right" valign="top" class="form_definitions">&nbsp;</td> <td align="left" valign="top"> <input type="submit" name="Submit" value="Log In to your account"> <div align="left"></div></td> </tr> <tr> <td align="right" valign="top" class="form_definitions">&nbsp;</td> <td align="left" valign="top"><a href="lostpassword.php" class="left">Lost Password? Press Here!</a></td> </tr> </table> </form></td> </tr> </table> <br> <br> <? include("_main.footer.php"); ?>

    Read the article

  • Implementing union of Set using basic java array

    - by lupindeterd
    Note: This is an assignment. Hi, Continuing with my Set implementation using Java basic array, I'm now struggling with the 3 to last function namely the union. import java.io.*; class Set { private int numberOfElements = 0; private String[] setElements = new String[5]; private int maxNumberOfElements = 5; // constructor for our Set class public Set(int numberOfE, int setE, int maxNumberOfE) { int numberOfElements = numberOfE; String[] setElements = new String[setE]; int maxNumberOfElements = maxNumberOfE; } // Helper method to shorten/remove element of array since we're using basic array instead of ArrayList or HashSet from collection interface :( static String[] removeAt(int k, String[] arr) { final int L = arr.length; String[] ret = new String[L - 1]; System.arraycopy(arr, 0, ret, 0, k); System.arraycopy(arr, k + 1, ret, k, L - k - 1); return ret; } int findElement(String element) { int retval = 0; for ( int i = 0; i < setElements.length; i++) { if ( setElements[i] != null && setElements[i].equals(element) ) { return retval = i; } retval = -1; } return retval; } void add(String newValue) { int elem = findElement(newValue); if( numberOfElements < maxNumberOfElements && elem == -1 ) { setElements[numberOfElements] = newValue; numberOfElements++; } } int getLength() { if ( setElements != null ) { return setElements.length; } else { return 0; } } String[] emptySet() { setElements = new String[0]; return setElements; } Boolean isFull() { Boolean True = new Boolean(true); Boolean False = new Boolean(false); if ( setElements.length == maxNumberOfElements ){ return True; } else { return False; } } Boolean isEmpty() { Boolean True = new Boolean(true); Boolean False = new Boolean(false); if ( setElements.length == 0 ) { return True; } else { return False; } } void remove(String newValue) { for ( int i = 0; i < setElements.length; i++) { if ( setElements[i].equals(newValue) ) { setElements = removeAt(i,setElements); } } } int isAMember(String element) { int retval = -1; for ( int i = 0; i < setElements.length; i++ ) { if (setElements[i] != null && setElements[i].equals(element)) { return retval = i; } } return retval; } void printSet() { for ( int i = 0; i < setElements.length; i++) { System.out.println("Member elements on index: "+ i +" " + setElements[i]); } } String[] getMember() { String[] tempArray = new String[setElements.length]; for ( int i = 0; i < setElements.length; i++) { if(setElements[i] != null) { tempArray[i] = setElements[i]; } } return tempArray; } Set union(Set x, Set y) { String[] newtemparray = new String[x.getLength]; newtemparray = x.getMember; return x; } } // This is the SetDemo class that will make use of our Set class class SetDemo { public static void main(String[] args) { //get input from keyboard BufferedReader keyboard; InputStreamReader reader; String temp = ""; reader = new InputStreamReader(System.in); keyboard = new BufferedReader(reader); try { System.out.println("Enter string element to be added" ); temp = keyboard.readLine( ); System.out.println("You entered " + temp ); } catch (IOException IOerr) { System.out.println("There was an error during input"); } /* ************************************************************************** * Test cases for our new created Set class. * ************************************************************************** */ Set setA = new Set(1,10,10); setA.add(temp); setA.add("b"); setA.add("b"); setA.add("hello"); setA.add("world"); setA.add("six"); setA.add("seven"); setA.add("b"); int size = setA.getLength(); System.out.println("Set size is: " + size ); Boolean isempty = setA.isEmpty(); System.out.println("Set is empty? " + isempty ); int ismember = setA.isAMember("sixb"); System.out.println("Element six is member of setA? " + ismember ); Boolean output = setA.isFull(); System.out.println("Set is full? " + output ); setA.printSet(); int index = setA.findElement("world"); System.out.println("Element b located on index: " + index ); setA.remove("b"); setA.emptySet(); int resize = setA.getLength(); System.out.println("Set size is: " + resize ); setA.printSet(); Set setB = new Set(0,10,10); Set SetA = setA.union(setB,setA); } } Ok the method in question will be the implementation of union. As such this: Set union(Set x, Set y) { String[] newtemparray = new String[x.getLength]; newtemparray = x.getMember; return x; } I got this error: symbol : variable getLength location: class Set String[] newtemparray = new String[x.getLength]; ^ d:\javaprojects\Set.java:122: cannot find symbol symbol : variable getMember location: class Set newtemparray = x.getMember; ^ 2 errors My approach for union would be: *) create temporary array of string with size of the object x length. *) store object x members to temporary array by looping the object and calling the getMember *) loop object y members and check if element exist against temporary array. *) discard if it exist/add if it is not there *) return obj x with the union array. thanks, lupin

    Read the article

  • C# Generic Arrays and math operations on it

    - by msedi
    Hello, I'm currently involved in a project where I have very large image volumes. This volumes have to processed very fast (adding, subtracting, thresholding, and so on). Additionally most of the volume are so large that they event don't fit into the memory of the system. For that reason I have created an abstract volume class (VoxelVolume) that host the volume and image data and overloads the operators so that it's possible to perform the regular mathematical operations on volumes. Thereby two more questions opened up which I will put into stackoverflow into two additional threads. Here is my first question. My volume is implemented in a way that it only can contain float array data, but most of the containing data is from an UInt16 image source. Only operations on the volume can create float array images. When I started implementing such a volume the class looked like following: public abstract class VoxelVolume<T> { ... } but then I realized that overloading the operators or return values would get more complicated. An example would be: public abstract class VoxelVolume<T> { ... public static VoxelVolume<T> Import<T>(param string[] files) { } } also adding two overloading operators would be more complicated: ... public static VoxelVolume<T> operator+(VoxelVolume<T> A, VoxelVolume<T> B) { ... } Let's assume I can overcome the problems described above, nevertheless I have different types of arrays that contain the image data. Since I have fixed my type in the volumes to float the is no problem and I can do an unsafe operation when adding the contents of two image volume arrays. I have read a few threads here and had a look around the web, but found no real good explanation of what to do when I want to add two arrays of different types in a fast way. Unfortunately every math operation on generics is not possible, since C# is not able to calculate the size of the underlying data type. Of course there might by a way around this problem by using C++/CLR, but currently everything I have done so far, runs in 32bit and 64bit without having to do a thing. Switching to C++/CLR seemed to me (pleased correct me if I'm wrong) that I'm bound to a certain platform (32bit) and I have to compile two assemblies when I let the application run on another platform (64bit). Is this true? So asked shortly: How is it possible to add two arrays of two different types in a fast way. Is it true that the developers of C# haven't thought about this. Switching to a different language (C# - C++) seems not to be an option. I realize that simply performing this operation float []A = new float[]{1,2,3}; byte []B = new byte[]{1,2,3}; float []C = A+B; is not possible and unnecessary although it would be nice if it would work. My solution I was trying was following: public static class ArrayExt { public static unsafe TResult[] Add<T1, T2, TResult>(T1 []A, T2 []B) { // Assume the length of both arrays is equal TResult[] result = new TResult[A.Length]; GCHandle h1 = GCHandle.Alloc (A, Pinned); GCHandle h2 = GCHandle.Alloc (B, Pinned); GCHandle hR = GCHandle.Alloc (C, Pinned); void *ptrA = h1.ToPointer(); void *ptrB = h2.ToPointer(); void *ptrR = hR.ToPointer(); for (int i=0; i<A.Length; i++) { *((TResult *)ptrR) = (TResult *)((T1)*ptrA + (T2)*ptrB)); } h1.Free(); h2.Free(); hR.Free(); return result; } } Please excuse if the code above is not quite correct, I wrote it without using an C# editor. Is such a solution a shown above thinkable? Please feel free to ask if I made a mistake or described some things incompletely. Thanks for your help Martin

    Read the article

  • Printing an array in a method, from a different class?

    - by O.Lodhi
    Hello All, I'm a fairly inexperienced programmer, and i'm currently working on a Console Application project. It's basically a little 'mathematics game'; the application generates two random numbers, that have either been added, subtracted, multiplied or divided against each other randomly. The answer is shown on screen and the user has to pick from the menu which is the right mathematical operator, once the correct answer is picked the application then displays on screen how long it took for the user in milliseconds to input the correct answer. Now I want to save the times of the players in an array that can be called up later with all the scores. I need to include a method in this programme and I figured a method to save the times into an array would be suitable. I seem to have stumbled across a little problem though. I'm not quite sure what's wrong: using System; using System.Collections.Generic; using System.Linq; using System.Text; namespace Mathgame { class Program { } class arrayclass { public static void saveInArray(int duration) { int[] TopTenScores = {000,1000,2000,3000,4000,5000,6000,7000,8000,9000}; if (duration < 1000) { duration = TopTenScores[000]; } else if ((duration >= 1000) && (duration <= 1999)) { duration = TopTenScores[1000]; } else if ((duration >= 2000) && (duration <= 2999)) { duration = TopTenScores[2000]; } else if ((duration >= 3000) && (duration <= 3999)) { duration = TopTenScores[3000]; } else if ((duration >= 4000) && (duration <= 4999)) { duration = TopTenScores[4000]; } else if ((duration >= 5000) && (duration <= 5999)) { duration = TopTenScores[5000]; } else if ((duration >= 6000) && (duration <= 6999)) { duration = TopTenScores[6000]; } else if ((duration >= 7000) && (duration <= 7999)) { duration = TopTenScores[7000]; } else if ((duration >= 8000) && (duration <= 8999)) { duration = TopTenScores[8000]; } else if ((duration >= 9000) && (duration <= 9999)) { duration = TopTenScores[9000]; } Console.WriteLine(TopTenScores); } static void Main(string[] args) { int intInput, num1, num2, incorrect, array1; float answer; string input; System.Random randNum = new System.Random(); Console.WriteLine("Welcome to the Maths game!"); Console.WriteLine("(Apologies for the glitchiness!)"); Console.WriteLine(); Console.WriteLine("Please choose from the following options:"); Console.WriteLine(); retry: Console.WriteLine("1 - Test your Maths against the clock!"); Console.WriteLine("2 - Exit the application."); Console.WriteLine("3 - Top scores"); Console.WriteLine(); input = Console.ReadLine(); intInput = int.Parse(input); if (intInput == 1) { goto start; } else if (intInput == 2) { goto fin; } else if (intInput == 3) { array1 = array1.saveInArray; goto retry; } Now, in the last 'else if' statement in the code, you can see my variable array1 trying to call the method, but no matter what I do I keep getting errors. This is the only error I have at the moment, but I have a feeling soon as I resolve that error, another will come up. For now i'm just determined to get past this error: 'int' does not contain a definition for 'saveInArray' and no extension method 'saveInArray' accepting a first argument of type 'int' could be found (are you missing a using directive or an assembly reference?). Any help would be kindly appreciated, apologies in advanced for my ugly written code! And thank you to any help that I receive! Regards, Omar.

