Search Results

Search found 19256 results on 771 pages for 'css tables'.

Page 156/771 | < Previous Page | 152 153 154 155 156 157 158 159 160 161 162 163  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Apache server, PHP

    - by user65649
    I am running a php site on my apache server (Mac). I am having trouble displaying images on the site when I access it externally or from another computer on the same server. If I try to access the image directly. website.com/image.jpg I get a broken link icon and can't display the image. Any ideas what could cause this? My images are embedded using a style.css file. background-image:url(image.jpg);

    Read the article

  • Does OSB has any database dependency?

    - by Manoj Neelapu
    Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

    Read the article

  • How to solve 404 for static files with Django and Nginx?

    - by Lucio
    I setup a Trusty VM with Django + Nginx (other stuffs too). The server is working, I get the "Welcome to Django" page. But when I enter to servername/admin it loads the HTML page but fails to load the static content. And the admin page have this links to static content: <link rel="stylesheet" type="text/css" href="/static/admin/css/base.css" /> <link rel="stylesheet" type="text/css" href="/static/admin/css/login.css" /> Both of the CSS files give me 404, as the Nginx log shows: 192.168.56.1 - - [05/Jun/2014:12:04:09 -0300] "GET /admin HTTP/1.1" 301 5 "-" "Mozilla/5.0 (X11; Ubuntu; Linux x86_64; rv:29.0) Gecko/20100101 Firefox/29.0" 192.168.56.1 - - [05/Jun/2014:12:04:09 -0300] "GET /admin/ HTTP/1.1" 200 833 "-" "Mozilla/5.0 (X11; Ubuntu; Linux x86_64; rv:29.0) Gecko/20100101 Firefox/29.0" 192.168.56.1 - - [05/Jun/2014:12:04:10 -0300] "GET /static/admin/css/base.css HTTP/1.1" 404 142 "http://ubuntu-server/admin/" "Mozilla/5.0 (X11; Ubuntu; Linux x86_64; rv:29.0) Gecko/20100101 Firefox/29.0" 192.168.56.1 - - [05/Jun/2014:12:04:10 -0300] "GET /static/admin/css/login.css HTTP/1.1" 404 142 "http://ubuntu-server/admin/" "Mozilla/5.0 (X11; Ubuntu; Linux x86_64; rv:29.0) Gecko/20100101 Firefox/29.0" I think that the error is on my nginx.conf file, but do not know how to solve it.

    Read the article

  • [Flex 4 and .Net] Retrieving tables from SQL database

    - by mG
    Hi everyone, As the title says, I want to retrieve tables of data from a SQL database, using Flex 4 and .Net WebService. I'm new to both Flex and DotNet. Please tell me a proper way to do it. This is what I've done so far: Retrieving an array of string: (this works) .Net: [WebMethod] public String[] getTestArray() { String[] arStr = { "AAA", "BBB", "CCC", "DDD" }; return arStr; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getTestArray(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application> Retrieving a DataTable: (this does not work) DotNet: [WebMethod] public DataTable getUsers() { DataTable dt = new DataTable("Users"); SqlConnection conn = new SqlConnection("server = 192.168.1.50; database = MyDatabase; user id = sa; password = 1234; integrated security = false"); SqlDataAdapter da = new SqlDataAdapter("select vFName, vLName, vEmail from Users", conn); da.Fill(dt); return dt; } Flex 4: <?xml version="1.0" encoding="utf-8"?> <s:Application xmlns:fx="http://ns.adobe.com/mxml/2009" xmlns:s="library://ns.adobe.com/flex/spark" xmlns:mx="library://ns.adobe.com/flex/mx" minWidth="955" minHeight="600"> <fx:Script> <![CDATA[ import mx.collections.ArrayCollection; import mx.controls.Alert; import mx.rpc.events.ResultEvent; [Bindable] private var ac:ArrayCollection = new ArrayCollection(); protected function btn_clickHandler(event:MouseEvent):void { ws.getUsers(); } protected function ws_resultHandler(event:ResultEvent):void { ac = event.result as ArrayCollection; Alert.show(ac.toString()); } ]]> </fx:Script> <fx:Declarations> <s:WebService id="ws" wsdl="http://localhost:50582/Service1.asmx?WSDL" result="ws_resultHandler(event)"/> </fx:Declarations> <s:Button x="10" y="30" label="Button" id="btn" click="btn_clickHandler(event)"/> </s:Application>

    Read the article

  • Comparing 2 tables column values and copying the next column content to the second table

