Search Results

Search found 39788 results on 1592 pages for 'action method'.

Page 1579/1592 | < Previous Page | 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586  | Next Page >

  • NOOB Memory Problem - EXC_BAD_ACCESS

    - by Michael Bordelon
    I have been banging my head against the wall for a couple days and need some help. I have a feeling that I am doing something really silly here, but I cannot find the issue. This is the controller for a table view. I put the SQL in line to simplify it as part of the troubleshooting of this error. Normally, it would be in an accessor method in a model class. It gets through the SQL read just fine. Finds the two objects, loads them into the todaysWorkout array and then builds the cells for the table view. The table view actually comes up on the scree and then it throws the EXC_BAD_ACCESS. I ran instruments and it shows the following: 0 CFString Malloc 1 00:03.765 0x3946470 176 Foundation -[NSPlaceholderString initWithFormat:locale:arguments:] 1 CFString Autorelease 00:03.765 0x3946470 0 Foundation NSRecordAllocationEvent 2 CFString CFRelease 0 00:03.767 0x3946470 0 Bring It -[WorkoutViewController viewDidLoad] 3 CFString Zombie -1 00:03.917 0x3946470 0 Foundation NSPopAutoreleasePool Here is the source code for the controller. I left it all in there just in case there is something extraneous causing the problem. I sincerely appreciate any help I can get: #import "WorkoutViewController.h" #import "MoveListViewController.h" #import "Profile.h" static sqlite3 *database = nil; @implementation WorkoutViewController @synthesize todaysWorkouts; @synthesize woNoteCell; @synthesize bi; //@synthesize woSwitchCell; - (void)viewDidLoad { [super viewDidLoad]; bi = [[BIUtility alloc] init]; todaysWorkouts = [[NSMutableArray alloc] init]; NSString *query; sqlite3_stmt *statement; //open the database if (sqlite3_open([[BIUtility getDBPath] UTF8String], &database) != SQLITE_OK) { sqlite3_close(database); NSAssert(0, @"Failed to opendatabase"); } query = [NSString stringWithFormat:@"SELECT IWORKOUT.WOINSTANCEID, IWORKOUT.WORKOUTID, CWORKOUTS.WORKOUTNAME FROM CWORKOUTS JOIN IWORKOUT ON IWORKOUT.WORKOUTID = CWORKOUTS.WORKOUTID AND DATE = '%@'", [BIUtility todayDateString]]; if (sqlite3_prepare_v2(database, [query UTF8String], -1, &statement, nil) == SQLITE_OK) { while (sqlite3_step(statement) == SQLITE_ROW) { Workout *wo = [[Workout alloc] init]; wo.woInstanceID = sqlite3_column_int(statement, 0); wo.workoutID = sqlite3_column_int(statement, 1); wo.workoutName = [NSString stringWithUTF8String:(char *)sqlite3_column_text(statement, 2)]; [todaysWorkouts addObject:wo]; [wo release]; } sqlite3_finalize(statement); } if(database) sqlite3_close(database); [query release]; } - (UITableViewCell *)tableView:(UITableView *)tableView cellForRowAtIndexPath:(NSIndexPath *)indexPath { //todaysWorkouts = [BIUtility todaysScheduledWorkouts]; static NSString *noteCellIdentifier = @"NoteCellIdentifier"; UITableViewCell *cell; if (indexPath.section < ([todaysWorkouts count])) { cell = [tableView dequeueReusableCellWithIdentifier:@"OtherCell"]; if (cell == nil) { cell = [[[UITableViewCell alloc] initWithFrame:CGRectZero reuseIdentifier: @"OtherCell"] autorelease]; cell.accessoryType = UITableViewCellAccessoryNone; } if (indexPath.row == 0) { Workout *wo = [todaysWorkouts objectAtIndex:indexPath.section]; [cell.textLabel setText:wo.workoutName]; } else { [cell.textLabel setText:@"Completed?"]; [cell.textLabel setFont:[UIFont fontWithName:@"Arial" size:15]]; [cell.textLabel setTextColor:[UIColor blueColor]]; } } else { cell = (NoteCell *)[tableView dequeueReusableCellWithIdentifier:noteCellIdentifier]; if (cell == nil) { NSArray *nib = [[NSBundle mainBundle] loadNibNamed:@"NoteCell" owner:self options:nil]; cell = [nib objectAtIndex:0]; } } return cell; //[cell release]; } - (void)tableView:(UITableView *)tableView didSelectRowAtIndexPath:(NSIndexPath *)indexPath { NSUInteger row = [indexPath row]; if (indexPath.section < ([todaysWorkouts count]) && (row == 0)) { MoveListViewController *moveListController = [[MoveListViewController alloc] initWithStyle:UITableViewStylePlain]; moveListController.workoutID = [[todaysWorkouts objectAtIndex:indexPath.section] workoutID]; moveListController.workoutName = [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]; moveListController.woInstanceID = [[todaysWorkouts objectAtIndex:indexPath.section] woInstanceID]; NSLog(@"Workout Selected: %@", [[todaysWorkouts objectAtIndex:indexPath.section] workoutName]); Bring_ItAppDelegate *delegate = [[UIApplication sharedApplication] delegate]; [delegate.workoutNavController pushViewController:moveListController animated:YES]; } else { UITableViewCell *cell = [tableView cellForRowAtIndexPath:indexPath]; if (indexPath.section < ([todaysWorkouts count]) && (row == 1)) { if (cell.accessoryType == UITableViewCellAccessoryNone) { cell.accessoryType = UITableViewCellAccessoryCheckmark; } else { cell.accessoryType = UITableViewCellAccessoryNone; } } } [tableView deselectRowAtIndexPath:indexPath animated:YES]; } - (CGFloat)tableView:(UITableView *)tableView heightForRowAtIndexPath:(NSIndexPath *)indexPath { NSInteger h = 35; return h; } - (NSInteger)numberOfSectionsInTableView:(UITableView *)tableView { return ([todaysWorkouts count] + 1); //return ([todaysWorkouts count]); } - (NSInteger)tableView:(UITableView *)tableView numberOfRowsInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return 2; } else { return 1; } } - (NSString *)tableView:(UITableView *)tableView titleForHeaderInSection:(NSInteger)section { if (section < ([todaysWorkouts count])) { return @"Workout"; } else { return @"How Was Your Workout?"; } } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { [super viewDidUnload]; // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [todaysWorkouts release]; [bi release]; [super dealloc]; } @end

    Read the article

  • How to use EJB 3.1 DI in Servlet ? (Could not inject session bean by @EJB from web application)