    Read the article

  • Entry lvl. COBOL Control Breaks

    - by Kyle Benzle
    I'm working in COBOL with a double control break to print a hospital record. The input is one record per line, with, hospital info first, then patient info. There are multiple records per hospital, and multiple services per patient. The idea is, using a double control break, to print one hospital name, then all the patients from that hospital. Then print the patient name just once for all services, like the below. I'm having trouble with my output, and am hoping someone can help me get it in order. I am using AccuCobol to compile experts-exchange does not allow .cob and .dat so the extentions were changed to .txt The files are: the .cob lab5b.cob the input / output: lab5bin.dat, lab5bout.dat The assignment: http://www.cse.ohio-state.edu/~sgomori/314/lab5.html Hospital Number: 001 Hospital Name: Mount Carmel 00001 Griese, Brian Ear Infection 08/24/1999 300.00 Diaper Rash 09/05/1999 25.00 Frontal Labotomy 09/25/1999 25,000.00 Rear Labotomy 09/26/1999 25,000.00 Central Labotomy 09/28/1999 24,999.99 The total amount owed for this patient is: $.......... (End of Hospital) The total amount owed for this hospital is: $......... enter code here IDENTIFICATION DIVISION. PROGRAM-ID. LAB5B. ENVIRONMENT DIVISION. INPUT-OUTPUT SECTION. FILE-CONTROL. SELECT FILE-IN ASSIGN TO 'lab5bin.dat' ORGANIZATION IS LINE SEQUENTIAL. SELECT FILE-OUT ASSIGN TO 'lab5bout.dat' ORGANIZATION IS LINE SEQUENTIAL. DATA DIVISION. FILE SECTION. FD FILE-IN. 01 HOSPITAL-RECORD-IN. 05 HOSPITAL-NUMBER-IN PIC 999. 05 HOSPITAL-NAME-IN PIC X(20). 05 PATIENT-NUMBER-IN PIC 99999. 05 PATIENT-NAME-IN PIC X(20). 05 SERVICE-IN PIC X(30). 05 DATE-IN PIC 9(8). 05 OWED-IN PIC 9(7)V99. FD FILE-OUT. 01 REPORT-REC-OUT PIC X(100). WORKING-STORAGE SECTION. 01 WS-WORK-AREAS. 05 WS-HOLD-HOSPITAL-NUM PIC 999 VALUE ZEROS. 05 WS-HOLD-PATIENT-NUM PIC 99999 VALUE ZEROS. 05 ARE-THERE-MORE-RECORDS PIC XXX VALUE 'YES'. 88 MORE-RECORDS VALUE 'YES'. 88 NO-MORE-RECORDS VALUE 'NO '. 05 FIRST-RECORD PIC XXX VALUE 'YES'. 05 WS-PATIENT-TOTAL PIC 9(9)V99 VALUE ZEROS. 05 WS-HOSPITAL-TOTAL PIC 9(9)V99 VALUE ZEROS. 05 WS-PAGE-CTR PIC 99 VALUE ZEROS. 01 WS-DATE. 05 WS-YR PIC 9999. 05 WS-MO PIC 99. 05 WS-DAY PIC 99. 01 HL-HEADING1. 05 PIC X(49) VALUE SPACES. 05 PIC X(14) VALUE 'OHIO INSURANCE'. 05 PIC X(7) VALUE SPACES. 05 HL-PAGE PIC Z9. 05 PIC X(14) VALUE SPACES. 05 HL-DATE. 10 HL-MO PIC 99. 10 PIC X VALUE '/'. 10 HL-DAY PIC 99. 10 PIC X VALUE '/'. 10 HL-YR PIC X VALUE '/'. 01 HL-HEADING2. 05 PIC XXXXXXXXXX VALUE 'HOSPITAL: '. 05 HL-HOSPITAL PIC 999. 01 HL-HEADING3. 05 PIC X(7) VALUE "Patient". 05 PIC X(3) VALUE SPACES. 05 PIC X(7) VALUE "Patient". 05 PIC X(39) VALUE SPACES. 05 PIC X(7) VALUE "Date of". 05 PIC X(3) VALUE SPACES. 05 PIC X(6) VALUE "Amount". 01 HL-HEADING4. 05 PIC X(6) VALUE "Number". 05 PIC X(4) VALUE SPACES. 05 PIC X(4) VALUE "Name". 05 PIC X(18) VALUE SPACES. 05 PIC X(10) VALUE "Service". 05 PIC X(14) VALUE SPACES. 05 PIC X(8) VALUE "Service". 05 PIC X(2) VALUE SPACES. 05 PIC X(5) VALUE "Owed". 01 DL-PATIENT-LINE. 05 PIC X(28) VALUE SPACES. 05 DL-PATIENT-NUMBER PIC XXXXX. 05 PIC X(21) VALUE SPACES. 05 DL-PATIENT-TOTAL PIC $$$,$$$,$$9.99. 01 DL-HOSPITAL-LINE. 05 PIC X(47) VALUE SPACES. 05 PIC X(16) VALUE 'HOSPITAL TOTAL: '. 05 DL-HOSPITAL-TOTAL PIC $$$,$$$,$$9.99. PROCEDURE DIVISION. 100-MAIN-MODULE. PERFORM 600-INITIALIZATION-RTN PERFORM UNTIL NO-MORE-RECORDS READ FILE-IN AT END MOVE 'NO ' TO ARE-THERE-MORE-RECORDS NOT AT END PERFORM 200-DETAIL-RTN END-READ END-PERFORM PERFORM 400-HOSPITAL-BREAK PERFORM 700-END-OF-JOB-RTN STOP RUN. 200-DETAIL-RTN. EVALUATE TRUE WHEN FIRST-RECORD = 'YES' MOVE PATIENT-NUMBER-IN TO WS-HOLD-PATIENT-NUM MOVE HOSPITAL-NUMBER-IN TO WS-HOLD-HOSPITAL-NUM PERFORM 500-HEADING-RTN MOVE 'NO ' TO FIRST-RECORD WHEN HOSPITAL-NUMBER-IN NOT = WS-HOLD-HOSPITAL-NUM PERFORM 400-HOSPITAL-BREAK WHEN PATIENT-NUMBER-IN NOT = WS-HOLD-PATIENT-NUM PERFORM 300-PATIENT-BREAK END-EVALUATE ADD OWED-IN TO WS-PATIENT-TOTAL. 300-PATIENT-BREAK. MOVE WS-PATIENT-TOTAL TO DL-PATIENT-TOTAL MOVE WS-HOLD-PATIENT-NUM TO DL-PATIENT-NUMBER WRITE REPORT-REC-OUT FROM DL-PATIENT-LINE AFTER ADVANCING 2 LINES ADD WS-PATIENT-TOTAL TO WS-HOSPITAL-TOTAL IF MORE-RECORDS MOVE ZEROS TO WS-PATIENT-TOTAL MOVE PATIENT-NUMBER-IN TO WS-HOLD-PATIENT-NUM END-IF. 400-HOSPITAL-BREAK. PERFORM 300-PATIENT-BREAK MOVE WS-HOSPITAL-TOTAL TO DL-HOSPITAL-TOTAL WRITE REPORT-REC-OUT FROM DL-HOSPITAL-LINE AFTER ADVANCING 2 LINES IF MORE-RECORDS MOVE ZEROS TO WS-HOSPITAL-TOTAL MOVE HOSPITAL-NUMBER-IN TO WS-HOLD-HOSPITAL-NUM PERFORM 500-HEADING-RTN END-IF. 500-HEADING-RTN. ADD 1 TO WS-PAGE-CTR MOVE WS-PAGE-CTR TO HL-PAGE MOVE WS-HOLD-HOSPITAL-NUM TO HL-HOSPITAL WRITE REPORT-REC-OUT FROM HL-HEADING1 AFTER ADVANCING PAGE WRITE REPORT-REC-OUT FROM HL-HEADING2 AFTER ADVANCING 2 LINES. WRITE REPORT-REC-OUT FROM HL-HEADING3 AFTER ADVANCING 2 LINES. 600-INITIALIZATION-RTN. OPEN INPUT FILE-IN OUTPUT FILE-OUT *159 ACCEPT WS-DATE FROM DATE YYYYMMDD MOVE WS-YR TO HL-YR MOVE WS-MO TO HL-MO MOVE WS-DAY TO HL-DAY. 700-END-OF-JOB-RTN. CLOSE FILE-IN FILE-OUT.

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Returning new object, overwrite the existing one in Java

    - by lupin
    Note: This is an assignment. Hi, Ok I have this method that will create a supposedly union of 2 sets. i mport java.io.*; class Set { public int numberOfElements; public String[] setElements; public int maxNumberOfElements; // constructor for our Set class public Set(int numberOfE, int setE, int maxNumberOfE) { this.numberOfElements = numberOfE; this.setElements = new String[setE]; this.maxNumberOfElements = maxNumberOfE; } // Helper method to shorten/remove element of array since we're using basic array instead of ArrayList or HashSet from collection interface :( static String[] removeAt(int k, String[] arr) { final int L = arr.length; String[] ret = new String[L - 1]; System.arraycopy(arr, 0, ret, 0, k); System.arraycopy(arr, k + 1, ret, k, L - k - 1); return ret; } int findElement(String element) { int retval = 0; for ( int i = 0; i < setElements.length; i++) { if ( setElements[i] != null && setElements[i].equals(element) ) { return retval = i; } retval = -1; } return retval; } void add(String newValue) { int elem = findElement(newValue); if( numberOfElements < maxNumberOfElements && elem == -1 ) { setElements[numberOfElements] = newValue; numberOfElements++; } } int getLength() { if ( setElements != null ) { return setElements.length; } else { return 0; } } String[] emptySet() { setElements = new String[0]; return setElements; } Boolean isFull() { Boolean True = new Boolean(true); Boolean False = new Boolean(false); if ( setElements.length == maxNumberOfElements ){ return True; } else { return False; } } Boolean isEmpty() { Boolean True = new Boolean(true); Boolean False = new Boolean(false); if ( setElements.length == 0 ) { return True; } else { return False; } } void remove(String newValue) { for ( int i = 0; i < setElements.length; i++) { if ( setElements[i] != null && setElements[i].equals(newValue) ) { setElements = removeAt(i,setElements); } } } int isAMember(String element) { int retval = -1; for ( int i = 0; i < setElements.length; i++ ) { if (setElements[i] != null && setElements[i].equals(element)) { return retval = i; } } return retval; } void printSet() { for ( int i = 0; i < setElements.length; i++) { if (setElements[i] != null) { System.out.println("Member elements on index: "+ i +" " + setElements[i]); } } } String[] getMember() { String[] tempArray = new String[setElements.length]; for ( int i = 0; i < setElements.length; i++) { if(setElements[i] != null) { tempArray[i] = setElements[i]; } } return tempArray; } Set union(Set x, Set y) { String[] newXtemparray = new String[x.getLength()]; String[] newYtemparray = new String[y.getLength()]; int len = newYtemparray.length + newXtemparray.length; Set temp = new Set(0,len,len); newXtemparray = x.getMember(); newYtemparray = x.getMember(); for(int i = 0; i < newYtemparray.length; i++) { temp.add(newYtemparray[i]); } for(int j = 0; j < newXtemparray.length; j++) { temp.add(newXtemparray[j]); } return temp; } Set difference(Set x, Set y) { String[] newXtemparray = new String[x.getLength()]; String[] newYtemparray = new String[y.getLength()]; int len = newYtemparray.length + newXtemparray.length; Set temp = new Set(0,len,len); newXtemparray = x.getMember(); newYtemparray = x.getMember(); for(int i = 0; i < newXtemparray.length; i++) { temp.add(newYtemparray[i]); } for(int j = 0; j < newYtemparray.length; j++) { int retval = temp.findElement(newYtemparray[j]); if( retval != -1 ) { temp.remove(newYtemparray[j]); } } return temp; } } // This is the SetDemo class that will make use of our Set class class SetDemo { public static void main(String[] args) { //get input from keyboard BufferedReader keyboard; InputStreamReader reader; String temp = ""; reader = new InputStreamReader(System.in); keyboard = new BufferedReader(reader); try { System.out.println("Enter string element to be added" ); temp = keyboard.readLine( ); System.out.println("You entered " + temp ); } catch (IOException IOerr) { System.out.println("There was an error during input"); } /* ************************************************************************** * Test cases for our new created Set class. * ************************************************************************** */ Set setA = new Set(0,10,10); setA.add(temp); setA.add("b"); setA.add("b"); setA.add("hello"); setA.add("world"); setA.add("six"); setA.add("seven"); setA.add("b"); int size = setA.getLength(); System.out.println("Set size is: " + size ); Boolean isempty = setA.isEmpty(); System.out.println("Set is empty? " + isempty ); int ismember = setA.isAMember("sixb"); System.out.println("Element sixb is member of setA? " + ismember ); Boolean output = setA.isFull(); System.out.println("Set is full? " + output ); //setA.printSet(); int index = setA.findElement("world"); System.out.println("Element b located on index: " + index ); setA.remove("b"); //setA.emptySet(); int resize = setA.getLength(); System.out.println("Set size is: " + resize ); //setA.printSet(); Set setB = new Set(0,10,10); setB.add("b"); setB.add("z"); setB.add("x"); setB.add("y"); Set setC = setA.union(setB,setA); System.out.println("Elements of setA"); setA.printSet(); System.out.println("Union of setA and setB"); setC.printSet(); } } The union method works a sense that somehow I can call another method on it but it doesn't do the job, i supposedly would create and union of all elements of setA and setB but it only return element of setB. Sample output follows: java SetDemo Enter string element to be added hello You entered hello Set size is: 10 Set is empty? false Element sixb is member of setA? -1 Set is full? true Element b located on index: 2 Set size is: 9 Elements of setA Member elements on index: 0 hello Member elements on index: 1 world Member elements on index: 2 six Member elements on index: 3 seven Union of setA and setB Member elements on index: 0 b Member elements on index: 1 z Member elements on index: 2 x Member elements on index: 3 y thanks, lupin