    - by Sullan
    Hi All.. I am comparing between two tables first column each. If there is find a match i am copying the text from the adjacent cell of the first table to the second table. I am able to compare strings and get the value, but finding it difficult to print it in the second table. I am getting the value in the var "replaceText", but how to print it in the second table ?? Please help... Sample code is as follows.. <script type="text/javascript"> jQuery.noConflict(); jQuery(document).ready(function(){ jQuery('.itemname').each(function(){ var itemName = jQuery(this).text(); jQuery('.comparerow').each(function() { var compareRow = jQuery(this).text(); if (itemName == compareRow) { var replaceText = jQuery(this).next('td').text(); alert(replaceText); } }); }); }); </script> HTML is as follows <table width="100%"><thead> <tr> <th align="left" >Name</th><th>Description</th></tr></thead> <tbody> <tr> <td class="comparerow">IX0001</td> <td class="desc">Desc 1 </td> </tr> <tr> <td class="comparerow">IX0002</td> <td class="desc" >Desc 2 </td> </tr> <tr> <td class="comparerow">IX0003</td> <td class="desc">Desc 3 </td> </tr> <tr> <td class="comparerow">IX0004</td> <td class="desc">Desc 4 </td> </tr> </tbody> </table> <br /> <table width="100%"> <tr> <th>Name</th><th>Description</th> </tr> <tr > <td class="itemname">IX0001</td><td></td> </tr> <tr> <td class="itemname">IX0002</td><td></td> </tr> <tr> <td class="itemname">IX0003</td><td></td> </tr> </table>

    Read the article

  • Parsing tables, cells with Html agility in C#

    - by Kaeso
    I need to parse Html code. More specifically, parse each cell of every rows in all tables. Each row represent a single object and each cell represent different properties. I want to parse these to be able to write an XML file with every data inside (without the useless HTML code). This is the way I thought it out initially but I ran out of ideas: HTML: <tr> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="left"> <a href="/ice/player.htm?id=8471675">Sidney Crosby</a> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> PIT </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="center"> C </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 39 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 32 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 33 </td> <td class="statBox sorted" style="border-width:0px 1px 1px 0px; background-color: #E0E0E0" align="right"> <font color="#000000"> 65 </font> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 29 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 10 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 1 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 3 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 0 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 154 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 20.8 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 21:54 </td> <td class="statBox" style="border-width:0px 1px 1px 0px; background-color: #FFFFFF" align="right"> 22.6 </td> <td class="statBox" style="border-width:0px 0px 1px 0px; background-color: #FFFFFF" align="right"> 55.7 </td> </tr> C#: using HtmlAgilityPack; using System.Data; namespace Stats { class StatsParser { private string htmlCode; private static string fileName = "[" + DateTime.Now.ToShortDateString() + " NHL Stats].xml"; public StatsParser(string htmlCode) { this.htmlCode = htmlCode; this.ParseHtml(); } public DataTable ParseHtml() { var result = new DataTable(); HtmlDocument doc = new HtmlDocument(); doc.LoadHtml(htmlCode); HtmlNode row = doc.DocumentNode.SelectNodes("//tr"); foreach (var statBox in row.SelectNodes("//td[@class='statBox']")) { System.Windows.MessageBox.Show(statBox.InnerText); } } } }