    - by kislo_metal
    I am tying to merging web application(gwt, jpa) to an separate 2 application(business login in ejb/jpa and web client in gwt). Currently i can`t inject my beans from web application (simple servlet) I am using glassfish v3. module limbo(ejb jar) is in dependency of module lust (war). If I use lust with compiler output of limbo everything work perfect (if ejb in web application and the are deploying together as one application). Have I messed some container configuration ? Here is my steps: I have some limbo.jar (ejb-jar) deployed to ejb container. I do not use any ejb-jar.xml, only annotations. package ua.co.inferno.limbo.persistence.beans; import javax.ejb.Remote; @Remote public interface IPersistentServiceRemote { ArrayList<String> getTerminalACPList(); ArrayList<String> getBoxACPList(); ArrayList<String> getCNPList(); ArrayList<String> getCNSList(); String getProductNamebyID(int boxid); ArrayList<String> getRegionsList(String lang); long getSequence(); void persistEntity (Object ent); } package ua.co.inferno.limbo.persistence.beans; import ua.co.inferno.limbo.persistence.entitis.EsetChSchemaEntity; import ua.co.inferno.limbo.persistence.entitis.EsetKeyActionsEntity; @Local public interface IPersistentService { ArrayList<String> getTerminalACPList(); ArrayList<String> getBoxACPList(); ArrayList<String> getCNPList(); ArrayList<String> getCNSList(); String getProductNamebyID(int boxid); ArrayList<String> getRegionsList(String lang); long getSequence(); long persistPurchaseBox(EsetRegPurchaserEntity rp); void removePurchaseTempBox(EsetRegPurchaserTempEntity rpt); EsetRegionsEntity getRegionsById(long rid); void persistEntity (Object ent); } package ua.co.inferno.limbo.persistence.beans; import ua.co.inferno.limbo.persistence.entitis.EsetChSchemaEntity; import ua.co.inferno.limbo.persistence.entitis.EsetKeyActionsEntity; import ua.co.inferno.limbo.persistence.entitis.EsetRegBoxesEntity; import javax.ejb.Stateless; import javax.persistence.EntityManager; import javax.persistence.PersistenceContext; @Stateless(name = "PersistentService") public class PersistentServiceEJB implements IPersistentService, IPersistentServiceRemote{ @PersistenceContext(unitName = "Limbo") EntityManager em; public PersistentServiceEJB() { } ......... } Than i trying to use PersistentService session bean(included in limbo.jar) from web application in lust.war (the limbo.jar & lust.war is not in ear) package ua.co.lust; import ua.co.inferno.limbo.persistence.beans.IPersistentService; import javax.ejb.EJB; import javax.servlet.ServletException; import javax.servlet.annotation.WebServlet; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import java.io.IOException; @WebServlet(name = "ServletTest", urlPatterns = {"/"}) public class ServletTest extends HttpServlet { protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { service(request, response); } protected void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { service(request, response); } @EJB private IPersistentService pService; public void service(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { String hi = pService.getCNPList().toString(); System.out.println("testBean.hello method returned: " + hi); System.out.println("In MyServlet::init()"); System.out.println("all regions" + pService.getRegionsList("ua")); System.out.println("all regions" + pService.getBoxACPList()); } } web.xm <?xml version="1.0" encoding="UTF-8"?> <web-app xmlns="http://java.sun.com/xml/ns/javaee" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://java.sun.com/xml/ns/javaee http://java.sun.com/xml/ns/javaee/web-app_3_0.xsd" version="3.0"> <servlet> <servlet-name>ServletTest</servlet-name> <servlet-class>ua.co.lust.ServletTest</servlet-class> </servlet> </web-app> When servelt is loading i ge 404 eror (The requested resource () is not available.) And errors in logs : global Log Level SEVERE Logger global Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=31} Record Number 1421 Message ID Complete Message Class [ Lua/co/inferno/limbo/persistence/beans/IPersistentService; ] not found. Error while loading [ class ua.co.lust.ServletTest ] javax.enterprise.system.tools.deployment.org.glassfish.deployment.common Log Level WARNING Logger javax.enterprise.system.tools.deployment.org.glassfish.deployment.common Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=31} Record Number 1422 Message ID Error in annotation processing Complete Message java.lang.NoClassDefFoundError: Lua/co/inferno/limbo/persistence/beans/IPersistentService; ejb jar was deployed with this info log : Log Level INFO Logger javax.enterprise.system.container.ejb.com.sun.ejb.containers Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=26} Record Number 1436 Message ID Glassfish-specific (Non-portable) JNDI names for EJB PersistentService Complete Message [ua.co.inferno.limbo.persistence.beans.IPersistentServiceRemote#ua.co.inferno.limbo.persistence.beans.IPersistentServiceRemote, ua.co.inferno.limbo.persistence.beans.IPersistentServiceRemote] Log Level INFO Logger javax.enterprise.system.tools.admin.org.glassfish.deployment.admin Name-Value Pairs {_ThreadName=Thread-1, _ThreadID=26} Record Number 1445 Message ID Complete Message limbo was successfully deployed in 610 milliseconds. Do i nee to add some additional configuration in a case of injections from others application? Some ideas?

    Read the article

  • Logging with log4j on tomcat jruby-rack for a Rails 3 application

    - by John
    I just spent the better part of 3 hours trying to get my Rails application logging with Log4j. I've finally got it working, but I'm not sure if what I did is correct. I tried various methods to no avail until my various last attempt. So I'm really looking for some validation here, perhaps some pointers and tips as well -- anything would be appreciated to be honest. I've summarized all my feeble methods into three attempts below. I'm hoping for some enlightenment on where I went wrong with each attempt -- even if it means I get ripped up. Thanks for the help in advance! System Specs Rails 3.0 Windows Server 2008 Log4j 1.2 Tomact 6.0.29 Java 6 Attempt 1 - Configured Tomcat to Use Log4J I basically followed the guide on the Apache Tomcat website here. The steps are: Create a log4j.properties file in $CATALINA_HOME/lib Download and copy the log4j-x.y.z.jar into $CATALINA_HOME/lib Replace $CATALINA_HOME/bin/tomcat-juli.jar with the tomcat-juli.jar from the Apache Tomcat Extras folder Copy tomcat-juli-adapters.jar from the Apache Tomcat Extras folder into $CATALINA_HOME/lib Delete $CATALINA_BASE/conf/logging.properties Start Tomcat (as a service) Expected Results According to the Guide I should have seen a tomcat.log file in my $CATALINA_BASE/logs folder. Actual Results No tomcat.log Saw three of the standard logs instead jakarta_service_20101231.log stderr_20101231.log stdout_20101231.log Question Shouldn't I have at least seen a tomcat.log file? Attempt 2 - Use default Tomcat logging (commons-logging) Reverted all the changes from the previous setup Modified $CATALINA_BASE/conf/logging.properties by doing the following: Adding a setting for my application in the handlers line: 5rails3.org.apache.juli.FileHandler Adding Handler specific properties 5rails3.org.apache.juli.FileHandler.level = FINE 5rails3.org.apache.juli.FileHandler.directory = ${catalina.base}/logs 5rails3.org.apache.juli.FileHandler.prefix = rails3. Adding Facility specific properties org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].level = INFO org.apache.catalina.core.ContainerBase.[Catalina].[localhost].[/rails3].handlers = 4host-manager.org.apache.juli.FileHandler Modified my web.xml by adding the following context parameter as per the Logging section of the jruby-rack readme (I also modified my warbler.rb accordingly, but I did opted to change the web.xml directly to test things faster). <context-param> <param-name>jruby.rack.logging</param-name> <param-value>commons_logging</param-value> </context-param> Restarted Tomcat Results A log file was created (rails3.log), however there was no log information in the file. Attempt 2A - Use Log4j with existing set up I decided to go Log4j another whirl with this new web.xml setting. Copied the log4j.jar into my WEB-INF/lib folder Created a log4j.properties file and put it into WEB-INF/classes log4j.rootLogger=INFO, R log4j.logger.javax.servlet=DEBUG log4j.appender.R=org.apache.log4j.RollingFileAppender log4j.appender.R.File=${catalina.base}/logs/rails3.log log4j.appender.R.MaxFileSize=5036KB log4j.appender.R.MaxBackupIndex=4 log4j.appender.R.layout=org.apache.log4j.PatternLayout log4j.appender.R.layout.ConversionPattern=%d{dd MMM yyyy HH:mm:ss} [%t] %-5p %c %x - %m%n Restarted Tomcat Results Same as Attempt 2 NOTE: I used log4j.logger.javax.servlet=DEBUG because I read in the jruby-rack README that all logging output is automatically redirected to the javax.servlet.ServletContext#log method. So I though this would capture it. I was obviously wrong. Question Why didn't this work? Isn't Log4J using the commons_logging API? Attempt 3 - Tried out slf4j (WORKED) A bit uncertain as to why Attempt 2A didn't work, I thought to myself, maybe I can't use commons_logging for the jruby.rack.logging parameter because it's probably not using commons_logging API... (but I was still not sure). I saw slf4j as an option. I have never heard of it and by stroke of luck, I decided to look up what it is. After reading briefly about what it does, I thought it was good of a shot as any and decided to try it out following the instructions here. Continuing from the setup of Attempt 2A: Copied slf4j-api-1.6.1.jar and slf4j-simple-1.6.1.jar into my WEB-INF/lib folder I also copied slf4j-log4j12-1.6.1.jar into my WEB-INF/lib folder Restarted Tomcat And VIOLA! I now have logging information going into my rails3.log file. So the big question is: WTF? Even though logging seems to be working now, I'm really not sure if I did this right. So like I said earlier, I'm really looking for some validation more or less. I'd also appreciate any pointers/tips/advice if you have any. Thanks!