    Read the article

  • Java constructor and modify the object properties at runtime

    - by lupin
    Note: This is an assignment Hi, I have the following class/constructor. import java.io.*; class Set { public int numberOfElements = 0; public String[] setElements = new String[5]; public int maxNumberOfElements = 5; // constructor for our Set class public Set(int numberOfE, int setE, int maxNumberOfE) { int numberOfElements = numberOfE; String[] setElements = new String[setE]; int maxNumberOfElements = maxNumberOfE; } // Helper method to shorten/remove element of array since we're using basic array instead of ArrayList or HashSet from collection interface :( static String[] removeAt(int k, String[] arr) { final int L = arr.length; String[] ret = new String[L - 1]; System.arraycopy(arr, 0, ret, 0, k); System.arraycopy(arr, k + 1, ret, k, L - k - 1); return ret; } int findElement(String element) { int retval = 0; for ( int i = 0; i < setElements.length; i++) { if ( setElements[i] != null && setElements[i].equals(element) ) { return retval = i; } retval = -1; } return retval; } void add(String newValue) { int elem = findElement(newValue); if( numberOfElements < maxNumberOfElements && elem == -1 ) { setElements[numberOfElements] = newValue; numberOfElements++; } } int getLength() { if ( setElements != null ) { return setElements.length; } else { return 0; } } String[] emptySet() { setElements = new String[0]; return setElements; } Boolean isFull() { Boolean True = new Boolean(true); Boolean False = new Boolean(false); if ( setElements.length == maxNumberOfElements ){ return True; } else { return False; } } Boolean isEmpty() { Boolean True = new Boolean(true); Boolean False = new Boolean(false); if ( setElements.length == 0 ) { return True; } else { return False; } } void remove(String newValue) { for ( int i = 0; i < setElements.length; i++) { if ( setElements[i].equals(newValue) ) { setElements = removeAt(i,setElements); } } } int isAMember(String element) { int retval = -1; for ( int i = 0; i < setElements.length; i++ ) { if (setElements[i] != null && setElements[i].equals(element)) { return retval = i; } } return retval; } void printSet() { for ( int i = 0; i < setElements.length; i++) { System.out.println("Member elements on index: "+ i +" " + setElements[i]); } } String[] getMember() { String[] tempArray = new String[setElements.length]; for ( int i = 0; i < setElements.length; i++) { if(setElements[i] != null) { tempArray[i] = setElements[i]; } } return tempArray; } Set union(Set x, Set y) { String[] newXtemparray = new String[x.getLength()]; String[] newYtemparray = new String[y.getLength()]; Set temp = new Set(1,20,20); newXtemparray = x.getMember(); newYtemparray = x.getMember(); for(int i = 0; i < newXtemparray.length; i++) { temp.add(newYtemparray[i]); } for(int j = 0; j < newYtemparray.length; j++) { temp.add(newYtemparray[j]); } return temp; } } // This is the SetDemo class that will make use of our Set class class SetDemo { public static void main(String[] args) { //get input from keyboard BufferedReader keyboard; InputStreamReader reader; String temp = ""; reader = new InputStreamReader(System.in); keyboard = new BufferedReader(reader); try { System.out.println("Enter string element to be added" ); temp = keyboard.readLine( ); System.out.println("You entered " + temp ); } catch (IOException IOerr) { System.out.println("There was an error during input"); } /* ************************************************************************** * Test cases for our new created Set class. * ************************************************************************** */ Set setA = new Set(1,10,10); setA.add(temp); setA.add("b"); setA.add("b"); setA.add("hello"); setA.add("world"); setA.add("six"); setA.add("seven"); setA.add("b"); int size = setA.getLength(); System.out.println("Set size is: " + size ); Boolean isempty = setA.isEmpty(); System.out.println("Set is empty? " + isempty ); int ismember = setA.isAMember("sixb"); System.out.println("Element six is member of setA? " + ismember ); Boolean output = setA.isFull(); System.out.println("Set is full? " + output ); setA.printSet(); int index = setA.findElement("world"); System.out.println("Element b located on index: " + index ); setA.remove("b"); setA.emptySet(); int resize = setA.getLength(); System.out.println("Set size is: " + resize ); setA.printSet(); Set setB = new Set(0,10,10); Set SetA = setA.union(setB,setA); SetA.printSet(); } } I have two question here, why I when I change the class property declaration to: class Set { public int numberOfElements; public String[] setElements; public int maxNumberOfElements; // constructor for our Set class public Set(int numberOfE, int setE, int maxNumberOfE) { int numberOfElements = numberOfE; String[] setElements = new String[setE]; int maxNumberOfElements = maxNumberOfE; } I got this error: \ javaprojects>java SetDemo Enter string element to be added a You entered a Exception in thread "main" java.lang.NullPointerException at Set.findElement(Set.java:30) at Set.add(Set.java:43) at SetDemo.main(Set.java:169) Second, on the union method, why the result of SetA.printSet still printing null, isn't it getting back the return value from union method? Thanks in advance for any explaination. lupin

    Read the article

  • Using a boost::fusion::map in boost::spirit::karma

    - by user1097105
    I am using boost spirit to parse some text files into a data structure and now I am beginning to generate text from this data structure (using spirit karma). One attempt at a data structure is a boost::fusion::map (as suggested in an answer to this question). But although I can use boost::spirit::qi::parse() and get data in it easily, when I tried to generate text from it using karma, I failed. Below is my attempt (look especially at the "map_data" type). After some reading and playing around with other fusion types, I found boost::fusion::vector and BOOST_FUSION_DEFINE_ASSOC_STRUCT. I succeeded to generate output with both of them, but they don't seem ideal: in vector you cannot access a member using a name (it is like a tuple) -- and in the other solution, I don't think I need both ways (member name and key type) to access the members. #include <iostream> #include <string> #include <boost/spirit/include/karma.hpp> #include <boost/fusion/include/map.hpp> #include <boost/fusion/include/make_map.hpp> #include <boost/fusion/include/vector.hpp> #include <boost/fusion/include/as_vector.hpp> #include <boost/fusion/include/transform.hpp> struct sb_key; struct id_key; using boost::fusion::pair; typedef boost::fusion::map < pair<sb_key, int> , pair<id_key, unsigned long> > map_data; typedef boost::fusion::vector < int, unsigned long > vector_data; #include <boost/fusion/include/define_assoc_struct.hpp> BOOST_FUSION_DEFINE_ASSOC_STRUCT( (), assocstruct_data, (int, a, sb_key) (unsigned long, b, id_key)) namespace karma = boost::spirit::karma; template <typename X> std::string to_string ( const X& data ) { std::string generated; std::back_insert_iterator<std::string> sink(generated); karma::generate_delimited ( sink, karma::int_ << karma::ulong_, karma::space, data ); return generated; } int main() { map_data d1(boost::fusion::make_map<sb_key, id_key>(234, 35314988526ul)); vector_data d2(boost::fusion::make_vector(234, 35314988526ul)); assocstruct_data d3(234,35314988526ul); std::cout << "map_data as_vector: " << boost::fusion::as_vector(d1) << std::endl; //std::cout << "map_data to_string: " << to_string(d1) << std::endl; //*FAIL No 1* std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d1) << boost::fusion::at_c<0>(d1) << std::endl << std::endl; std::cout << "vector_data: " << d2 << std::endl; std::cout << "vector_data to_string: " << to_string(d2) << std::endl << std::endl; std::cout << "assoc_struct as_vector: " << boost::fusion::as_vector(d3) << std::endl; std::cout << "assoc_struct to_string: " << to_string(d3) << std::endl; std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d3) << d3.a << boost::fusion::at_c<0>(d3) << std::endl; return 0; } Including the commented line gives lots of pages of compilation errors, among which notably something like: no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘double’ no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘float’ Might it be that to_string needs the values of the map_data, and not the pairs? Though I am not good with templates, I tried to get a vector from a map using transform in the following way template <typename P> struct take_second { typename P::second_type operator() (P p) { return p.second; } }; // ... inside main() pair <char, int> ff(32); std::cout << "take_second (expect 32): " << take_second<pair<char,int>>()(ff) << std::endl; std::cout << "transform map_data and to_string: " << to_string(boost::fusion::transform(d1, take_second<>())); //*FAIL No 2* But I don't know what types am I supposed to give when instantiating take_second and anyway I think there must be an easier way to get (iterate over) the values of a map (is there?) If you answer this question, please also give your opinion on whether using an ASSOC_STRUCT or a map is better.

    Read the article

  • cannot delete from doubly linked list using visual studios in C

    - by Jesus Sanchez
    hello I am currently doing an assignment that is supposed to read in a file, use the information, and then print out another file. all using doubly linked list. Currently i am trying to just read in the file into a doubly linked list, print it out onto the screen and a file, and finally delete the list and close the program. The program works fine as long as I don't call the dlist_distroy function which is supposed to delete the string. as soon as I do it the program starts running and then a window pops up saying "Windows has triggered a breakpoint in tempfilter.exe. This may be due to a corruption of the heap, which indicates a bug in tempfilter.exe or any of the DLLs it has loaded. This may also be due to the user pressing F12 while tempfilter.exe has focus. The output window may have more diagnostic information." I have revised the destroy and remove functions and cant understand the problem. my program is the following main.c #include <stdlib.h> #include <stdio.h> #include <string.h> #include "dlinklist.h" #include "DlistElmt.h" #include "Dlist.h" #include "dlistdata.h" /**************************************************************************************************/ int main ( int argc, char *argv[] ) { FILE *ifp, *ofp; int hour, min; Dlist *list; DlistElmt *current=NULL, *element; float temp; list = (Dlist *)malloc(sizeof(list)); element = (DlistElmt *)malloc(sizeof(element)); if ( argc != 3 ) /* argc should be 3 for correct execution */ { /* We print argv[0] assuming it is the program name */ /* TODO: This is wrong, it should be: usage: %s inputfile outputfile */ printf( "usage: %s filename", argv[0] ); } else { // We assume argv[1] is a filename to open ifp = fopen( argv[1], "r" ); if (ifp == 0 ){ printf("Could not open file\n"); } else{ ofp = fopen(argv[2], "w"); dlist_init(list);//, (destroy)(hour, min, temp)); while (fscanf(ifp, "%d:%d %f ", &hour, &min, &temp) == 3) { current=list->tail; if(dlist_size(list)==0){ dlist_ins_prev(list, current, hour, min, temp); } else{ dlist_ins_next(list, current, hour, min, temp); } } current = list->head; while(current != NULL){ if(current==list->head){ current=current->next; } else if((current->temp > (current->prev->temp +5)) || (current->temp < (current->prev->temp -5))){ dlist_remove(list, current); current=current->next; } else current=current->next; } current = list->head; while(current != NULL){ printf("%d:%d %2.1lf\n" ,current->time, current->time2, current->temp ); fprintf(ofp, "%d:%d %2.1lf\n", current->time, current->time2, current->temp ); current = current->next; } //dlist_destroy(list); //} fclose(ifp); fclose(ofp); } } getchar(); } dlistdata.c #include <stdlib.h> #include <stdio.h> #include <string.h> #include "dlinklist.h" #include "DlistElmt.h" #include "dlistdata.h" /**************************************************************************************************/ void dlist_init(Dlist *list){ list->size = 0; list->head = NULL; list->tail = NULL; return; } void dlist_destroy(Dlist *list){ while (dlist_size(list) > 0){ dlist_remove(list, list->head); } memset(list, 0, sizeof(Dlist)); return; } int dlist_ins_next(Dlist *list, DlistElmt *element, const int time, const int time2, const float temp){ DlistElmt *new_element; if (element == NULL && dlist_size(list) != 0) return -1; if ((new_element = (DlistElmt *)malloc(sizeof(new_element))) == NULL) return -1; new_element->time = (int )time; new_element->time2 = (int )time2; new_element->temp = (float )temp; if (dlist_size(list) == 0) { list->head = new_element; list->head->prev = NULL; list->head->next = NULL; list->tail = new_element; } else { new_element->next = element->next; new_element->prev = element; if(element->next == NULL) list->tail = new_element; else element->next->prev = new_element; element->next = new_element; } list->size++; return 0; } int dlist_ins_prev(Dlist *list, DlistElmt *element, const int time, const int time2, const float temp){ DlistElmt *new_element; if (element == NULL && dlist_size(list) != 0) return -1; if ((new_element = (DlistElmt *)malloc(sizeof(new_element))) == NULL) return -1; new_element->time = (int )time; new_element->time2 = (int )time2; new_element->temp = (float )temp; if (dlist_size(list) == 0){ list->head = new_element; list->head->prev = NULL; list->head->next=NULL; list->tail = new_element; } else{ new_element->next = element; new_element->prev = element->prev; if(element->prev ==NULL) list->head = new_element; else element->prev->next = new_element; element->prev = new_element; } list->size++; return 0; } int dlist_remove(Dlist *list, DlistElmt *element){//, int time, int time2, float temp){ if (element == NULL || dlist_size(list) == 0) return -1; if (element == list->head) { list->head = element->next; if (list->head == NULL) list->tail = NULL; else element->next->prev = NULL; } else{ element->prev->next = element->next; if (element->next = NULL) list->tail = element->prev; else element->next->prev = element->prev; } free(element); list->size--; return 0; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • need prefuse graph edges like arrows