    Read the article

  • HTML tables in JTextPane showing weird "form" boxes

    - by Ted
    import java.awt.BorderLayout; import java.awt.EventQueue; import javax.swing.JFrame; import javax.swing.JPanel; import javax.swing.JTextPane; import javax.swing.border.EmptyBorder; import javax.swing.text.Document; import javax.swing.text.html.HTMLEditorKit; import javax.swing.text.html.StyleSheet; public class htmlEditor2 extends JFrame { private JPanel contentPane; public static void main(String[] args) { EventQueue.invokeLater(new Runnable() { public void run() { try { htmlEditor2 frame = new htmlEditor2(); frame.setVisible(true); } catch (Exception e) { e.printStackTrace(); } } }); } public htmlEditor2() { setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); setBounds(100, 100, 450, 300); contentPane = new JPanel(); contentPane.setBorder(new EmptyBorder(5, 5, 5, 5)); contentPane.setLayout(new BorderLayout(0, 0)); setContentPane(contentPane); Foo f = new Foo(); f.setText("<html><body><table border=\"1\" width=\"985\" cellpadding=\"3\" cellspacing=\"0\" style=\"table-layout: fixed; border-collapse: collapse; border-width: 0px; border-color: #010101; \"><colgroup><col width=\"328\"></col> <col width=\"328\"></col> <col width=\"328\"></col> </colgroup><tr><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><font face=\"Arial\"><span style=\"font-size:8pt\">row 1</span></font></div></td><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><font face=\"Arial\"><span style=\"font-size:8pt\">row2</span></font></div></td><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><font face=\"Arial\"><span style=\"font-size:8pt\">row3</span></font></div></td></tr><tr><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><span style=\"font-size: 8pt;\">&nbsp;</span></div></td><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><span style=\"font-size: 8pt;\">&nbsp;</span></div></td><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><span style=\"font-size: 8pt;\">&nbsp;</span></div></td></tr><tr><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><span style=\"font-size: 8pt;\">&nbsp;</span></div></td><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><span style=\"font-size: 8pt;\">&nbsp;</span></div></td><td align=\"left\" valign=\"top\" width=\"321\" style=\"border: solid #010101 1px; \"><div align=\"left\"><span style=\"font-size: 8pt;\">&nbsp;</span></div></td></tr></table><div align=\"left\">&nbsp;&nbsp;</div></body></html>"); contentPane.add(f); } class Foo extends JTextPane { public Foo() { super(); HTMLEditorKit kit = new HTMLEditorKit(); setEditorKit(kit); StyleSheet styleSheet = kit.getStyleSheet(); styleSheet.addRule(""); //in case I need to add a CSS Document doc = kit.createDefaultDocument(); setDocument(doc); } } } I would paste a nicely formatted version of the html, but I'm not sure how to do it on here... So yeah.. I just want to know how to get rid of those weird colgroup and col boxes in my table and how to make the table work normally! Thanks yall!

    Read the article

  • Why are items being placed below?

    - by Adam DePolo
    This is really confusing and I have never had this occur. For my computer, it is fine. But for anyone else's computer I have tried, it screws up. So on my site, designatease.com , the second bar down, it places the fifth item down below the first four. I am not sure why it is doing this. I want them to span across the bar but the stop at about half way. Help me out SOF. HTML <html> <head> <link rel="stylesheet" type="text/css" href="style.css" /> <title>Design At Ease - Home</title> </head> <body> <div id="header"> <div id="logo"><a class="logoclass">DesignAtEase.com</a></div> <ul id="headerlinks"> <li><a href="index.html">Home</a></li> <li><a href="coding.html">Coding</a></li> <li><a href="graphics.html">Graphics</a></li> <li><a href="database.html">Database</a></li> <li><a href="support.html">Support</a></li> <li><a href="more.html">More</a></li> </ul> </div> <ul id="quicklinks"> <li><a href="quickstart.html">Quick Start</a></li> <li><a href="tagsmain.html">Tag Helper</a></li> <li><a href="html.html">HTML</a></li> <li><a href="css.html">CSS</a></li> <li><a href="photoshop.html">Photoshop</a></li> <li><a href="quickstart.html">Quick Start</a></li> <li><a href="tagsmain.html">Tag Helper</a></li> </ul> </body> </html> CSS body{ background:#fffffc; margin: auto auto; } #header{ background:#e5e5e5; height:35px; width:100%; border-bottom: 1px #c9c9c9 solid; } #headerlinks{ position:relative; display:inline; float:right; margin-right:5%; bottom:37px; } #headerlinks li{ display:inline; padding-left:25px; } #headerlinks li a{ color:#777777; display:inline; font-size:18px; font-family: sans-serif; text-decoration:none; } #headerlinks li a:hover{ color:#a3a3a3; display:inline; font-size:18px; font-family: sans-serif; text-decoration:none; } #logo{ position:relative; color:black; margin-left:5%; top:5px; } .logoclass{ color:#212121; display:inline; font-size:24px; font-family: sans-serif; text-decoration:none; } #quicklinks{ width:90%; margin-left:auto; margin-right:auto;; height:25px; background:#e5e5e5; border-bottom: 1px #c9c9c9 solid; border-left: 1px #c9c9c9 solid; border-right: 1px #c9c9c9 solid; top:-16px; position:relative; } #quicklinks li{ display:inline; } #quicklinks li a{ } #quicklinks li a:hover{ } #wrapper{ width:80%; height:100%; }