    Read the article

  • How do I add the j2ee.jar to a Java2WSDL ant script programmatically?

    - by Marcus
    I am using IBM's Rational Application Developer. I have an ant script that contains the Java2WSDL task. When I run it via IBM, it gives compiler errors unless I include the j2ee.jar file in the classpath via the run tool (it does not pick up the jar files in the classpath in the script). However, I need to be able to call this script programmatically, and it is giving me this error: "java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException" I'm not sure which jars need to be added or where? Since a simple echo script runs, I assume that it is the j2ee.jar or another ant jar that needs to be added. I've added it to the project's buildpath, but that doesn't help. (I also have ant.jar, wsanttasks.jar, all the ant jars from the plugin, tools.jar, remoteAnt.jar, and the swt - all which are included in the buildpath when you run the script by itself.) Script: <?xml version="1.0" encoding="UTF-8"?> <project default="build" basedir="."> <path id="lib.path"> <fileset dir="C:\Program Files\IBM\WebSphere\AppServer\lib" includes="*.jar"/> <!-- Adding these does not help. <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins\org.apache.ant_1.6.5\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\jdk\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70\configuration\org.eclipse.osgi\bundles\1139\1\.cp\lib" includes="*.jar"/> <fileset dir="C:\Program Files\IBM\SDP70Shared\plugins" includes="*.jar"/> --> </path> <taskdef name="java2wsdl" classname="com.ibm.websphere.ant.tasks.Java2WSDL"> <classpath refid="lib.path"/> </taskdef> <target name="build"> <echo message="Beginning build"/> <javac srcdir="C:\J2W_Test\Java2Wsdl_Example" destdir="C:\J2W_Test\Java2Wsdl_Example"> <classpath refid="lib.path"/> <include name="WSExample.java"/> </javac> <echo message="Set up javac"/> <echo message="Running java2wsdl"/> <java2wsdl output="C:\J2W_Test\Java2Wsdl_Example\example\META-INF\wsdl\WSExample.wsdl" classpath="C:\J2W_Test\Java2Wsdl_Example" className= "example.WSExample" namespace="http://example" namespaceImpl="http://example" location="http://localhost:9080/example/services/WSExample" style="document" use="literal"> <mapping namespace="http://example" package="example"/> </java2wsdl> <echo message="Complete"/> </target> </project> Code: File buildFile = new File("build.xml"); Project p = new Project(); p.setUserProperty("ant.file", buildFile.getAbsolutePath()); DefaultLogger consoleLogger = new DefaultLogger(); consoleLogger.setErrorPrintStream(System.err); consoleLogger.setOutputPrintStream(System.out); consoleLogger.setMessageOutputLevel(Project.MSG_INFO); p.addBuildListener(consoleLogger); try { p.fireBuildStarted(); p.init(); ProjectHelper helper = ProjectHelper.getProjectHelper(); p.addReference("ant.projectHelper", helper); helper.parse(p, buildFile); p.executeTarget(p.getDefaultTarget()); p.fireBuildFinished(null); } catch (BuildException e) { p.fireBuildFinished(e); } Error: [java2wsdl] java.lang.NoClassDefFoundError: org.eclipse.core.runtime.CoreException [java2wsdl] at java.lang.J9VMInternals.verifyImpl(Native Method) [java2wsdl] at java.lang.J9VMInternals.verify(J9VMInternals.java:68) [java2wsdl] at java.lang.J9VMInternals.initialize(J9VMInternals.java:129) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getDiscoveredServiceProviders(ServiceProviderManager.java:378) [java2wsdl] at com.ibm.ws.webservices.multiprotocol.discovery.ServiceProviderManager.getAllServiceProviders(ServiceProviderManager.java:214) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.initPluggableBindings(Emitter.java:2704) [java2wsdl] at com.ibm.ws.webservices.wsdl.fromJava.Emitter.<init>(Emitter.java:389) [java2wsdl] at com.ibm.ws.webservices.tools.ant.Java2WSDL.execute(Java2WSDL.java:122) [java2wsdl] at org.apache.tools.ant.UnknownElement.execute(UnknownElement.java:275) [java2wsdl] at org.apache.tools.ant.Task.perform(Task.java:364) [java2wsdl] at org.apache.tools.ant.Target.execute(Target.java:341) [java2wsdl] at org.apache.tools.ant.Target.performTasks(Target.java:369) [java2wsdl] at org.apache.tools.ant.Project.executeSortedTargets(Project.java:1216) [java2wsdl] at org.apache.tools.ant.Project.executeTarget(Project.java:1185) [java2wsdl] at att.ant.RunAnt.main(RunAnt.java:32)

    Read the article

  • Hard to append a table with many records into another without generating duplicates