    - by merve
    Hello, I did my homework and searched both google for a sample and a topic that is answered before on stackoverflow. But nothing has been found. My problem is ordinary edges who does not have a view like arrows. Here is what i do to hope there is forward arrows from target to destination: LabelRenderer nameLabel = new LabelRenderer("name"); nameLabel.setRoundedCorner(8, 8); DefaultRendererFactory rendererFactory = new DefaultRendererFactory(nameLabel); EdgeRenderer edgeRenderer; edgeRenderer = new EdgeRenderer(prefuse.Constants.EDGE_TYPE_LINE, prefuse.Constants.EDGE_ARROW_FORWARD); rendererFactory.setDefaultEdgeRenderer(edgeRenderer); vis.setRendererFactory(rendererFactory); Here is what i see about colour of edges, hoping these must not be transparent: int[] palette = new int[]{ColorLib.rgb(255, 180, 180), ColorLib.rgb(190, 190, 255)}; DataColorAction fill = new DataColorAction("socialnet.nodes", "gender", Constants.NOMINAL, VisualItem.FILLCOLOR, palette); ColorAction text = new ColorAction("socialnet.nodes", VisualItem.TEXTCOLOR, ColorLib.gray(0)); ColorAction edges = new ColorAction("socialnet.edges", VisualItem.STROKECOLOR, ColorLib.gray(200)); ColorAction arrow = new ColorAction("socialnet.edges", VisualItem.FILLCOLOR, ColorLib.gray(200)); ActionList colour = new ActionList(); colour.add(fill); colour.add(text); colour.add(edges); colour.add(arrow); vis.putAction("colour", colour); Thus, i wonder where am i wrong? Why my edges do not seem like arrows? Thanks for any idea. For more detail, i want to paste all of the code: /* * To change this template, choose Tools | Templates * and open the template in the editor. */ package prefusedeneme; import javax.swing.JFrame; import prefuse.data.*; import prefuse.data.io.*; import prefuse.Display; import prefuse.Visualization; import prefuse.render.*; import prefuse.util.*; import prefuse.action.assignment.*; import prefuse.Constants; import prefuse.visual.*; import prefuse.action.*; import prefuse.activity.*; import prefuse.action.layout.graph.*; import prefuse.controls.*; import prefuse.data.expression.Predicate; import prefuse.data.expression.parser.ExpressionParser; public class SocialNetworkVis { public static void main(String argv[]) { // 1. Load the data Graph graph = null; /* graph will contain the core data */ try { graph = new GraphMLReader().readGraph("socialnet.xml"); /* load the data from an XML file */ } catch (DataIOException e) { e.printStackTrace(); System.err.println("Error loading graph. Exiting..."); System.exit(1); } // 2. prepare the visualization Visualization vis = new Visualization(); /* vis is the main object that will run the visualization */ vis.add("socialnet", graph); /* add our data to the visualization */ // 3. setup the renderers and the render factory // labels for name LabelRenderer nameLabel = new LabelRenderer("name"); nameLabel.setRoundedCorner(8, 8); /* nameLabel decribes how to draw the data elements labeled as "name" */ // create the render factory DefaultRendererFactory rendererFactory = new DefaultRendererFactory(nameLabel); EdgeRenderer edgeRenderer; edgeRenderer = new EdgeRenderer(prefuse.Constants.EDGE_TYPE_LINE, prefuse.Constants.EDGE_ARROW_FORWARD); rendererFactory.setDefaultEdgeRenderer(edgeRenderer); vis.setRendererFactory(rendererFactory); // 4. process the actions // colour palette for nominal data type int[] palette = new int[]{ColorLib.rgb(255, 180, 180), ColorLib.rgb(190, 190, 255)}; /* ColorLib.rgb converts the colour values to integers */ // map data to colours in the palette DataColorAction fill = new DataColorAction("socialnet.nodes", "gender", Constants.NOMINAL, VisualItem.FILLCOLOR, palette); /* fill describes what colour to draw the graph based on a portion of the data */ // node text ColorAction text = new ColorAction("socialnet.nodes", VisualItem.TEXTCOLOR, ColorLib.gray(0)); /* text describes what colour to draw the text */ // edge ColorAction edges = new ColorAction("socialnet.edges", VisualItem.STROKECOLOR, ColorLib.gray(200)); ColorAction arrow = new ColorAction("socialnet.edges", VisualItem.FILLCOLOR, ColorLib.gray(200)); /* edge describes what colour to draw the edges */ // combine the colour assignments into an action list ActionList colour = new ActionList(); colour.add(fill); colour.add(text); colour.add(edges); colour.add(arrow); vis.putAction("colour", colour); /* add the colour actions to the visualization */ // create a separate action list for the layout ActionList layout = new ActionList(Activity.INFINITY); layout.add(new ForceDirectedLayout("socialnet")); /* use a force-directed graph layout with default parameters */ layout.add(new RepaintAction()); /* repaint after each movement of the graph nodes */ vis.putAction("layout", layout); /* add the laout actions to the visualization */ // 5. add interactive controls for visualization Display display = new Display(vis); display.setSize(700, 700); display.pan(350, 350); // pan to the middle display.addControlListener(new DragControl()); /* allow items to be dragged around */ display.addControlListener(new PanControl()); /* allow the display to be panned (moved left/right, up/down) (left-drag)*/ display.addControlListener(new ZoomControl()); /* allow the display to be zoomed (right-drag) */ // 6. launch the visualizer in a JFrame JFrame frame = new JFrame("prefuse tutorial: socialnet"); /* frame is the main window */ frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.add(display); /* add the display (which holds the visualization) to the window */ frame.pack(); frame.setVisible(true); /* start the visualization working */ vis.run("colour"); vis.run("layout"); } }

    Read the article

  • C++ Deck and Card Class Error with bad alloc

    - by user3702164
    Just started learn to code in school. Our assignment requires us to create a card game with card,deck and hand class. I am having troubles with it now and i keep getting exception: std::bad_alloc at memory location. Here are my codes right now CardType h: #ifndef cardType_h #define cardType_h #include <string> using namespace std; class cardType{ public: void print(); int getValue() const; string getSymbol() const; string getSpecial() const; string getSuit() const; int checkSpecial(int gscore) const; cardType(); cardType(string suit,int value); private: int value; string special; string symbol; string suit; }; #endif CardType cpp: #include "cardType.h" #include <iostream> #include <string> using namespace std; void cardType::print() { cout << getSymbol() << " of " << getSuit() << ", having the value of " << getValue() << "."<< endl <<"This card's special is " << getSpecial() << endl; } int cardType::getValue() const { return value; } string cardType::getSymbol() const { return symbol; } string cardType::getSpecial() const { return special; } string cardType::getSuit() const { return suit; } cardType::cardType(){ value=0; symbol="?"; special='?'; suit='?'; } cardType::cardType(string s, int v){ suit = s; value = v; switch(v){ case 1: // Ace cards have a value of 1 and have no special type symbol="Ace"; special="None"; break; case 2: // 2 cards have a value of 2 and have no special type symbol="2"; special="None"; break; case 3: symbol="3"; // 3 cards have a value of 3 and have no special type special="None"; break; case 4: symbol="4"; // 4 cards have a value of 0 and have a special type "Reverse" which reverses the flow of the game special="Reverse"; value=0; break; case 5: symbol="5"; // 5 cards have a value of 5 and have no special type special="None"; break; case 6: symbol="6"; // 6 cards have a value of 6 and have no special type special="None"; break; case 7: symbol="7"; // 7 cards have a value of 7 and have no special type special="None"; break; case 8: symbol="8"; // 8 cards have a value of 8 and have no special type special="None"; break; case 9: symbol="9"; // 9 cards have a value of 0 and have a special type "Pass" which does not add any value to the game and lets the player skip his turn. special="Pass"; value=0; break; case 10: symbol="10"; // 10 cards have a value of 10 and have a special type "subtract" which instead of adding the 10 value to the total game it is subtracted instead. special="Subtract"; value=10; break; case 11: // Jack cards have a value of 10 and have no special type symbol="Jack"; special="None"; value=10; break; case 12: // Queens cards have a value of 10 and have no special type symbol="Queen"; special="None"; value=10; break; case 13: symbol="King"; // King cards have a value of 0 and have a special type "NinetyNine" which changes the total game score to 99 reguardless what number it was previously special="NinetyNine"; value=0; break; } } int cardType::checkSpecial(int gscore) const{ if(special=="Pass"){ return gscore; } if(special=="Reverse"){ return gscore; } if(special=="Subtract"){ return gscore - value; } if(special=="NinetyNine"){ return 99; } else{ return gscore + value; } } DeckType h: #ifndef deckType_h #define deckType_h #include "cardType.h" #include <string> using namespace std; class deckType { public: void shuffle(); cardType dealCard(); deckType(); private: cardType *deck; int current; }; #endif DeckType cpp: #include <iostream> #include "deckType.h" using namespace std; deckType::deckType() { int index = 0; int current=0; deck = new cardType[52]; string suit[] = {"Hearts","Diamonds","Clubs","Spades"}; int value[] = {1,2,3,4,5,6,7,8,9,10,11,12,13}; for ( int i = 0; i <= 3; i++ ) { for ( int j = 1; j <= 13; j++ ) { deck[index] = cardType(suit[i],value[j]); index++; } } } cardType deckType::dealCard() { return deck[current]; current++; } Main cpp : #include "deckType.h" #include <iostream> using namespace std; int main() { deckType gamedeck; cout << "1" <<endl; cardType currentCard; cout << "2" <<endl; currentCard = gamedeck.dealCard(); cout << "3" <<endl; return 0; } I keep getting bad_alloc at the currentCard = gamedeck.dealCard(); I really do not know what i have done wrong.