    Read the article

  • Database with 5 Tables with Insert and Select

    - by kirbby
    hi guys, my problem is that i have 5 tables and need inserts and selects. what i did is for every table a class and there i wrote the SQL Statements like this public class Contact private static String IDCont = "id_contact"; private static String NameCont = "name_contact"; private static String StreetCont = "street_contact"; private static String Street2Cont = "street2_contact"; private static String Street3Cont = "street3_contact"; private static String ZipCont = "zip_contact"; private static String CityCont = "city_contact"; private static String CountryCont = "country_contact"; private static String Iso2Cont = "iso2_contact"; private static String PhoneCont = "phone_contact"; private static String Phone2Cont = "phone2_contact"; private static String FaxCont = "fax_contact"; private static String MailCont = "mail_contact"; private static String Mail2Cont = "mail2_contact"; private static String InternetCont = "internet_contact"; private static String DrivemapCont = "drivemap_contact"; private static String PictureCont = "picture_contact"; private static String LatitudeCont = "latitude_contact"; private static String LongitudeCont = "longitude_contact"; public static final String TABLE_NAME = "contact"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + IDCont + "INTEGER not NULL," + NameCont + " TEXT not NULL," + StreetCont + " TEXT," + Street2Cont + " TEXT," + Street3Cont + " TEXT," + ZipCont + " TEXT," + CityCont + " TEXT," + CountryCont + " TEXT," + Iso2Cont + " TEXT," + PhoneCont + " TEXT," + Phone2Cont + " TEXT," + FaxCont + " TEXT," + MailCont + " TEXT," + Mail2Cont + " TEXT," + InternetCont + " TEXT," + //website of the contact DrivemapCont + " TEXT," + //a link to a drivemap to the contact PictureCont + " TEXT," + //a photo of the contact building (contact is not a person) LatitudeCont + " TEXT," + LongitudeCont + " TEXT," + "primary key(id_contact)" + "foreign key(iso2)"; and my insert looks like this public boolean SQL_INSERT_CONTACT(int IDContIns, String NameContIns, String StreetContIns, String Street2ContIns, String Street3ContIns, String ZipContIns, String CityContIns, String CountryContIns, String Iso2ContIns, String PhoneContIns, String Phone2ContIns, String FaxContIns, String MailContIns, String Mail2ContIns, String InternetContIns, String DrivemapContIns, String PictureContIns, String LatitudeContIns, String LongitudeContIns) { try{ db.execSQL("INSERT INTO " + "contact" + "(" + IDCont + ", " + NameCont + ", " + StreetCont + ", " + Street2Cont + ", " + Street3Cont + ", " + ZipCont + ", " + CityCont + ", " + CountryCont + ", " + Iso2Cont + ", " + PhoneCont + ", " + Phone2Cont + ", " + FaxCont + ", " + MailCont + ", " + Mail2Cont + ", " + InternetCont + ", " + DrivemapCont + ", " + PictureCont + ", " + LatitudeCont + ", " + LongitudeCont + ") " + "VALUES (" + IDContIns + ", " + NameContIns +", " + StreetContIns + ", " + Street2ContIns + ", " + Street3ContIns + ", " + ZipContIns + ", " + CityContIns + ", " + CountryContIns + ", " + Iso2ContIns + ", " + PhoneContIns + ", " + Phone2ContIns + ", " + FaxContIns + ", " + MailContIns + ", " + Mail2ContIns + ", " + InternetContIns + ", " + DrivemapContIns + ", " + PictureContIns + ", " + LatitudeContIns + ", " + LongitudeContIns +")"); return true; } catch (SQLException e) { return false; } } i have a DBAdapter class there i created the database public class DBAdapter { public static final String DB_NAME = "mol.db"; private static final int DB_VERSION = 1; private static final String TAG = "DBAdapter"; //to log private final Context context; private SQLiteDatabase db; public DBAdapter(Context context) { this.context = context; OpenHelper openHelper = new OpenHelper(this.context); this.db = openHelper.getWritableDatabase(); } public static class OpenHelper extends SQLiteOpenHelper { public OpenHelper(Context context) { super(context, DB_NAME, null, DB_VERSION); } @Override public void onCreate(SQLiteDatabase db) { // TODO Auto-generated method stub db.execSQL(Contact.SQL_CREATE); db.execSQL(Country.SQL_CREATE); db.execSQL(Picture.SQL_CREATE); db.execSQL(Product.SQL_CREATE); db.execSQL(Project.SQL_CREATE); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { // TODO Auto-generated method stub Log.w(TAG, "Upgrading database from version " + oldVersion + " to " + newVersion + ", which will destroy all old data"); db.execSQL(Contact.SQL_DROP); db.execSQL(Country.SQL_DROP); db.execSQL(Picture.SQL_DROP); db.execSQL(Product.SQL_DROP); db.execSQL(Project.SQL_DROP); onCreate(db); } i found so many different things and tried them but i didn't get anything to work... i need to know how can i access the database in my activity and how i can get the insert to work and is there sth wrong in my code? thanks for your help thats how i tried to get it into my activity public class MainTabActivity extends TabActivity { private Context context; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.maintabactivity); TabHost mTabHost = getTabHost(); Intent intent1 = new Intent().setClass(this,MapOfLight.class); //Intent intent2 = new Intent().setClass(this,Test.class); //Testactivity //Intent intent2 = new Intent().setClass(this,DetailView.class); //DetailView Intent intent2 = new Intent().setClass(this,ObjectList.class); //ObjectList //Intent intent2 = new Intent().setClass(this,Gallery.class); //Gallery Intent intent3 = new Intent().setClass(this,ContactDetail.class); mTabHost.addTab(mTabHost.newTabSpec("tab_mol").setIndicator(this.getText(R.string.mol), getResources().getDrawable(R.drawable.ic_tab_mol)).setContent(intent1)); mTabHost.addTab(mTabHost.newTabSpec("tab_highlights").setIndicator(this.getText(R.string.highlights),getResources().getDrawable(R.drawable.ic_tab_highlights)).setContent(intent2)); mTabHost.addTab(mTabHost.newTabSpec("tab_contacts").setIndicator(this.getText(R.string.contact),getResources().getDrawable(R.drawable.ic_tab_contact)).setContent(intent3)); mTabHost.setCurrentTab(1); SQLiteDatabase db; DBAdapter dh = null; OpenHelper openHelper = new OpenHelper(this.context); dh = new DBAdapter(this); db = openHelper.getWritableDatabase(); dh.SQL_INSERT_COUNTRY("AT", "Austria", "AUT"); } } i tried it with my country table because it has only 3 columns public class Country { private static String Iso2Count = "iso2_country"; private static String NameCount = "name_country"; private static String FlagCount = "flag_image_url_country"; public static final String TABLE_NAME = "country"; public static final String SQL_CREATE = "CREATE TABLE IF NOT EXISTS " + TABLE_NAME + "(" + Iso2Count + " TEXT not NULL," + NameCount + " TEXT not NULL," + FlagCount + " TEXT not NULL," + "primary key(iso2_country)"; public boolean SQL_INSERT_COUNTRY(String Iso2CountIns, String NameCountIns, String FlagCountIns) { try{ db.execSQL("INSERT INTO " + "country" + "(" + Iso2Count + ", " + NameCount + ", " + FlagCount + ") " + "VALUES ( " + Iso2CountIns + ", " + NameCountIns +", " + FlagCountIns + " )"); return true; } catch (SQLException e) { return false; } } another question is it better to put the insert and select from each table into a separate class, so i have 1 class for each table or put them all into the DBAdapter class?