    - by Bill Mudry
    I may seem to be a bit wordy at first but for the hope it will be easier for all of you to understand what I am doing in the first place. I have an uncommon but enjoyable activity of collecting as many species of wood from around the world as I can (over 2,900 so far). Ok, that is the real world. Meanwhile I have spent over 8 years compiling over 5.8 meg of text data on all the woods of the world. That got so large that learning some basic PHP and MySQL was most welcome so I could build a new database driven home for all this research. I am still slow at it but getting there. The original premise was to find evidence of as many species of woods in the world I can. The more names identified, the more successful the project. I have named the project TAXA for ease of conversation (short for Taxonomy). You are most welcome to take a look at what I have so far at www.prowebcanada.com/taxa. It is 95% dynamically driven. So far I am reporting about 6,500 botanical wood names and, as said above, the more I can report, the more successful is the project. I have a file of all the woods in the second largest wood collection in the world, the Tervuren wood collection in the Netherlands with over 11,300 wood names even after cleaning out all duplicates. That is almost twice the number I am reporting now so porting all the new wood names from Tervuren to the 'species' table where I keep the reported data would be a major desirable advancement in the project. At one point I was able to add all the Tervuren records to the species table but over 3,000 duplicates also formed. They were not in the Tervuren file in the first place but represent the same wood names common to both files. It is common sense that there would be woods common to both that when merged would create new duplicates. At one point and with the help of others from another forum, I may very well have finally got the proper SQL statement. When I ran it, though, the system said (semi-amusingly at first) ----- that it had gone away! After looking up on the Net what could have have done this, one reason is that the MySQL timeout lapses and probably because of the large size of files I am running. I am running this on a rented account on Godaddy so I cannot go about trying to adjust any config file. For safety, I copied the tervuren.sql file as tervuren_target.sql and the species.sql file as species_master.sql tp use as working files just to make sure I protect the original files from destruction or damage. Later I can name the species_master back to just species.sql once I am happy all worked well. The species file has about 18 columns in it but only 5 columns match the columns in the Tervuren file (name for name and collation also). The rest of the columns are just along for the ride, so to speak. The common key in both is the 'species_name" columns in both. I am not sure it is at all proper to call one a primary key and the other a foreign key since there really is no relational connection to them. One is just more data for the other and can disappear after, never to be referred to the working code in the application. I have been very surprised and flabbergasted on how hard it can be to append records from one large table into another (with same column names plus others) without generating NEW duplicates in the first place. Watch out thinking that a SELECT DISTINCT statement may do the job because absolutely NO records in the species table must get destroyed in the process and there is no way (well, that I know of) to tell the 'DISTINCT" command this. Yes, the original 'species' table has duplicates in it even before all this but, trust me ---- they have to be removed the long hard way manually record by record or I will lose precious information. It is more important to just make sure no NEW duplicates form through bringing in new names in the tervuren_target.species_name into species.species_name. I am hoping and thinking that a straight SQL solution should work --- except for that nasty timeout. How do I get past that? Could it mean that I may have to turn to a PHP plus SQL method?? Or ..... would I have to break up the Tervuren files into a few smaller ones and run them independently (hope not....)" So far, what seems should be easy has proven to be unexpectedly tricky. I appreciate any help you can give but start from the assumption that this may be harder to do right than it may seem on the surface. By the way --- I am running a quad 64 bit system with Windows 7, so at least I have some fairly hefty power on the client end. I have a direct ethernet cable feeding a cable connection to the Internet. Once I get an algorithm and code working for this, I also have many other lists to process that could make the 'species' table grow even more. It could be equivalent to (ahem) lighting a rocket under my project (especially compared to do this record by record manually)! This is my first time in this forum, so I do not know how I can receive any replies. Do I have to to come back here periodically or are replies emailed out also? It would be great if you CC'd copies to me at billmudry at rogers.com :-) Much thanks for your patience and help, Bill Mudry Mississauga, Ontario Canada (next to Toronto).

    Read the article

  • How to associate Wi-Fi beacon info with a virtual "location"?

    - by leander
    We have a piece of embedded hardware that will sense 802.11 beacons, and we're using this to make a map of currently visible bssid -> signalStrength. Given this map, we would like to make a determination: Is this likely to be a location I have been to before? If so, what is its ID? If not, I should remember this location: generate a new ID. Now what should I store (and how should I store it) to make future determinations easier? This is for an augmented-reality app/game. We will be using it to associate particular characters and events with "locations". The device does not have internet or cellular access, so using a geolocation service is out of consideration for the time being. (We don't really need to know where we are in reality, just be able to determine if we return there.) It isn't crucial that it be extremely accurate, but it would be nice if it was tolerant to signal strength changes or the occasional missing beacon. It should be usable in relatively low numbers of access points (e.g. rural house with one wireless router) or many (wandering around a dense metropolis). In the case of a city, it should change location every few minutes of walking (continuously-overlapping signals make this a bit more tricky in naive code). A reasonable number of false positives (match a location when we aren't actually there) is acceptable. The wrong character/event showing up just adds a bit of variety. False negatives (no location match) are a bit more troublesome: this will tend to add a better-matching new location to the saved locations, masking the old one. While we will have additional logic to ensure locations that the device hasn't seen in a while will "orphan" any associated characters or events (if e.g. you move to a different country), we'd prefer not to mask and eventually orphan locations you do visit regularly. Some technical complications: signalStrength is returned as 1-4; presumably it's related to dB, but we are not sure exactly how; in my experiments it tends to stick to either 1 or 4, but occasionally we see numbers in between. (Tech docs on the hardware are sparse.) The device completes a scan of one-quarter of the channel space every second; so it takes about 4-5 seconds to get a complete picture of what's around. The list isn't always complete. (We are making strides to fix this using some slight sampling period randomization, as recommended by the library docs. We're also investigating ways to increase the number of scans without killing our performance; the hardware/libs are poorly behaved when it comes to saturating the bus.) We have only kilobytes to store our history. We have a "working" impl now, but it is relatively naive, and flaky in the face of real-world Wi-Fi behavior. Rough pseudocode: // recordLocation() -- only store strength 4 locations m_savedLocations[g_nextId++] = filterForStrengthGE( m_currentAPs, 4 ); // determineLocation() bestPoints = -inf; foreach ( oldLoc in m_savedLocations ) { points = 0.0; foreach ( ap in m_currentAPs ) { if ( oldLoc.has( ap ) ) { switch ( ap.signalStrength ) { case 3: points += 1.0; break; case 4: points += 2.0; break; } } } points /= oldLoc.numAPs; if ( points > bestPoints ) { bestLoc = oldLoc; bestPoints = points; } } if ( bestLoc && bestPoints > 1.0 ) { if ( bestPoints >= (2.0 - epsilon) ) { // near-perfect match. // update location with any new high-strength APs that have appeared bestLoc.addAPs( filterForStrengthGE( m_currentAPs, 4 ) ); } return bestLoc; } else { return NO_MATCH; } We record a location currently only when we have NO_MATCH and the app determines it's time for a new event. (The "near-perfect match" code above would appear to make it harder to match in the future... It's mostly to keep new powerful APs from being associated with other locations, but you'd think we'd need something to counter this if e.g. an AP doesn't show up in the next 10 times I match a location.) I have a feeling that we're missing some things from set theory or graph theory that would assist in grouping/classification of this data, and perhaps providing a better "confidence level" on matches, and better robustness against missed beacons, signal strength changes, and the like. Also it would be useful to have a good method for mutating locations over time. Any useful resources out there for this sort of thing? Simple and/or robust approaches we're missing?