    Read the article

  • Update table rows in a non-sequential way using the output of a php script

    - by moviemaniac
    Good evening everybody, this is my very first question and I hope I've done my search in stack's archive at best!!! I need to monitor several devices by querying theyr mysql database and gather some informations. Then these informations are presented to the operator in an html table. I have wrote a php script wich loads devices from a multidimensional array, loops through the array and gather data and create the table. The table structure is the following: <table id="monitoring" class="rt cf"> <thead class="cf"> <tr> <th>Device</th> <th>Company</th> <th>Data1</th> <th>Data2</th> <th>Data3</th> <th>Data4</th> <th>Data5</th> <th>Data6</th> <th>Data7</th> <th>Data8</th> <th>Data9</th> </tr> </thead> <tbody> <tr id="Device1"> <td>Devide 1 name</td> <td>xx</td> <td><img src="/path_to_images/ajax_loader.gif" width="24px" /></td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> <tr id="Device2"> <td>Devide 1 name</td> <td>xx</td> <td><img src="/path_to_images/ajax_loader.gif" width="24px" /></td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> <tr id="DeviceN"> <td>Devide 1 name</td> <td>xx</td> <td><img src="/path_to_images/ajax_loader.gif" width="24px" /></td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> <td>&nbsp;</td> </tr> </tbody> </table> The above table is directly populated when I first load the page; then, with a very simple function, i update this table every minute without reloading the page: <script> var auto_refresh = setInterval( function() { jQuery("#monitoring").load('/overview.php').fadeIn("slow"); var UpdateTime= new Date(); var StrUpdateTime; StrUpdateTime= ('0' + UpdateTime.getHours()).slice(-2) + ':' + ('0' + UpdateTime.getMinutes()).slice(-2) + ':' + ('0' + UpdateTime.getSeconds()).slice(-2); jQuery("#progress").text("Updated on: " + StrUpdateTime); }, 60000); </script> The above code runs in a wordpress environment. It comes out that when devices are too much and internet connection is not that fast, the script times out, even if i dramatically increase the timeout period. So it is impossible even to load the page the first time... Therefore I would like to change my code so that I can handle each row as a single entity, with its own refresh period. So when the user first loads the page, he sees n rows (one per device) with the ajax loader image... then an update cycle should start independently for each row, so that the user sees data gathered from each database... then ajax loader when the script is trying to retrieve data, then the gathered data once it has been collected or an error message stating that it is not possible to gather data since hour xx:yy:zz. So rows updating should be somewhat independent from the others, like if each row updating was a single closed process. So that rows updating is not done sequentially from the first row to the last. I hope I've sufficiently detailed my problem. Currently I feel like I am at a dead-end. Could someone please show me somewhere to start from?

    Read the article

  • C++ function not found during compilation

    - by forthewinwin
    For a homework assignment: I'm supposed to create randomized alphabetial keys, print them to a file, and then hash each of them into a hash table using the function "goodHash", found in my below code. When I try to run the below code, it says my "goodHash" "identifier isn't found". What's wrong with my code? #include <iostream> #include <vector> #include <cstdlib> #include "math.h" #include <fstream> #include <time.h> using namespace std; // "makeKey" function to create an alphabetical key // based on 8 randomized numbers 0 - 25. string makeKey() { int k; string key = ""; for (k = 0; k < 8; k++) { int keyNumber = (rand() % 25); if (keyNumber == 0) key.append("A"); if (keyNumber == 1) key.append("B"); if (keyNumber == 2) key.append("C"); if (keyNumber == 3) key.append("D"); if (keyNumber == 4) key.append("E"); if (keyNumber == 5) key.append("F"); if (keyNumber == 6) key.append("G"); if (keyNumber == 7) key.append("H"); if (keyNumber == 8) key.append("I"); if (keyNumber == 9) key.append("J"); if (keyNumber == 10) key.append("K"); if (keyNumber == 11) key.append("L"); if (keyNumber == 12) key.append("M"); if (keyNumber == 13) key.append("N"); if (keyNumber == 14) key.append("O"); if (keyNumber == 15) key.append("P"); if (keyNumber == 16) key.append("Q"); if (keyNumber == 17) key.append("R"); if (keyNumber == 18) key.append("S"); if (keyNumber == 19) key.append("T"); if (keyNumber == 20) key.append("U"); if (keyNumber == 21) key.append("V"); if (keyNumber == 22) key.append("W"); if (keyNumber == 23) key.append("X"); if (keyNumber == 24) key.append("Y"); if (keyNumber == 25) key.append("Z"); } return key; } // "makeFile" function to produce the desired text file. // Note this only works as intended if you include the ".txt" extension, // and that a file of the same name doesn't already exist. void makeFile(string fileName, int n) { ofstream ourFile; ourFile.open(fileName); int k; // For use in below loop to compare with n. int l; // For use in the loop inside the below loop. string keyToPassTogoodHash = ""; for (k = 1; k <= n; k++) { for (l = 0; l < 8; l++) { // For-loop to write to the file ONE key ourFile << makeKey()[l]; keyToPassTogoodHash += (makeKey()[l]); } ourFile << " " << k << "\n";// Writes two spaces and the data value goodHash(keyToPassTogoodHash); // I think this has to do with the problem makeKey(); // Call again to make a new key. } } // Primary function to create our desired file! void mainFunction(string fileName, int n) { makeKey(); makeFile(fileName, n); } // Hash Table for Part 2 struct Node { int key; string value; Node* next; }; const int hashTableSize = 10; Node* hashTable[hashTableSize]; // "goodHash" function for Part 2 void goodHash(string key) { int x = 0; int y; int keyConvertedToNumber = 0; // For-loop to produce a numeric value based on the alphabetic key, // which is then hashed into hashTable using the hash function // declared below the loop (hashFunction). for (y = 0; y < 8; y++) { if (key[y] == 'A' || 'B' || 'C') x = 0; if (key[y] == 'D' || 'E' || 'F') x = 1; if (key[y] == 'G' || 'H' || 'I') x = 2; if (key[y] == 'J' || 'K' || 'L') x = 3; if (key[y] == 'M' || 'N' || 'O') x = 4; if (key[y] == 'P' || 'Q' || 'R') x = 5; if (key[y] == 'S' || 'T') x = 6; if (key[y] == 'U' || 'V') x = 7; if (key[y] == 'W' || 'X') x = 8; if (key[y] == 'Y' || 'Z') x = 9; keyConvertedToNumber = x + keyConvertedToNumber; } int hashFunction = keyConvertedToNumber % hashTableSize; Node *temp; temp = new Node; temp->value = key; temp->next = hashTable[hashFunction]; hashTable[hashFunction] = temp; } // First two lines are for Part 1, to call the functions key to Part 1. int main() { srand ( time(NULL) ); // To make sure our randomization works. mainFunction("sandwich.txt", 5); // To test program cin.get(); return 0; } I realize my code is cumbersome in some sections, but I'm a noob at C++ and don't know much to do it better. I'm guessing another way I could do it is to AFTER writing the alphabetical keys to the file, read them from the file and hash each key as I do that, but I wouldn't know how to go about coding that.