    Read the article

  • Should CSS be listed on your resume under Languages?

    - by Sandeepan Nath
    I have some doubts like Whether CSS should be put under Languages or not? Although Wikipedia says Cascading Style Sheets (CSS) is a style sheet language ... But do they write CSS under the languages section of the resume, along with PHP, etc? Similarly what about HTML? I have some doubt and I don't want to sound like someone who is not aware of the trends. Just to give an example, currently I have the following languages,frameworks, technologies, etc. listed under the "Technical Expertise" section of my resume - Technical Expertise * Languages - Proficient - PHP 5, Javascript, HTML ?*,CSS ?*,Sass ?*. Beginner - Linux Bash. * Databases - MySQL 5. * Technologies - AJAX. * Frameworks/Libraries - Symfony, jQuery. * CMSes - Wordpress. Although my domain is Web-development/design, I welcome domain-agnostic answers which can provide some generic ideas/reasoning. I have seen, a lot of people messing up these sections (even more serious than my doubts :) ), putting things under wrong sub-headings and thus putting a big question mark on their understanding of those things. I don't know much about XML, Comet Technology etc. Considering those are included too, What things should be put under Languages? E.g. Should CSS be put under Languages? Please give some reasoning to support your views. Where should the others (XML, Comet, cURL etc. ) be put? I welcome some examples of how you put it. Or do you have an additional Keywords section where you write all the unsortables ? Considering a set of standards like W3C standards, etc. do you have a standards sub-heading? I guess I have put the contents of other sections Okay. But do let me know about your ideas and reasoning. After all, I understand there may not be a single answer to this, but let's see what is the trend. Thanks Updates Further, do you mention design patters you have used? Web Services etc.? Where do you mention SOAP, XML etc...