    Read the article

  • Custom validation works in development but not in unit test

    - by Geolev
    I want to validate that at least one of two columns have a value in my model. I found somewhere on the web that I could create a custom validator as follows: # Check for the presence of one or another field: # :validates_presence_of_at_least_one_field :last_name, :company_name - would require either last_name or company_name to be filled in # also works with arrays # :validates_presence_of_at_least_one_field :email, [:name, :address, :city, :state] - would require email or a mailing type address module ActiveRecord module Validations module ClassMethods def validates_presence_of_at_least_one_field(*attr_names) msg = attr_names.collect {|a| a.is_a?(Array) ? " ( #{a.join(", ")} ) " : a.to_s}.join(", ") + "can't all be blank. At least one field must be filled in." configuration = { :on => :save, :message => msg } configuration.update(attr_names.extract_options!) send(validation_method(configuration[:on]), configuration) do |record| found = false attr_names.each do |a| a = [a] unless a.is_a?(Array) found = true a.each do |attr| value = record.respond_to?(attr.to_s) ? record.send(attr.to_s) : record[attr.to_s] found = !value.blank? end break if found end record.errors.add_to_base(configuration[:message]) unless found end end end end end I put this in a file called lib/acs_validator.rb in my project and added "require 'acs_validator'" to my environment.rb. This does exactly what I want. It works perfectly when I manually test it in the development environment but when I write a unit test it breaks my test environment. This is my unit test: require 'test_helper' class CustomerTest < ActiveSupport::TestCase # Replace this with your real tests. test "the truth" do assert true end test "customer not valid" do puts "customer not valid" customer = Customer.new assert !customer.valid? assert customer.errors.invalid?(:subdomain) assert_equal "Company Name and Last Name can't both be blank.", customer.errors.on(:contact_lname) end end This is my model: class Customer < ActiveRecord::Base validates_presence_of :subdomain validates_presence_of_at_least_one_field :customer_company_name, :contact_lname, :message => "Company Name and Last Name can't both be blank." has_one :service_plan end When I run the unit test, I get the following error: DEPRECATION WARNING: Rake tasks in vendor/plugins/admin_data/tasks, vendor/plugins/admin_data/tasks, and vendor/plugins/admin_data/tasks are deprecated. Use lib/tasks instead. (called from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/tasks/rails.rb:10) Couldn't drop acs_test : #<ActiveRecord::StatementInvalid: PGError: ERROR: database "acs_test" is being accessed by other users DETAIL: There are 1 other session(s) using the database. : DROP DATABASE IF EXISTS "acs_test"> acs_test already exists NOTICE: CREATE TABLE will create implicit sequence "customers_id_seq" for serial column "customers.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "customers_pkey" for table "customers" NOTICE: CREATE TABLE will create implicit sequence "service_plans_id_seq" for serial column "service_plans.id" NOTICE: CREATE TABLE / PRIMARY KEY will create implicit index "service_plans_pkey" for table "service_plans" /usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb" "test/unit/customer_test.rb" "test/unit/service_plan_test.rb" "test/unit/helpers/dashboard_helper_test.rb" "test/unit/helpers/customers_helper_test.rb" "test/unit/helpers/service_plans_helper_test.rb" /usr/lib/ruby/gems/1.8/gems/activerecord-2.3.8/lib/active_record/base.rb:1994:in `method_missing_without_paginate': undefined method `validates_presence_of_at_least_one_field' for #<Class:0xb7076bd0> (NoMethodError) from /usr/lib/ruby/gems/1.8/gems/will_paginate-2.3.12/lib/will_paginate/finder.rb:170:in `method_missing' from /home/george/projects/advancedcomfortcs/app/models/customer.rb:3 from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `gem_original_require' from /usr/local/lib/site_ruby/1.8/rubygems/custom_require.rb:31:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:158:in `require' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:265:in `require_or_load' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:224:in `depend_on' from /usr/lib/ruby/gems/1.8/gems/activesupport-2.3.8/lib/active_support/dependencies.rb:136:in `require_dependency' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:414:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:413:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `each' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:411:in `load_application_classes' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:197:in `process' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `send' from /usr/lib/ruby/gems/1.8/gems/rails-2.3.8/lib/initializer.rb:113:in `run' from /home/george/projects/advancedcomfortcs/config/environment.rb:9 from ./test/test_helper.rb:2:in `require' from ./test/test_helper.rb:2 from ./test/unit/customer_test.rb:1:in `require' from ./test/unit/customer_test.rb:1 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `load' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5:in `each' from /usr/lib/ruby/gems/1.8/gems/rake-0.8.7/lib/rake/rake_test_loader.rb:5 rake aborted! Command failed with status (1): [/usr/bin/ruby1.8 -I"lib:test" "/usr/lib/ru...] (See full trace by running task with --trace) It seems to have stepped on will_paginate somehow. Does anyone have any suggestions? Is there another way to do the validation I'm attempting to do? Thanks, George