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

  • Using the West Wind Web Toolkit to set up AJAX and REST Services

    - by Rick Strahl
    I frequently get questions about which option to use for creating AJAX and REST backends for ASP.NET applications. There are many solutions out there to do this actually, but when I have a choice - not surprisingly - I fall back to my own tools in the West Wind West Wind Web Toolkit. I've talked a bunch about the 'in-the-box' solutions in the past so for a change in this post I'll talk about the tools that I use in my own and customer applications to handle AJAX and REST based access to service resources using the West Wind West Wind Web Toolkit. Let me preface this by saying that I like things to be easy. Yes flexible is very important as well but not at the expense of over-complexity. The goal I've had with my tools is make it drop dead easy, with good performance while providing the core features that I'm after, which are: Easy AJAX/JSON Callbacks Ability to return any kind of non JSON content (string, stream, byte[], images) Ability to work with both XML and JSON interchangeably for input/output Access endpoints via POST data, RPC JSON calls, GET QueryString values or Routing interface Easy to use generic JavaScript client to make RPC calls (same syntax, just what you need) Ability to create clean URLS with Routing Ability to use standard ASP.NET HTTP Stack for HTTP semantics It's all about options! In this post I'll demonstrate most of these features (except XML) in a few simple and short samples which you can download. So let's take a look and see how you can build an AJAX callback solution with the West Wind Web Toolkit. Installing the Toolkit Assemblies The easiest and leanest way of using the Toolkit in your Web project is to grab it via NuGet: West Wind Web and AJAX Utilities (Westwind.Web) and drop it into the project by right clicking in your Project and choosing Manage NuGet Packages from anywhere in the Project.   When done you end up with your project looking like this: What just happened? Nuget added two assemblies - Westwind.Web and Westwind.Utilities and the client ww.jquery.js library. It also added a couple of references into web.config: The default namespaces so they can be accessed in pages/views and a ScriptCompressionModule that the toolkit optionally uses to compress script resources served from within the assembly (namely ww.jquery.js and optionally jquery.js). Creating a new Service The West Wind Web Toolkit supports several ways of creating and accessing AJAX services, but for this post I'll stick to the lower level approach that works from any plain HTML page or of course MVC, WebForms, WebPages. There's also a WebForms specific control that makes this even easier but I'll leave that for another post. So, to create a new standalone AJAX/REST service we can create a new HttpHandler in the new project either as a pure class based handler or as a generic .ASHX handler. Both work equally well, but generic handlers don't require any web.config configuration so I'll use that here. In the root of the project add a Generic Handler. I'm going to call this one StockService.ashx. Once the handler has been created, edit the code and remove all of the handler body code. Then change the base class to CallbackHandler and add methods that have a [CallbackMethod] attribute. Here's the modified base handler implementation now looks like with an added HelloWorld method: using System; using Westwind.Web; namespace WestWindWebAjax { /// <summary> /// Handler implements CallbackHandler to provide REST/AJAX services /// </summary> public class SampleService : CallbackHandler { [CallbackMethod] public string HelloWorld(string name) { return "Hello " + name + ". Time is: " + DateTime.Now.ToString(); } } } Notice that the class inherits from CallbackHandler and that the HelloWorld service method is marked up with [CallbackMethod]. We're done here. Services Urlbased Syntax Once you compile, the 'service' is live can respond to requests. All CallbackHandlers support input in GET and POST formats, and can return results as JSON or XML. To check our fancy HelloWorld method we can now access the service like this: http://localhost/WestWindWebAjax/StockService.ashx?Method=HelloWorld&name=Rick which produces a default JSON response - in this case a string (wrapped in quotes as it's JSON): (note by default JSON will be downloaded by most browsers not displayed - various options are available to view JSON right in the browser) If I want to return the same data as XML I can tack on a &format=xml at the end of the querystring which produces: <string>Hello Rick. Time is: 11/1/2011 12:11:13 PM</string> Cleaner URLs with Routing Syntax If you want cleaner URLs for each operation you can also configure custom routes on a per URL basis similar to the way that WCF REST does. To do this you need to add a new RouteHandler to your application's startup code in global.asax.cs one for each CallbackHandler based service you create: protected void Application_Start(object sender, EventArgs e) { CallbackHandlerRouteHandler.RegisterRoutes<StockService>(RouteTable.Routes); } With this code in place you can now add RouteUrl properties to any of your service methods. For the HelloWorld method that doesn't make a ton of sense but here is what a routed clean URL might look like in definition: [CallbackMethod(RouteUrl="stocks/HelloWorld/{name}")] public string HelloWorld(string name) { return "Hello " + name + ". Time is: " + DateTime.Now.ToString(); } The same URL I previously used now becomes a bit shorter and more readable with: http://localhost/WestWindWebAjax/HelloWorld/Rick It's an easy way to create cleaner URLs and still get the same functionality. Calling the Service with $.getJSON() Since the result produced is JSON you can now easily consume this data using jQuery's getJSON method. First we need a couple of scripts - jquery.js and ww.jquery.js in the page: <!DOCTYPE html> <html> <head> <link href="Css/Westwind.css" rel="stylesheet" type="text/css" /> <script src="scripts/jquery.min.js" type="text/javascript"></script> <script src="scripts/ww.jquery.min.js" type="text/javascript"></script> </head> <body> Next let's add a small HelloWorld example form (what else) that has a single textbox to type a name, a button and a div tag to receive the result: <fieldset> <legend>Hello World</legend> Please enter a name: <input type="text" name="txtHello" id="txtHello" value="" /> <input type="button" id="btnSayHello" value="Say Hello (POST)" /> <input type="button" id="btnSayHelloGet" value="Say Hello (GET)" /> <div id="divHelloMessage" class="errordisplay" style="display:none;width: 450px;" > </div> </fieldset> Then to call the HelloWorld method a little jQuery is used to hook the document startup and the button click followed by the $.getJSON call to retrieve the data from the server. <script type="text/javascript"> $(document).ready(function () { $("#btnSayHelloGet").click(function () { $.getJSON("SampleService.ashx", { Method: "HelloWorld", name: $("#txtHello").val() }, function (result) { $("#divHelloMessage") .text(result) .fadeIn(1000); }); });</script> .getJSON() expects a full URL to the endpoint of our service, which is the ASHX file. We can either provide a full URL (SampleService.ashx?Method=HelloWorld&name=Rick) or we can just provide the base URL and an object that encodes the query string parameters for us using an object map that has a property that matches each parameter for the server method. We can also use the clean URL routing syntax, but using the object parameter encoding actually is safer as the parameters will get properly encoded by jQuery. The result returned is whatever the result on the server method is - in this case a string. The string is applied to the divHelloMessage element and we're done. Obviously this is a trivial example, but it demonstrates the basics of getting a JSON response back to the browser. AJAX Post Syntax - using ajaxCallMethod() The previous example allows you basic control over the data that you send to the server via querystring parameters. This works OK for simple values like short strings, numbers and boolean values, but doesn't really work if you need to pass something more complex like an object or an array back up to the server. To handle traditional RPC type messaging where the idea is to map server side functions and results to a client side invokation, POST operations can be used. The easiest way to use this functionality is to use ww.jquery.js and the ajaxCallMethod() function. ww.jquery wraps jQuery's AJAX functions and knows implicitly how to call a CallbackServer method with parameters and parse the result. Let's look at another simple example that posts a simple value but returns something more interesting. Let's start with the service method: [CallbackMethod(RouteUrl="stocks/{symbol}")] public StockQuote GetStockQuote(string symbol) { Response.Cache.SetExpires(DateTime.UtcNow.Add(new TimeSpan(0, 2, 0))); StockServer server = new StockServer(); var quote = server.GetStockQuote(symbol); if (quote == null) throw new ApplicationException("Invalid Symbol passed."); return quote; } This sample utilizes a small StockServer helper class (included in the sample) that downloads a stock quote from Yahoo's financial site via plain HTTP GET requests and formats it into a StockQuote object. Lets create a small HTML block that lets us query for the quote and display it: <fieldset> <legend>Single Stock Quote</legend> Please enter a stock symbol: <input type="text" name="txtSymbol" id="txtSymbol" value="msft" /> <input type="button" id="btnStockQuote" value="Get Quote" /> <div id="divStockDisplay" class="errordisplay" style="display:none; width: 450px;"> <div class="label-left">Company:</div> <div id="stockCompany"></div> <div class="label-left">Last Price:</div> <div id="stockLastPrice"></div> <div class="label-left">Quote Time:</div> <div id="stockQuoteTime"></div> </div> </fieldset> The final result looks something like this:   Let's hook up the button handler to fire the request and fill in the data as shown: $("#btnStockQuote").click(function () { ajaxCallMethod("SampleService.ashx", "GetStockQuote", [$("#txtSymbol").val()], function (quote) { $("#divStockDisplay").show().fadeIn(1000); $("#stockCompany").text(quote.Company + " (" + quote.Symbol + ")"); $("#stockLastPrice").text(quote.LastPrice); $("#stockQuoteTime").text(quote.LastQuoteTime.formatDate("MMM dd, HH:mm EST")); }, onPageError); }); So we point at SampleService.ashx and the GetStockQuote method, passing a single parameter of the input symbol value. Then there are two handlers for success and failure callbacks.  The success handler is the interesting part - it receives the stock quote as a result and assigns its values to various 'holes' in the stock display elements. The data that comes back over the wire is JSON and it looks like this: { "Symbol":"MSFT", "Company":"Microsoft Corpora", "OpenPrice":26.11, "LastPrice":26.01, "NetChange":0.02, "LastQuoteTime":"2011-11-03T02:00:00Z", "LastQuoteTimeString":"Nov. 11, 2011 4:20pm" } which is an object representation of the data. JavaScript can evaluate this JSON string back into an object easily and that's the reslut that gets passed to the success function. The quote data is then applied to existing page content by manually selecting items and applying them. There are other ways to do this more elegantly like using templates, but here we're only interested in seeing how the data is returned. The data in the object is typed - LastPrice is a number and QuoteTime is a date. Note about the date value: JavaScript doesn't have a date literal although the JSON embedded ISO string format used above  ("2011-11-03T02:00:00Z") is becoming fairly standard for JSON serializers. However, JSON parsers don't deserialize dates by default and return them by string. This is why the StockQuote actually returns a string value of LastQuoteTimeString for the same date. ajaxMethodCallback always converts dates properly into 'real' dates and the example above uses the real date value along with a .formatDate() data extension (also in ww.jquery.js) to display the raw date properly. Errors and Exceptions So what happens if your code fails? For example if I pass an invalid stock symbol to the GetStockQuote() method you notice that the code does this: if (quote == null) throw new ApplicationException("Invalid Symbol passed."); CallbackHandler automatically pushes the exception message back to the client so it's easy to pick up the error message. Regardless of what kind of error occurs: Server side, client side, protocol errors - any error will fire the failure handler with an error object parameter. The error is returned to the client via a JSON response in