    Read the article

  • How do you version/track changes to SQL tables?

    - by gabe.
    When working in a team of developers, where everyone is making changes to local tables, and development tables, how do you keep all the changes in sync? A central log file where everyone keeps their sql changes? A wiki page to track alter table statements, individual .sql files that the devs can run to bring their local db's to the latest version? I've used some of these solutions, and I'm tyring to get a good solid solution together that works, so I'd appreciate your ideas.

    Read the article

  • Focussing on Style Sheets and Cross Browser Compatibility.

    - by Sam
    Hello everyone, Let me begin this topic by explaining my background experience with web design. I have always been more of a back end programmer, with PHP and SQL and things. However I do have a shallow background with HTML and CSS. The problem is, I don't know it all. What I do know is, when it comes to designing (not back end dirty work) I understand basic CSS properties and I also understand HTML and I can usually throw together a sloppy web page with the two and a couple bazillion DIV tags. Anyways.. The problem I always have encountered is that when I design a website in a browser such as IE7 (and then it looks perfect on IE7), and then look at it on IE8 or IE6 or Mozilla (etc.) it gets all spacey and ugly and looks totally different than the way it should look on IE7. Question one: Basically, what I am asking everyone is what route should I take to learn how to properly build the website? Build as in put it togehter with CSS standards and HTML standards that will make my site look the same on every brwoser. (Not only learning standards but where can I learn to properly write my code?) Where is a strong free resource I can use to learn how to these things? Question two: How do I properly code my website? Do I use all external style sheets to make dynamic page design simplistic or do I hard code some things into the DIV tags on each page? What is proper? Oh, and if anyone has any tutorials on how to properly design a complete layout feel free to throw it in a response somewhere. Thank you for taking the time to read my questions, and hopefully you will understand what I am trying to get out to everyone. I need to get on the right route of the designing side of web programming so that I will know how to create successful websites in the future. Thank you, Sam Pardee

    Read the article

  • Eliminate horizontal scrolling in div in favor of horizontal scrolling in browser window

    - by Casey Flynn
    I have a div, set to 800px wide, that will automatically scroll horizontally if the browser window is resized to < 800px. The behavior I would like, is to have the browser window scroll instead of the div. It would seem simple but for some reason I'm getting hung up on it. Any ideas? The page in question: http://www.caseyflynn.com/game/ The div CSS: div#main_container { border: 1px solid #FFF; width:800px; margin-left:auto; margin-right:auto; padding:0px; background-color:#FFF; overflow:hidden; } The BODY CSS: html, body { background-color:#000; border:0px; margin:0px; padding:0px; font-family : Arial, Helvetica, sans-serif; font-size : 62.5%; overflow:auto; } I'm assuming anyone looking at this will have the ability to see the HTML and the CSS. Thanks!

    Read the article

  • Change specificity by child

    - by jim red
    hi I'd like to integrate a theme tag to my elements so they appear in diffrent colours. But since the css selectors have the same css specificity the latest overrides the earlier defined rule. this is an example that shows my problem: .... <div class="red"> <div class="box">This should be red</div> <div class="yellow"> ... <div class="box">This should be yellow (nested in x levels under the div.yellow)</div> ... </div> .... and here my css .box { width: 100px; height: 100px; } .yellow { background-color: yellow; } .red { background-color: red; } the box should be listed somewhere, but as soon as it is a sub child of another color definition it should been overwritten. thanks for any help! //jim

    Read the article

  • How can I add the "--watch" flag to this TextMate snippet?