    Read the article

  • Moving the swapfiles to a dedicated partition in Snow Leopard

    - by e.James
    I have been able to move Apple's virtual memory swapfiles to a dedicated partition on my hard drive up until now. The technique I have been using is described in a thread on forums.macosxhints.com. However, with the developer preview of Snow Leopard, this method no longer works. Does anyone know how it could be done with the new OS? Update: I have marked dblu's answer as accepted even though it didn't quite work because he gave excellent, detailed instructions and because his suggestion to use plutil ultimately pointed me in the right direction. The complete, working solution is posted here in the question because I don't have enough reputation to edit the accepted answer. Complete solution: 1. Open Terminal and make a backup copy of Apple's default dynamic_pager.plist: $ cd /System/Library/LaunchDaemons $ sudo cp com.apple.dynamic_pager.plist{,_bak} 2. Convert the plist from binary to plain XML: $ sudo plutil -convert xml1 com.apple.dynamic_pager.plist 3. Open the converted plist with your text editor of choice. (I use pico, see dblu's answer for an example using vim): $ sudo pico -w com.apple.dynamic_pager.plist It should look as follows: <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs$ <plist version="1.0"> <dict> <key>EnableTransactions</key> <true/> <key>HopefullyExitsLast</key> <true/> <key>Label</key> <string>com.apple.dynamic_pager</string> <key>OnDemand</key> <false/> <key>ProgramArguments</key> <array> <string>/sbin/dynamic_pager</string> <string>-F</string> <string>/private/var/vm/swapfile</string> </array> </dict> </plist> 4. Change the ProgramArguments array (lines 13 through 18) so that it launches an intermediate shell script instead of launching dynamic_pager directly. See note #1 for details on why this is necessary. <key>ProgramArguments</key> <array> <string>/sbin/dynamic_pager_init</string> </array> 5. Save the plist, and return to the terminal prompt. Using pico, the commands would be: <ctrl+o> to save the file <enter> to accept the same filename (com.apple.dynamic_pager.plist) <ctrl+x> to exit 6. Convert the modified plist back to binary: $ sudo plutil -convert binary1 com.apple.dynamic_pager.plist 7. Create the intermediate shell script: $ cd /sbin $ sudo pico -w dynamic_pager_init The script should look as follows (my partition is called 'Swap', and I chose to put the swapfiles in a hidden directory on that partition, called '.vm' be sure that the directory you specify actually exists): Update: This version of the script makes use of wait4path as suggested by ZILjr: #!/bin/bash #launch Apple's dynamic_pager only when the swap volume is mounted echo "Waiting for Swap volume to mount"; wait4path /Volumes/Swap; echo "Launching dynamic pager on volume Swap"; /sbin/dynamic_pager -F /Volumes/Swap/.vm/swapfile; 8. Save and close dynamic_pager_init (same commands as step 5) 9. Modify permissions and ownership for dynamic_pager_init: $ sudo chmod a+x-w /sbin/dynamic_pager_init $ sudo chown root:wheel /sbin/dynamic_pager_init 10. Verify the permissions on dynamic_pager_init: $ ls -l dynamic_pager_init -r-xr-xr-x 1 root wheel 6 18 Sep 15:11 dynamic_pager_init 11. Restart your Mac. If you run into trouble, switch to verbose startup mode by holding down Command-v immediately after the startup chime. This will let you see all of the startup messages that appear during startup. If you run into even worse trouble (i.e. you never see the login screen), hold down Command-s instead. This will boot the computer in single-user mode (no graphical UI, just a command prompt) and allow you to restore the backup copy of com.apple.dynamic_pager.plist that you made in step 1. 12. Once the computer boots, fire up Terminal and verify that the swap files have actually been moved: $ cd /Volumes/Swap/.vm $ ls -l You should see something like this: -rw------- 1 someUser staff 67108864 18 Sep 12:02 swapfile0 13. Delete the old swapfiles: $ cd /private/var/vm $ sudo rm swapfile* 14. Profit! Note 1 Simply modifying the arguments to dynamic_pager in the plist does not always work, and when it fails, it does so in a spectacularly silent way. The problem stems from the fact that dynamic_pager is launched very early in the startup process. If your swap partition has not yet been mounted when dynamic_pager is first loaded (in my experience, this happens 99% of the time), then the system will fake its way through. It will create a symbolic link in your /Volumes directory which has the same name as your swap partition, but points back to the default swapfile location (/private/var/vm). Then, when your actual swap partition mounts, it will be given the name Swap 1 (or YourDriveName 1). You can see the problem by opening up Terminal and listing the contents of your /Volumes directory: $ cd /Volumes $ ls -l You will see something like this: drwxrwxrwx 11 yourUser staff 442 16 Sep 12:13 Swap -> private/var/vm drwxrwxrwx 14 yourUser staff 5 16 Sep 12:13 Swap 1 lrwxr-xr-x 1 root admin 1 17 Sep 12:01 System -> / Note that this failure can be very hard to spot. If you were to check for the swapfiles as I show in step 12, you would still see them! The symbolic link would make it seem as though your swapfiles had been moved, even though they were actually being stored in the default location. Note 2 I was originally unable to get this to work in Snow Leopard because com.apple.dynamic_pager.plist was stored in binary format. I made a copy of the original file and opened it with Apple's Property List Editor (available with Xcode) in order to make changes, but this process added some extended attributes to the plist file which caused the system to ignore it and just use the defaults. As dblu pointed out, using plutil to convert the file to plain XML works like a charm. Note 3 You can check the Console application to see any messages that dynamic_pager_init echos to the screen. If you see the following lines repeated over and over again, there is a problem with the setup. I ran into these messages because I forgot to create the '.vm' directory that I specified in dynamic_pager_init. com.apple.launchd[1] (com.apple.dynamic_pager[176]) Exited with exit code: 1 com.apple.launchd[1] (com.apple.dynamic_pager) Throttling respawn: Will start in 10 seconds When everything is working properly, you may see the above message a couple of times, but you should also see the following message, and then no more of the "Throttling respawn" messages afterwards. com.apple.dynamic_pager[???] Launching dynamic pager on volume Swap This means that the script did have to wait for the partition to load, but in the end it was successful.

    Read the article

  • post image and other data using mulipart form data in iphone

    - by abdulsamad
    Hi all I am sending some data and and an image to the server using multipart/form-data in objective C. kindly give me some Php code that how can i save the image on the server i am able to get the other variables on the server that i am passing with the image. kindly see my obj C code and php and tell me where i am wrong. your help will be highly appreciated. here i make the POST request. ////////////////////// NSString *stringBoundary, *contentType, *baseURLString, *urlString; NSData *imageData; NSURL *url; NSMutableURLRequest *urlRequest; NSMutableData *postBody; // Create POST request from message, imageData, username and password baseURLString = @"http://localhost:8888/Test.php"; urlString = [NSString stringWithFormat:@"%@", baseURLString]; url = [NSURL URLWithString:urlString]; urlRequest = [[[NSMutableURLRequest alloc] initWithURL:url] autorelease]; [urlRequest setHTTPMethod:@"POST"]; // Set the params NSString *path = [[NSBundle mainBundle] pathForResource:@"LibraryIcon" ofType:@"png"]; imageData = [[NSData alloc] initWithContentsOfFile:path]; // Setup POST body stringBoundary = [NSString stringWithString:@"0xKhTmLbOuNdArY"]; contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@", stringBoundary]; [urlRequest addValue:contentType forHTTPHeaderField:@"Content-Type"]; // Setting up the POST request's multipart/form-data body postBody = [NSMutableData data]; [postBody appendData:[[NSString stringWithFormat:@"\r\n\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"source\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"lighttable"] dataUsingEncoding:NSUTF8StringEncoding]]; // So Light Table show up as source in Twitter post [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"title\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:book.title] dataUsingEncoding:NSUTF8StringEncoding]]; // title [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"isbn\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:book.isbn] dataUsingEncoding:NSUTF8StringEncoding]]; // isbn [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"price\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:txtPrice.text] dataUsingEncoding:NSUTF8StringEncoding]]; // Price [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:@"Content-Disposition: form-data; name=\"condition\"\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithString:txtCondition.text] dataUsingEncoding:NSUTF8StringEncoding]]; // Price NSString *imageFileName = [NSString stringWithFormat:@"photo.jpeg"]; [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"upload\"; filename=\"%@\"\r\n",imageFileName] dataUsingEncoding:NSUTF8StringEncoding]]; //[postBody appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"upload\"\r\n\n\n"]dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:[@"Content-Type: image/jpeg\r\n\r\n" dataUsingEncoding:NSUTF8StringEncoding]]; [postBody appendData:imageData]; [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; // [postBody appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n", stringBoundary] dataUsingEncoding:NSUTF8StringEncoding]]; NSLog(@"postBody=%@", [[NSString alloc] initWithData:postBody encoding:NSASCIIStringEncoding]); [urlRequest setHTTPBody:postBody]; NSLog(@"Image data=%@",[[NSString alloc] initWithData:imageData encoding:NSASCIIStringEncoding]); // Spawn a new thread so the UI isn't blocked while we're uploading the image [NSThread detachNewThreadSelector:@selector(uploadingDataWithURLRequest:) toTarget:self withObject:urlRequest]; I the method uploadingDataWithURLRequest i post the request to the server... Here is my php Code ?php $title = $_POST['title']; $isbn = $_POST['isbn']; $price = $_POST['price']; $condition = $_POST['condition']; $image=$_FILES['image']['name']; if($image) { $filename = 'newimage.jpeg'; file_put_contents($filename, $image); echo "image is there"; } else { echo "image is nil"; } ?> I am unable to get the image on server kindly help me where i am wrong.