the error callback. In the previous examples I called onPageError which is a generic routine in ww.jquery that displays a status message on the bottom of the screen. But of course you can also take over the error handling yourself: $("#btnStockQuote").click(function () { ajaxCallMethod("SampleService.ashx", "GetStockQuote", [$("#txtSymbol").val()], function (quote) { $("#divStockDisplay").fadeIn(1000); $("#stockCompany").text(quote.Company + " (" + quote.Symbol + ")"); $("#stockLastPrice").text(quote.LastPrice); $("#stockQuoteTime").text(quote.LastQuoteTime.formatDate("MMM dd, hh:mmt")); }, function (error, xhr) { $("#divErrorDisplay").text(error.message).fadeIn(1000); }); }); The error object has a isCallbackError, message and  stackTrace properties, the latter of which is only populated when running in Debug mode, and this object is returned for all errors: Client side, transport and server side errors. Regardless of which type of error you get the same object passed (as well as the XHR instance optionally) which makes for a consistent error retrieval mechanism. Specifying HttpVerbs You can also specify HTTP Verbs that are allowed using the AllowedHttpVerbs option on the CallbackMethod attribute: [CallbackMethod(AllowedHttpVerbs=HttpVerbs.GET | HttpVerbs.POST)] public string HelloWorld(string name) { … } If you're building REST style API's this might be useful to force certain request semantics onto the client calling. For the above if call with a non-allowed HttpVerb the request returns a 405 error response along with a JSON (or XML) error object result. The default behavior is to allow all verbs access (HttpVerbs.All). Passing in object Parameters Up to now the parameters I passed were very simple. But what if you need to send something more complex like an object or an array? Let's look at another example now that passes an object from the client to the server. Keeping with the Stock theme here lets add a method called BuyOrder that lets us buy some shares for a stock. Consider the following service method that receives an StockBuyOrder object as a parameter: [CallbackMethod] public string BuyStock(StockBuyOrder buyOrder) { var server = new StockServer(); var quote = server.GetStockQuote(buyOrder.Symbol); if (quote == null) throw new ApplicationException("Invalid or missing stock symbol."); return string.Format("You're buying {0} shares of {1} ({2}) stock at {3} for a total of {4} on {5}.", buyOrder.Quantity, quote.Company, quote.Symbol, quote.LastPrice.ToString("c"), (quote.LastPrice * buyOrder.Quantity).ToString("c"), buyOrder.BuyOn.ToString("MMM d")); } public class StockBuyOrder { public string Symbol { get; set; } public int Quantity { get; set; } public DateTime BuyOn { get; set; } public StockBuyOrder() { BuyOn = DateTime.Now; } } This is a contrived do-nothing example that simply echoes back what was passed in, but it demonstrates how you can pass complex data to a callback method. On the client side we now have a very simple form that captures the three values on a form: <fieldset> <legend>Post a Stock Buy Order</legend> Enter a symbol: <input type="text" name="txtBuySymbol" id="txtBuySymbol" value="GLD" />&nbsp;&nbsp; Qty: <input type="text" name="txtBuyQty" id="txtBuyQty" value="10" style="width: 50px" />&nbsp;&nbsp; Buy on: <input type="text" name="txtBuyOn" id="txtBuyOn" value="<%= DateTime.Now.ToString("d") %>" style="width: 70px;" /> <input type="button" id="btnBuyStock" value="Buy Stock" /> <div id="divStockBuyMessage" class="errordisplay" style="display:none"></div> </fieldset> The completed form and demo then looks something like this:   The client side code that picks up the input values and assigns them to object properties and sends the AJAX request looks like this: $("#btnBuyStock").click(function () { // create an object map that matches StockBuyOrder signature var buyOrder = { Symbol: $("#txtBuySymbol").val(), Quantity: $("#txtBuyQty").val() * 1, // number Entered: new Date() } ajaxCallMethod("SampleService.ashx", "BuyStock", [buyOrder], function (result) { $("#divStockBuyMessage").text(result).fadeIn(1000); }, onPageError); }); The code creates an object and attaches the properties that match the server side object passed to the BuyStock method. Each property that you want to update needs to be included and the type must match (ie. string, number, date in this case). Any missing properties will not be set but also not cause any errors. Pass POST data instead of Objects In the last example I collected a bunch of values from form variables and stuffed them into object variables in JavaScript code. While that works, often times this isn't really helping - I end up converting my types on the client and then doing another conversion on the server. If lots of input controls are on a page and you just want to pick up the values on the server via plain POST variables - that can be done too - and it makes sense especially if you're creating and filling the client side object only to push data to the server. Let's add another method to the server that once again lets us buy a stock. But this time let's not accept a parameter but rather send POST data to the server. Here's the server method receiving POST data: [CallbackMethod] public string BuyStockPost() { StockBuyOrder buyOrder = new StockBuyOrder(); buyOrder.Symbol = Request.Form["txtBuySymbol"]; ; int qty; int.TryParse(Request.Form["txtBuyQuantity"], out qty); buyOrder.Quantity = qty; DateTime time; DateTime.TryParse(Request.Form["txtBuyBuyOn"], out time); buyOrder.BuyOn = time; // Or easier way yet //FormVariableBinder.Unbind(buyOrder,null,"txtBuy"); var server = new StockServer(); var quote = server.GetStockQuote(buyOrder.Symbol); if (quote == null) throw new ApplicationException("Invalid or missing stock symbol."); return string.Format("You're buying {0} shares of {1} ({2}) stock at {3} for a total of {4} on {5}.", buyOrder.Quantity, quote.Company, quote.Symbol, quote.LastPrice.ToString("c"), (quote.LastPrice * buyOrder.Quantity).ToString("c"), buyOrder.BuyOn.ToString("MMM d")); } Clearly we've made this server method take more code than it did with the object parameter. We've basically moved the parameter assignment logic from the client to the server. As a result the client code to call this method is now a bit shorter since there's no client side shuffling of values from the controls to an object. $("#btnBuyStockPost").click(function () { ajaxCallMethod("SampleService.ashx", "BuyStockPost", [], // Note: No parameters - function (result) { $("#divStockBuyMessage").text(result).fadeIn(1000); }, onPageError, // Force all page Form Variables to be posted { postbackMode: "Post" }); }); The client simply calls the BuyStockQuote method and pushes all the form variables from the page up to the server which parses them instead. The feature that makes this work is one of the options you can pass to the ajaxCallMethod() function: { postbackMode: "Post" }); which directs the function to include form variable POST data when making the service call. Other options include PostNoViewState (for WebForms to strip out WebForms crap vars), PostParametersOnly (default), None. If you pass parameters those are always posted to the server except when None is set. The above code can be simplified a bit by using the FormVariableBinder helper, which can unbind form variables directly into an object: FormVariableBinder.Unbind(buyOrder,null,"txtBuy"); which replaces the manual Request.Form[] reading code. It receives the object to unbind into, a string of properties to skip, and an optional prefix which is stripped off form variables to match property names. The component is similar to the MVC model binder but it's independent of MVC. Returning non-JSON Data CallbackHandler also supports returning non-JSON/XML data via special return types. You can return raw non-JSON encoded strings like this: [CallbackMethod(ReturnAsRawString=true,ContentType="text/plain")] public string HelloWorldNoJSON(string name) { return "Hello " + name + ". Time is: " + DateTime.Now.ToString(); } Calling this method results in just a plain string - no JSON encoding with quotes around the result. This can be useful if your server handling code needs to return a string or HTML result that doesn't fit well for a page or other UI component. Any string output can be returned. You can also return binary data. Stream, byte[] and Bitmap/Image results are automatically streamed back to the client. Notice that you should set the ContentType of the request either on the CallbackMethod attribute or using Response.ContentType. This ensures the Web Server knows how to display your binary response. Using a stream response makes it possible to return any of data. Streamed data can be pretty handy to return bitmap data from a method. The following is a method that returns a stock history graph for a particular stock over a provided number of years: [CallbackMethod(ContentType="image/png",RouteUrl="stocks/history/graph/{symbol}/{years}")] public Stream GetStockHistoryGraph(string symbol, int years = 2,int width = 500, int height=350) { if (width == 0) width = 500; if (height == 0) height = 350; StockServer server = new StockServer(); return server.GetStockHistoryGraph(symbol,"Stock History for " + symbol,width,height,years); } I can now hook this up into the JavaScript code when I get a stock quote. At the end of the process I can assign the URL to the service that returns the image into the src property and so force the image to display. Here's the changed code: $("#btnStockQuote").click(function () { var symbol = $("#txtSymbol").val(); ajaxCallMethod("SampleService.ashx", "GetStockQuote", [symbol], function (quote) { $("#divStockDisplay").fadeIn(1000); $("#stockCompany").text(quote.Company + " (" + quote.Symbol + ")"); $("#stockLastPrice").text(quote.LastPrice); $("#stockQuoteTime").text(quote.LastQuoteTime.formatDate("MMM dd, hh:mmt")); // display a stock chart $("#imgStockHistory").attr("src", "stocks/history/graph/" + symbol + "/2"); },onPageError); }); The resulting output then looks like this: The charting code uses the new ASP.NET 4.0 Chart components via code to display a bar chart of the 2 year stock data as part of the StockServer class which you can find in the sample download. The ability to return arbitrary data from a service is useful as you can see - in this case the chart is clearly associated with the service and it's nice that the graph generation can happen off a handler rather than through a page. Images are common resources, but output can also be PDF reports, zip files for downloads etc. which is becoming increasingly more common to be returned from REST endpoints and other applications. Why reinvent? Obviously the examples I've shown here are pretty basic in terms of functionality. But I hope they demonstrate the core features of AJAX callbacks that you need to work through in most applications which is simple: return data, send back data and potentially retrieve data in various formats. While there are other solutions when it comes down to making AJAX callbacks and servicing REST like requests, I like the flexibility my home grown solution provides. Simply put it's still the easiest solution that I've found that addresses my common use cases: AJAX JSON RPC style callbacks Url based access XML and JSON Output from single method endpoint XML and JSON POST support, querystring input, routing parameter mapping UrlEncoded POST data support on callbacks Ability to return stream/raw string data Essentially ability to return ANYTHING from Service and pass anything All these features are available in various solutions but not together in one place. I've been using this code base for over 4 years now in a number of projects both for myself and commercial work and it's served me extremely well. Besides the AJAX functionality CallbackHandler provides, it's also an easy way to create any kind of output endpoint I need to create. Need to create a few simple routines that spit back some data, but don't want to create a Page or View or full blown handler for it? Create a CallbackHandler and add a method or multiple methods and you have your generic endpoints.  It's a quick and easy way to add small code pieces that are pretty efficient as they're running through a pretty small handler implementation. I can have this up and running in a couple of minutes literally without any setup and returning just about any kind of data. Resources Download the Sample NuGet: Westwind Web and AJAX Utilities (Westwind.Web) ajaxCallMethod() Documentation Using the AjaxMethodCallback WebForms Control West Wind Web Toolkit Home Page West Wind Web Toolkit Source Code © Rick Strahl, West Wind Technologies, 2005-2011Posted in ASP.NET  jQuery  AJAX   Tweet (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