    - by Jannis
    I love TextMate as my editor for all things web, and so I'd like to use a snippet to use it with style.less files to automatically take advantage of the .less way of compiling .css files on the fly using the native $ lessc {filepath} --watch as suggested in the less documentation (link) My (thanks to someone who wrote the LESS TM Bundle!) current TextMate snippet works well for writing the currently opened .less file to the .css file but I'd like to take advantage of the --watch parameter so that every change to the .less file gets automatically compiled into the .css file. This works well when using the Terminal command line for it, so I am sure it must be possible to use it in an adapted version of the current LESS Command for TextMate since that only invokes the command to compile the file. So how do I add the --watch flag to this command:? #!/usr/bin/env ruby file = STDIN.read[/lessc: ([^*]+\.less)/, 1] || ENV["TM_FILEPATH"] system("lessc \"#{file}\"") I assume it should be something like: #!/usr/bin/env ruby file = STDIN.read[/lessc: ([^*]+\.less)/, 1] || ENV["TM_FILEPATH"] system("lessc \"#{file}\" --watch") But doing so only crashes the TextMate.app. Any ideas would be much appreciated. Thanks for reading. Jannis

    Read the article

  • Vertically center a fluid image in a fluid container

    - by Ferdy
    I certainly do not want to add to the pile of vertical alignments CSS questions, but I've spent hours trying to find a solution to no avail yet. Here's the situation: I am building a slideshow gallery of images. I want the images to be displayed as large as the user's window allows. So I have this outer placeholder: <section class="photo full"> (Yes, I'm using HTML5 elements). Which has the following CSS: section.photo.full { display:inline-block; width:100%; height:100%; position:absolute; overflow:hidden; text-align:center; } Next, the image is placed inside it. Depending on the orientation of the image, I set either the width or height to 75%, and the other axis to auto: $wide = $bigimage['width'] >= $bigimage['height'] ? true: false; ?> <img src="<?= $bigimage['url'] ?>" width="<?= $wide? "75%" : "auto"?>" height="<?= $wide? "auto" : "75%"?>"/> So, we have a fluid outer container, with inside a fluid image. The horizontal centering of the image works, yet I cannot seem to find a way to vertically center the image within it's container. I have researched centering methods but most assume either the container or image has a known width or height. Then there is the display:table-cell method, which does not seem to work for me either. I'm stuck. I'm looking for a CSS solution, but am open to js solutions too.

    Read the article

  • Horizontally and Vertically Center Modal Div IE Issue

    - by aherrick
    I'm trying to horizontally and vertically center a modal window inside a div. I want it to be cross browser compatible. You can see from the picture below that when I resize IE8 then click, "show modal" button it displays not exactly horizontally centered. This does not seem to be an issue with Chrome. Any thoughts? How would you guys accomplish this? <html> <head> <title>test</title> <style type="text/css"> * { margin: 0px; padding: 0px; } </style> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.min.js"></script> <script type="text/javascript"> $(function() { $('#modal').click(function() { // overlay $('<div id="overlay" />').css({ position: 'absolute', top: 0, left: 0, width: '100%', height: '100%', backgroundColor: 'black', opacity: 0 }).appendTo('body'); $('<div id="datamodal" />').css({ backgroundColor: '#FFFFFF', border: '10px solid #999', height: '200px', width: '600px', position: 'absolute', top: '50%', left: '50%', marginTop: '-120px', marginLeft: '-320px', color: '#111111', fontWeight: 'bold', padding: '10px', display: 'none' }).append('<input type="text" />').appendTo('#overlay'); $('#overlay').fadeTo(300, 0.7); $('#datamodal').fadeIn(300); }); }); </script> </head> <body> <input id="modal" type="button" value="show modal" /> </body> </html>

    Read the article

  • Absolute positioning in IE6, using left: 0; and right: 0; simultaneously

    - by Zane
    Here is my website: http://dagwaging.110mb.com/ View it in any good browser, then in IE6. It dies in IE6. It seems that in IE6, one can't do this: div { position: absolute; left: 0px; right: 0px; } or this: div { position: absolute; top: 0px; bottom: 0px; } Absolute positions cannot be set for left and right or top and bottom at the same time. This is terrible, because that is pretty much the basis of my site design. The HTML can be viewed on the site, and the CSS is in /style.css. I'd like to fix this without invalidating my CSS or HTML. Can this be done? Another problem is that my content uses min-width and max-width to avoid over-stretching or compressing the content within. IE6 can't do min-width, so how can I replicate this behavior?

    Read the article

  • Where can I find a professional image gallery built on a javascript framework?