    Read the article

  • Sorting/Paginating/Filtering Complex Multi-AR Object Tables in Rails

    - by Matt Rogish
    I have a complex table pulled from a multi-ActiveRecord object array. This listing is a combined display of all of a particular user's "favorite" items (songs, messages, blog postings, whatever). Each of these items is a full-fledged AR object. My goal is to present the user with a simplified search, sort, and pagination interface. The user need not know that the Song has a singer, and that the Message has an author -- to the end user both entries in the table will be displayed as "User". Thus, the search box will simply be a dropdown list asking them which to search on (User name, created at, etc.). Internally, I would need to convert that to the appropriate object search, combine the results, and display. I can, separately, do pagination (mislav will_paginate), sorting, and filtering, but together I'm having some problems combining them. For example, if I paginate the combined list of items, the pagination plugin handles it just fine. It is not efficient since the pagination is happening in the app vs. the DB, but let's assume the intended use-case would indicate the vast majority of the users will have less than 30 favorited items and all other behavior, server capabilities, etc. indicates this will not be a bottleneck. However, if I wish to sort the list I cannot sort it via the pagination plugin because it relies on the assumption that the result set is derived from a single SQL query, and also that the field name is consistent throughout. Thus, I must sort the merged array via ruby, e.g. @items.sort_by{ |i| i.whatever } But, since the items do not share common names, I must first interrogate the object and then call the correct sort by. For example, if the user wishes to sort by user name, if the sorted object is a message, I sort by author but if the object is a song, I sort by singer. This is all very gross and feels quite un-ruby-like. This same problem comes into play with the filter. If the user filters on the "parent item" (the message's thread, the song's album), I must translate that to the appropriate collection object method. Also gross. This is not the exact set-up but is close enough. Note that this is a legacy app so changing it is quite difficult, although not impossible. Also, yes there is some DRY that can be done, but don't focus on the style or elegance of the following code. Style/elegance of the SOLUTION is important, however! :D models: class User < ActiveRecord::Base ... has_and_belongs_to_many :favorite_messages, :class_name => "Message" has_and_belongs_to_many :favorite_songs, :class_name => "Song" has_many :authored_messages, :class_name => "Message" has_many :sung_songs, :class_name => "Song" end class Message < ActiveRecord::Base has_and_belongs_to_many :favorite_messages belongs_to :author, :class_name => "User" belongs_to :thread end class Song < ActiveRecord::Base has_and_belongs_to_many :favorite_songs belongs_to :singer, :class_name => "User" belongs_to :album end controller: def show u = User.find 123 @items = Array.new @items << u.favorite_messages @items << u.favorite_songs # etc. etc. @items.flatten! @items = @items.sort_by{ |i| i.created_at } @items = @items.paginate :page => params[:page], :per_page => 20 end def search # Assume user is searching for username like 'Bob' u = User.find 123 @items = Array.new @items << u.favorite_messages.find( :all, :conditions => "LOWER( author ) LIKE LOWER('%bob%')" ) @items << u.favorite_songs.find( :all, :conditions => "LOWER( singer ) LIKE ... " ) # etc. etc. @items.flatten! @items = @items.sort_by{ |i| determine appropriate sorting based on user selection } @items = @items.paginate :page => params[:page], :per_page => 20 end view: #index.html.erb ... <table> <tr> <th>Title (sort ASC/DESC links)</th> <th>Created By (sort ASC/DESC links))</th> <th>Collection Title (sort ASC/DESC links)</th> <th>Created At (sort ASC/DESC links)</th> </tr> <% @items.each |item| do %> <%= render { :partial => "message", :locals => item } if item.is_a? Message %> <%= render { :partial => "song", :locals => item } if item.is_a? Song %> <%end%> ... </table> #message.html.erb # shorthand, not real ruby print out message title, author name, thread title, message created at #song.html.erb # shorthand print out song title, singer name, album title, song created at

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • jQuery templates - Load another template within a template (composite)

    - by Saxman
    I'm following this post by Dave Ward (http://encosia.com/2010/12/02/jquery-templates-composite-rendering-and-remote-loading/) to load a composite templates for a Blog, where I have a total of 3 small templates (all in one file) for a blog post. In the template file, I have these 3 templates: blogTemplate, where I render the "postTemplate" Inside the "postTemplate", I would like to render another template that displays comments, I called this "commentsTemplate" the "commentsTemplate" Here's the structure of my json data: blog Title Content PostedDate Comments (a collection of comments) CommentContents CommentedBy CommentedDate For now, I was able to render the Post content using the code below: Javascript $(document).ready(function () { $.get('/GetPost', function (data) { $.get('/Content/Templates/_postWithComments.tmpl.htm', function (templates) { $('body').append(templates); $('#blogTemplate').tmpl(data).appendTo('#blogPost'); }); }); }); Templates <!--Blog Container Templates--> <script id="blogTemplate" type="x-jquery-tmpl"> <div class="latestPost"> {{tmpl() '#postTemplate'}} </div> </script> <!--Post Item Container--> <script id="postTemplate" type="x-jquery-tmpl"> <h2> ${Title}</h2> <div class="entryHead"> Posted in <a class="category" rel="#">Design</a> on ${PostedDateString} <a class="comments" rel="#">${NumberOfComments} Comments</a></div> ${Content} <div class="tags"> {{if Tags.length}} <strong>Tags:</strong> {{each(i, tag) Tags}} <a class="tag" href="/blog/tags/{{= tag.Name}}"> {{= tag.Name}}</a> {{/each}} <a class="share" rel="#"><strong>TELL A FRIEND</strong></a> <a class="share twitter" rel="#">Twitter</a> <a class="share facebook" rel="#">Facebook</a> {{/if}} </div> <!-- close .tags --> <!-- end Entry 01 --> {{if Comments.length}} {{each(i, comment) Comments}} {{tmpl() '#commentTemplate'}} {{/each}} {{/if}} <div class="lineHor"> </div> </script> <!--Comment Items Container--> <script id="commentTemplate" type="x-jquery-tmpl"> <h4> Comments</h4> &nbsp; <!-- COMMENT --> <div id="authorComment1"> <div id="gravatar1" class="grid_2"> <!--<img src="images/gravatar.png" alt="" />--> </div> <!-- close #gravatar --> <div id="commentText1"> <span class="replyHead">by<a class="author" rel="#">${= comment.CommentedBy}</a>on today</span> <p> {{= comment.CommentContents}}</p> </div> <!-- close #commentText --> <div id="quote1"> <a class="quote" rel="#"><strong>Quote this Comment</strong></a> </div> <!-- close #quote --> </div> <!-- close #authorComment --> <!-- END COMMENT --> </script> Where I'm having problem is at the {{each(i, comment) Comments}} {{tmpl() '#commentTemplate'}} {{/each}} Update - Example Json data when GetPost method is called { Id: 1, Title: "Test Blog", Content: "This is a test post asdf asdf asdf asdf asdf", PostedDateString: "2010-12-20", - Comments: [ - { Id: 1, PostId: 1, CommentContents: "Test comments # 1, asdf asdf asdf", PostedBy: "User 1", CommentedDate: "2010-12-20" }, - { Id: 2, PostId: 1, CommentContents: "Test comments # 2, ghjk gjjk gjkk", PostedBy: "User 2", CommentedDate: "2010-12-21" } ] } I've tried passing in {{tmpl(comment) ..., {{tmpl(Comments) ..., or leave {{tmpl() ... but none seems to work. I don't know how to iterate over the Comments collection and pass that object into the commentsTemplate. Any suggestions? Thank you very much.