    Read the article

  • SQLAuthority News – TechEd India – April 12-14, 2010 Bangalore – An Unforgettable Experience – An Op

    - by pinaldave
    TechEd India was one of the largest Technology events in India led by Microsoft. This event was attended by more than 3,000 technology enthusiasts, making it one of the most well-organized events of the year. Though I attempted to attend almost all the technology events here, I have not seen any bigger or better event in Indian subcontinents other than this. There are 21 Technical Tracks at Tech·Ed India 2010 that span more than 745 learning opportunities. I was fortunate enough to be a part of this whole event as a speaker and a delegate, as well. TechEd India Speaker Badge and A Token of Lifetime Hotel Selection I presented three different sessions at TechEd India and was also a part of panel discussion. (The details of the sessions are given at the end of this blog post.) Due to extensive traveling, I stay away from my family occasionally. For this reason, I took my wife – Nupur and daughter Shaivi (8 months old) to the event along with me. We stayed at the same hotel where the event was organized so as to maximize my time bonding with my family and to have more time in networking with technology community, at the same time. The hotel Lalit Ashok is the largest and most luxurious venue one can find in Bangalore, located in the middle of the city. The cost of the hotel was a bit pricey, but looking at all the advantages, I had decided to ask for a booking there. Hotel Lalit Ashok Nupur Dave and Shaivi Dave Arrival Day – DAY 0 – April 11, 2010 I reached the event a day earlier, and that was one wise decision for I was able to relax a bit and go over my presentation for the next day’s course. I am a kind of person who likes to get everything ready ahead of time. I was also able to enjoy a pleasant evening with several Microsoft employees and my family friends. I even checked out the location where I would be doing presentations the next day. I was fortunate enough to meet Bijoy Singhal from Microsoft who helped me out with a few of the logistics issues that occured the day before. I was not aware of the fact that the very next day he was going to be “The Man” of the TechEd 2010 event. Vinod Kumar from Microsoft was really very kind as he talked to me regarding my subsequent session. He gave me some suggestions which were really helpful that I was able to incorporate them during my presentation. Finally, I was able to meet Abhishek Kant from Microsoft; his valuable suggestions and unlimited passion have inspired many people like me to work with the Community. Pradipta from Microsoft was also around, being extremely busy with logistics; however, in those busy times, he did find some good spare time to have a chat with me and the other Community leaders. I also met Harish Ranganathan and Sachin Rathi, both from Microsoft. It was so interesting to listen to both of them talking about SharePoint. I just have no words to express my overwhelmed spirit because of all these passionate young guys - Pradipta,Vinod, Bijoy, Harish, Sachin and Ahishek (of course!). Map of TechEd India 2010 Event Day 1 – April 12, 2010 From morning until night time, today was truly a very busy day for me. I had two presentations and one panel discussion for the day. Needless to say, I had a few meetings to attend as well. The day started with a keynote from S. Somaseger where he announced the launch of Visual Studio 2010. The keynote area was really eye-catching because of the very large, bigger-than- life uniform screen. This was truly one to show. The title music of the keynote was very interesting and it featured Bijoy Singhal as the model. It was interesting to talk to him afterwards, when we laughed at jokes together about his modeling assignment. TechEd India Keynote Opening Featuring Bijoy TechEd India 2010 Keynote – S. Somasegar Time: 11:15pm – 11:45pm Session 1: True Lies of SQL Server – SQL Myth Buster Following the excellent keynote, I had my very first session on the subject of SQL Server Myth Buster. At first, I was a bit nervous as right after the keynote, for this was my very first session and during my presentation I saw lots of Microsoft Product Team members. Well, it really went well and I had a really good discussion with attendees of the session. I felt that a well begin was half-done and my confidence was regained. Right after the session, I met a few of my Community friends and had meaningful discussions with them on many subjects. The abstract of the session is as follows: In this 30-minute demo session, I am going to briefly demonstrate few SQL Server Myths and their resolutions as I back them up with some demo. This demo presentation is a must-attend for all developers and administrators who would come to the event. This is going to be a very quick yet fun session. Pinal Presenting session at TechEd India 2010 Time: 1:00 PM – 2:00 PM Lunch with Somasegar After the session I went to see my daughter, and then I headed right away to the lunch with S. Somasegar – the keynote speaker and senior vice president of the Developer Division at Microsoft. I really thank to Abhishek who made it possible for us. Because of his efforts, all the MVPs had the opportunity to meet such a legendary person and had to talk with them on Microsoft Technology. Though Somasegar is currently holding such a high position in Microsoft, he is very polite and a real gentleman, and how I wish that everybody in industry is like him. Believe me, if you spread love and kindness, then that is what you will receive back. As soon as lunch time was over, I ran to the session hall as my second presentation was about to start. Time: 2:30pm – 3:30pm Session 2: Master Data Services in Microsoft SQL Server 2008 R2 Business Intelligence is a subject which was widely talked about at TechEd. Everybody was interested in this subject, and I did not excuse myself from this great concept as well. I consider myself fortunate as I was presenting on the subject of Master Data Services at TechEd. When I had initially learned this subject, I had a bit of confusion about the usage of this tool. Later on, I decided that I would tackle about how we all developers and DBAs are not able to understand something so simple such as this, and even worst, creating confusion about the technology. During system designing, it is very important to have a reference material or master lookup tables. Well, I talked about the same subject and presented the session keeping that as my center talk. The session went very well and I received lots of interesting questions. I got many compliments for talking about this subject on the real-life scenario. I really thank Rushabh Mehta (CEO, Solid Quality Mentors India) for his supportive suggestions that helped me prepare the slide deck, as well as the subject. Pinal Presenting session at TechEd India 2010 The abstract of the session is as follows: SQL Server Master Data Services will ship with SQL Server 2008 R2 and will improve Microsoft’s platform appeal. This session provides an in-depth demonstration of MDS features and highlights important usage scenarios. Master Data Services enables consistent decision-making process by allowing you to create, manage and propagate changes from a single master view of your business entities. Also, MDS – Master Data-hub which is a vital component, helps ensure the consistency of reporting across systems and deliver faster and more accurate results across the enterprise. We will talk about establishing the basis for a centralized approach to defining, deploying, and managing master data in the enterprise. Pinal Presenting session at TechEd India 2010 The day was still not over for me. I had ran into several friends but we were not able keep our enthusiasm under control about all the rumors saying that SQL Server 2008 R2 was about to be launched tomorrow in the keynote. I then ran to my third and final technical event for the day- a panel discussion with the top technologies of India. Time: 5:00pm – 6:00pm Panel Discussion: Harness the power of Web – SEO and Technical Blogging As I have delivered two technical sessions by this time, I was a bit tired but  not less enthusiastic when I had to talk about Blog and Technology. We discussed many different topics there. I told them that the most important aspect for any blog is its content. We discussed in depth the issues with plagiarism and how to avoid it. Another topic of discussion was how we technology bloggers can create awareness in the Community about what the right kind of blogging is and what morally and technically wrong acts are. A couple of questions were raised about what type of liberty a person can have in terms of writing blogs. Well, it was generically agreed that a blog is mainly a representation of our ideas and thoughts; it should not be governed by external entities. As long as one is writing what they really want to say, but not providing incorrect information or not practicing plagiarism, a blogger should be allowed to express himself. This panel discussion was supposed to be over in an hour, but the interest of the participants was remarkable and so it was extended for 30 minutes more. Finally, we decided to bring to a close the discussion and agreed that we will continue the topic next year. TechEd India Panel Discussion on Web, Technology and SEO Surprisingly, the day was just beginning after doing all of these. By this time, I have almost met all the MVP who arrived at the event, as well as many Microsoft employees. There were lots of Community folks present, too. I decided that I would go to meet several friends from the Community and continue to communicate with me on SQLAuthority.com. I also met Abhishek Baxi and had a good talk with him regarding Win Mobile and Twitter. He also took a very quick video of me wherein I spoke in my mother’s tongue, Gujarati. It was funny that I talked in Gujarati almost all the day, but when I was talking in the interview I could not find the right Gujarati words to speak. I think we all think in English when we think about Technology, so as to address universality. After meeting them, I headed towards the Speakers’ Dinner. Time: 8:00 PM – onwards Speakers Dinner The Speakers’ dinner was indeed a wonderful opportunity for all the speakers to get together and relax. We talked so many different things, from XBOX to Hindi Movies, and from SQL to Samosas. I just could not express how much fun I had. After a long evening, when I returned tmy room and met Shaivi, I just felt instantly relaxed. Kids are really gifts from God. Today was a really long but exciting day. So many things happened in just one day: Visual Studio Lanch, lunch with Somasegar, 2 technical sessions, 1 panel discussion, community leaders meeting, speakers dinner and, last but not leas,t playing with my child! A perfect day! Day 2 – April 13, 2010 Today started with a bang with the excellent keynote by Kamal Hathi who launched SQL Server 2008 R2 in India and demonstrated the power of PowerPivot to all of us. 101 Million Rows in Excel brought lots of applause from the audience. Kamal Hathi Presenting Keynote at TechEd India 2010 The day was a bit easier one for me. I had no sessions today and no events planned. I had a few meetings planned for the second day of the event. I sat in the speaker’s lounge for half a day and met many people there. I attended nearly 9 different meetings today. The subjects of the meetings were very different. Here is a list of the topics of the Community-related meetings: SQL PASS and its involvement in India and subcontinents How to start community blogging Forums and developing aptitude towards technology Ahmedabad/Gandhinagar User Groups and their developments SharePoint and SQL Business Meeting – a client meeting Business Meeting – a potential performance tuning project Business Meeting – Solid Quality Mentors (SolidQ) And family friends Pinal Dave at TechEd India The day passed by so quickly during this meeting. In the evening, I headed to Partners Expo with friends and checked out few of the booths. I really wanted to talk about some of the products, but due to the freebies there was so much crowd that I finally decided to just take the contact details of the partner. I will now start sending them with my queries and, hopefully, I will have my questions answered. Nupur and Shaivi had also one meeting to attend; it was with our family friend Vijay Raj. Vijay is also a person who loves Technology and loves it more than anybody. I see him growing and learning every day, but still remaining as a ‘human’. I believe that if someone acquires as much knowledge as him, that person will become either a computer or cyborg. Here, Vijay is still a kind gentleman and is able to stay as our close family friend. Shaivi was really happy to play with Uncle Vijay. Pinal Dave and Vijay Raj Renuka Prasad, a Microsoft MVP, impressed me with his passion and knowledge of SQL. Every time he gives me credit for his success, I believe that he is very humble. He has way more certifications than me and has worked many more years with SQL compared to me. He is an excellent photographer as well. Most of the photos in this blog post have been taken by him. I told him if ever he wants to do a part time job, he can do the photography very well. Pinal Dave and Renuka Prasad I also met L Srividya from Microsoft, whom I was looking forward to meet. She is a bundle of knowledge that everyone would surely learn a lot from her. I was able to get a few minutes from her and well, I felt confident. She enlightened me with SQL Server BI concepts, domain management and SQL Server security and few other interesting details. I also had a wonderful time talking about SharePoint with fellow Solid Quality Mentor Joy Rathnayake. He is very passionate about SharePoint but when you talk .NET and SQL with him, he is still overwhelmingly knowledgeable. In fact, while talking to him, I figured out that the recent training he delivered was on SQL Server 2008 R2. I told him a joke that it hurts my ego as he is more popular now in SQL training and consulting than me. I am sure all of you agree that working with good people is a gift from God. I am fortunate enough to work with the best of the best Industry experts. It was a great pleasure to hang out with my Community friends – Ahswin Kini, HimaBindu Vejella, Vasudev G, Suprotim Agrawal, Dhananjay, Vikram Pendse, Mahesh Dhola, Mahesh Mitkari,  Manu Zacharia, Shobhan, Hardik Shah, Ashish Mohta, Manan, Subodh Sohani and Sanjay Shetty (of course!) .  (Please let me know if I have met you at the event and forgot your name to list here). Time: 8:00 PM – onwards Community Leaders Dinner After lots of meetings, I headed towards the Community Leaders dinner meeting and met almost all the folks I met in morning. The discussion was almost the same but the real good thing was that we were enjoying it. The food was really good. Nupur was invited in the event, but Shaivi could not come. When Nupur tried to enter the event, she was stopped as Shaivi did not have the pass to enter the dinner. Nupur expressed that Shaivi is only 8 months old and does not eat outside food as well and could not stay by herself at this age, but the door keeper did not agree and asked that without the entry details Shaivi could not go in, but Nupur could. Nupur called me on phone and asked me to help her out. By the time, I was outside; the organizer of the event reached to the door and happily approved Shaivi to join the party. Once in the party, Shaivi had lots of fun meeting so many people. Shaivi Dave and Abhishek Kant Dean Guida (Infragistics President and CEO) and Pinal Dave (SQLAuthority.com) Day 3 – April 14, 2010 Though, it was last day, I was very much excited today as I was about to present my very favorite session. Query Optimization and Performance Tuning is my domain expertise and I make my leaving by consulting and training the same. Today’s session was on the same subject and as an additional twist, another subject about Spatial Database was presented. I was always intrigued with Spatial Database and I have enjoyed learning about it; however, I have never thought about Spatial Indexing before it was decided that I will do this session. I really thank Solid Quality Mentor Dr. Greg Low for his assistance in helping me prepare the slide deck and also review the content. Furthermore, today was really what I call my ‘learning day’ . So far I had not attended any session in TechEd and I felt a bit down for that. Everybody spends their valuable time & money to learn something new and exciting in TechEd and I had not attended a single session at the moment thinking that it was already last day of the event. I did have a plan for the day and I attended two technical sessions before my session of spatial database. I attended 2 sessions of Vinod Kumar. Vinod is a natural storyteller and there was no doubt that his sessions would be jam-packed. People attended his sessions simply because Vinod is syhe speaker. He did not have a single time disappointed audience; he is truly a good speaker. He knows his stuff very well. I personally do not think that in India he can be compared to anyone for SQL. Time: 12:30pm-1:30pm SQL Server Query Optimization, Execution and Debugging Query Performance I really had a fun time attending this session. Vinod made this session very interactive. The entire audience really got into the presentation and started participating in the event. Vinod was presenting a small problem with Query Tuning, which any developer would have encountered and solved with their help in such a fashion that a developer feels he or she have already resolved it. In one question, I was the only one who was ready to answer and Vinod told me in a light tone that I am now allowed to answer it! The audience really found it very amusing. There was a huge crowd around Vinod after the session. Vinod – A master storyteller! Time: 3:45pm-4:45pm Data Recovery / consistency with CheckDB This session was much heavier than the earlier one, and I must say this is my most favorite session I EVER attended in India. In this TechEd I have only attended two sessions, but in my career, I have attended numerous technical sessions not only in India, but all over the world. This session had taken my breath away. One by one, Vinod took the different databases, and started to corrupt them in different ways. Each database has some unique ways to get corrupted. Once that was done, Vinod started to show the DBCC CEHCKDB and demonstrated how it can solve your problem. He finally fixed all the databases with this single tool. I do have a good knowledge of this subject, but let me honestly admit that I have learned a lot from this session. I enjoyed and cheered during this session along with other attendees. I had total satisfaction that, just like everyone, I took advantage of the event and learned something. I am now TECHnically EDucated. Pinal Dave and Vinod Kumar After two very interactive and informative SQL Sessions from Vinod Kumar, the next turn me presenting on Spatial Database and Indexing. I got once again nervous but Vinod told me to stay natural and do my presentation. Well, once I got a huge stage with a total of four projectors and a large crowd, I felt better. Time: 5:00pm-6:00pm Session 3: Developing with SQL Server Spatial and Deep Dive into Spatial Indexing Pinal Presenting session at TechEd India 2010 Pinal Presenting session at TechEd India 2010 I kicked off this session with Michael J Swart‘s beautiful spatial image. This session was the last one for the day but, to my surprise, I had more than 200+ attendees. Slowly, the rain was starting outside and I was worried that the hall would not be full; despite this, there was not a single seat available in the first five minutes of the session. Thanks to all of you for attending my presentation. I had demonstrated the map of world (and India) and quickly explained what  Geographic and Geometry data types in Spatial Database are. This session had interesting story of Indexing and Comparison, as well as how different traditional indexes are from spatial indexing. Pinal Presenting session at TechEd India 2010 Due to the heavy rain during this event, the power went off for about 22 minutes (just an accident – nobodies fault). During these minutes, there were no audio, no video and no light. I continued to address the mass of 200+ people without any audio device and PowerPoint. I must thank the audience because not a single person left from the session. They all stayed in their place, some moved closure to listen to me properly. I noticed that the curiosity and eagerness to learn new things was at the peak even though it was the very last session of the TechEd. Everybody wanted get the maximum knowledge out of this whole event. I was touched by the support from audience. They listened and participated in my session even without any kinds of technology (no ppt, no mike, no AC, nothing). During these 22 minutes, I had completed my theory verbally. Pinal Presenting session at TechEd India 2010 After a while, we got the projector back online and we continued with some exciting demos. Many thanks to Microsoft people who worked energetically in background to get the backup power for project up. I had a very interesting demo wherein I overlaid Bangalore and Hyderabad on the India Map and find their aerial distance between them. After finding the aerial distance, we browsed online and found that SQL Server estimates the exact aerial distance between these two cities, as compared to the factual distance. There was a huge applause from the crowd on the subject that SQL Server takes into the count of the curvature of the earth and finds the precise distances based on details. During the process of finding the distance, I demonstrated a few examples of the indexes where I expressed how one can use those indexes to find these distances and how they can improve the performance of similar query. I also demonstrated few examples wherein we were able to see in which data type the Index is most useful. We finished the demos with a few more internal stuff. Pinal Presenting session at TechEd India 2010 Despite all issues, I was mostly satisfied with my presentation. I think it was the best session I have ever presented at any conference. There was no help from Technology for a while, but I still got lots of appreciation at the end. When we ended the session, the applause from the audience was so loud that for a moment, the rain was not audible. I was truly moved by the dedication of the Technology enthusiasts. Pinal Dave After Presenting session at TechEd India 2010 The abstract of the session is as follows: The Microsoft SQL Server 2008 delivers new spatial data types that enable you to consume, use, and extend location-based data through spatial-enabled applications. Attend this session to learn how to use spatial functionality in next version of SQL Server to build and optimize spatial queries. This session outlines the new geography data type to store geodetic spatial data and perform operations on it, use the new geometry data type to store planar spatial data and perform operations on it, take advantage of new spatial indexes for high performance queries, use the new spatial results tab to quickly and easily view spatial query results directly from within Management Studio, extend spatial data capabilities by building or integrating location-enabled applications through support for spatial standards and specifications and much more. Time: 8:00 PM – onwards Dinner by Sponsors After the lively session during the day, there was another dinner party courtesy of one of the sponsors of TechEd. All the MVPs and several Community leaders were present at the dinner. I would like to express my gratitude to Abhishek Kant for organizing this wonderful event for us. It was a blast and really relaxing in all angles. We all stayed there for a long time and talked about our sweet and unforgettable memories of the event. Pinal Dave and Bijoy Singhal It was really one wonderful event. After writing this much, I say that I have no words to express about how much I enjoyed TechEd. However, it is true that I shared with you only 1% of the total activities I have done at the event. There were so many people I have met, yet were not mentioned here although I wanted to write their names here, too . Anyway, I have learned so many things and up until now, I am not able to get over all the fun I had in this event. Pinal Dave at TechEd India 2010 The Next Days – April 15, 2010 – till today I am still not able to get my mind out of the whole experience I had at TechEd India 2010. It was like a whole Microsoft Family working together to celebrate a happy occasion. TechEd India – Truly An Unforgettable Experience! Reference : Pinal Dave (http://blog.SQLAuthority.com) Filed under: About Me, MVP, Pinal Dave, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, SQLAuthority Author Visit, SQLAuthority News, SQLServer, T SQL, Technology Tagged: TechEd, TechEdIn

    Read the article

< Previous Page | 149 150 151 152 153 154 155  | Next Page >