    - by user278457
    I'm looking to find a galleria replacement, hopefully using jQuery but other javascript frameworks such as prototype or mootools are fine too. I used galleria a while back, and I need a similar product now. Unfortunately, the devkick.com domain seems to have disappeared in the meantime and I'm wary of using products that aren't actively maintained. I'm willing to pay up to $50 per site for licensing costs, if the product meets my needs. I'm specifically looking for a gallery with the following features: Every image in the gallery preloads asap, not as the user clicks "next" Minimalist default css to keep my subsequent styling headaches down, preferably a "darkroom" style by default, much as galleria looks Each element that constructs the image gallery should be simple and logical to reference with CSS As easy to install as adding a css class to a single unordered list No dependencies other than the core jQuery/other library, including "easing" and other effects must be optional Works on browsers back to IE6, Firefox 3, Safari (and iPhone), Chrome, Opera Has a javascript API that lets me trigger callback functions on common events such as "user clicks next" or "image loads" degrades gracefully without javascript, either displays images as a list, or just displays the first image in the list bonus: The gallery can display other content, such as video or external sites, like the modal boxes at shadowbox-js.com well documented minimal bandwidth requirement - .js file should be ~10kb minified bonus: The gallery source is hosted on a reliable CDN like google's bonus: Thumbnails for images do not appear until the main image has loaded bonus: includes ability to set parameters with JSON to change common behaviours, such as slide/fade transitions or automatic image switch every X seconds

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • How can I ceil the height of a div that has "display: table-cell"?

    - by eric01
    I am trying to vertically center a div inside another div, regardless of the size of both div's I am doing this: <div id='outer_div'> <div id='inner_div'></div> </div> The CSS is #outer_div { display: table-row; height: 200px; width: 200px } #inner_div { display: table-cell; vertical-align: middle; height: 500px; width: 500px } I put larger dimensions for the inner div on purpose. What happens is that even if I put a width of 1000px, the width of the innerdiv is ceiled at 200px because of the outer div's width (and this is what I want) But for the height, it is not ceiled and I would like it to be ceiled to the height of the outer div. What i want is the innerdiv to remain at the same size as the outer_div, no matter what height I give to outer_div in CSS. I basically want it to be the same size as its parent. EDIT: I only put text inside those div's. So let's say I have an outer div of 200px*200px (it has display: table-row), and the inner div is defined by css as 500px*500px and it has dummy text inside. My expected result is to have the inner div shrunk down to 200px*200px. It is successfully 'shrunk' by the outer div for the width, but NOT for the height. What I want is to have it shrunk on the height as well (so the inner div ajusts automatically in case I change the height of the outer div) How do I go about that?

    Read the article

  • Selenium RC: How to assert an element contains text and any number of other elements?

    - by Andrew
    I am using Selenium RC and the PHPUnit Selenium Extension. I am trying to assert that a table row exists, with the content that I expect, while making it flexible enough to be reused. Thanks to this article, I figured out a way to select the table row, asserting that it contains all the text that I expect. $this->assertElementPresent("css=tr:contains(\"$text1\"):contains(\"$text2\")"); But now I would like to assert that a specific radio button appears in the table row also. Here's the element that I would like to assert that is within the table row. (I am currently asserting that it exists using XPath. I'm sure I could do the same using CSS). $this->assertElementPresent("//input[@type='radio'][@name='Contact_ID'][@value='$contactId']"); Currently I have a function that can assert that a table row exists which contains any number of texts, but I would like to add the ability to specify any number of elements and have it assert that the table row contains them. How can I achieve this? /** * Provides the ability to assert that all of the text appear in the same table row. * @param array $texts */ public function assertTextPresentInTableRow(array $texts) { $locator = 'css=tr'; foreach ($texts as $text) { $locator .= ":contains(\"$text\")"; } $this->assertElementPresent($locator); }

    Read the article

  • Is it bad use "display: table;" to organise a layout into 2 columns?

    - by Colen
    Hello, I am trying to make a 2 column layout, apparently the bane of CSS. I know you shouldn't use tables for layout, but I've settled on this CSS. Note the use of display: table etc. div.container { width: 600px; height: 300px; margin: auto; display: table; table-layout: fixed; } ul { white-space: nowrap; overflow: hidden; display: table-cell; width: 40%; } div.inner { display: table-cell; width: auto; } With this layout: <div class="container"> <ul> <li>First</li> <li>Second</li> <li>Third</li> </ul> <div class="inner"> <p>Hello world</p> </div> </div> This seems to work admirably. However, I can't help wondering - am I obeying the letter of the "don't use tables" rule, but not the spirit? I think it's ok, since there's no positioning markup in the HTML code, but I'm just not sure about the "right" way to do it. I can't use css float, because I want the columns to expand and contract with the available space. Please, stack overflow, help me resolve my existential sense of dread at these pseudo-tables.

    Read the article

< Previous Page | 152 153 154 155 156 157 158 159 160 161 162 163  | Next Page >