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Passing a comparator syntax help in Java

    - by Crystal
    I've tried this a couple ways, the first is have a class that implements comparator at the bottom of the following code. When I try to pass the comparat in sortListByLastName, I get a constructor not found error and I am not sure why import java.util.*; public class OrganizeThis implements WhoDoneIt { /** Add a person to the organizer @param p A person object */ public void add(Person p) { staff.put(p.getEmail(), p); //System.out.println("Person " + p + "added"); } /** * Remove a Person from the organizer. * * @param email The email of the person to be removed. */ public void remove(String email) { staff.remove(email); } /** * Remove all contacts from the organizer. * */ public void empty() { staff.clear(); } /** * Find the person stored in the organizer with the email address. * Note, each person will have a unique email address. * * @param email The person email address you are looking for. * */ public Person findByEmail(String email) { Person aPerson = staff.get(email); return aPerson; } /** * Find all persons stored in the organizer with the same last name. * Note, there can be multiple persons with the same last name. * * @param lastName The last name of the persons your are looking for. * */ public Person[] find(String lastName) { ArrayList<Person> names = new ArrayList<Person>(); for (Person s : staff.values()) { if (s.getLastName() == lastName) { names.add(s); } } // Convert ArrayList back to Array Person nameArray[] = new Person[names.size()]; names.toArray(nameArray); return nameArray; } /** * Return all the contact from the orgnizer in * an array sorted by last name. * * @return An array of Person objects. * */ public Person[] getSortedListByLastName() { PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(comp); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; } private Map<String, Person> staff = new HashMap<String, Person>(); public static void main(String[] args) { OrganizeThis testObj = new OrganizeThis(); Person person1 = new Person("J", "W", "111-222-3333", "[email protected]"); Person person2 = new Person("K", "W", "345-678-9999", "[email protected]"); Person person3 = new Person("Phoebe", "Wang", "322-111-3333", "[email protected]"); Person person4 = new Person("Nermal", "Johnson", "322-342-5555", "[email protected]"); Person person5 = new Person("Apple", "Banana", "123-456-1111", "[email protected]"); testObj.add(person1); testObj.add(person2); testObj.add(person3); testObj.add(person4); testObj.add(person5); System.out.println(testObj.findByEmail("[email protected]")); System.out.println("------------" + '\n'); Person a[] = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("------------" + '\n'); a = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("SORTED" + '\n'); a = testObj.getSortedListByLastName(); for (Person b : a) { System.out.println(b); } System.out.println(testObj.getAuthor()); } } class PersonLastNameComparator implements Comparator<Person> { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } } And then when I tried doing it by creating an anonymous inner class, I also get a constructor TreeMap cannot find symbol error. Any thoughts? inner class method: public Person[] getSortedListByLastName() { //PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(new Comparator<Person>() { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } }); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; }

    Read the article

  • Opacity in CSS, some doubts

    - by André
    Hi, I have some doubts with opacity in CSS. I have a Header and a Footer that uses opacity, but I would like to turn off opacity the opacity in the text. Is that possible? To a better understanding I will post the code. <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title> stu nicholls | CSS PLaY | cross browser fixed header/footer layout basic method </title> <style type="text/css" media="screen"> #printhead {display:none;} html { height:100%; max-height:100%; padding:0; margin:0; border:0; background:#fff; font-size:80%; font-family: "trebuchet ms", tahoma, verdana, arial, sans-serif; /* hide overflow:hidden from IE5/Mac */ /* \*/ overflow: hidden; /* */ } body {height:100%; max-height:100%; overflow:hidden; padding:0; margin:0; border:0;} #content {display:block; height:100%; max-height:100%; overflow:hidden; padding-left:0px; position:relative; z-index:3; word-wrap:break-word;} #head {position:absolute; margin:0; top:0; right:18px; display:block; width:100%; height:1; background-color:transparent; font-size:1em; z-index:5; color:#000; border-bottom:1px solid #000;} #foot {position:absolute; margin:0; bottom:-1px; right:18px; display:block; width:100%; height:30px; background-color:transparent; color:#000; text-align:right; font-size:2em; z-index:4; border-top:1px solid #000;} .pad1 {display:block; width:18px; height:18px; float:left;} /* Com este "height", alinho a border do header */ .pad2 {display:block; height:100px;} .pad3 {display:block; height:0px;} /* Com este "height" controlo onde começa o content e o scroll do browser */ #content p {padding:5px;} .bold {font-size:1.2em; font-weight:bold;} .red {color:#c00; margin-left:5px; font-family:"trebuchet ms", "trebuchet", "verdana", sans-serif;} h2 {margin-left:5px;} h3 {margin-left:5px;} /* Esta classe controla as caracteristicas do background do footer e do header. */ .bkg { background-color: blue; filter:alpha(opacity=35); /* IE's opacity*/ opacity: 0.35; height: 10; } iframe { border-style: none; width: 100%; height: 100%; } </style> </head> <body> <div id="head"> <div class="bkg"> <div class="pad1"></div>Header </div> </div> <div id="content"> <div class="pad3"></div> <iframe src="http://www.yahoo.com" id="iFrame"></iframe> <div class="pad2"></div> </div> </div> <div id="foot"><div class="bkg">Footer</div></div> </body> </html> I want to maintain the opacity in the blue color in the footer and header but I would like to put the text stronger. Is that possible? Best Regards,

    Read the article

  • Retrieving XML node from a path specified in an attribute value of another node

    - by Olivier PAYEN
    From this XML source : <?xml version="1.0" encoding="utf-8" ?> <ROOT> <STRUCT> <COL order="1" nodeName="FOO/BAR" colName="Foo Bar" /> <COL order="2" nodeName="FIZZ" colName="Fizz" /> </STRUCT> <DATASET> <DATA> <FIZZ>testFizz</FIZZ> <FOO> <BAR>testBar</BAR> <LIB>testLib</LIB> </FOO> </DATA> <DATA> <FIZZ>testFizz2</FIZZ> <FOO> <BAR>testBar2</BAR> <LIB>testLib2</LIB> </FOO> </DATA> </DATASET> </ROOT> I want to generate this HTML : <html> <head> <title>Test</title> </head> <body> <table border="1"> <tr> <td>Foo Bar</td> <td>Fizz</td> </tr> <tr> <td>testBar</td> <td>testFizz</td> </tr> <tr> <td>testBar2</td> <td>testFizz2</td> </tr> </table> </body> </html> Here is the XSLT I currently have : <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform" xmlns:msxsl="urn:schemas-microsoft-com:xslt" exclude-result-prefixes="msxsl"> <xsl:output method="html" indent="yes"/> <xsl:template match="/ROOT"> <html> <head> <title>Test</title> </head> <body> <table border="1"> <tr> <!--Generate the table header--> <xsl:apply-templates select="STRUCT/COL"> <xsl:sort data-type="number" select="@order"/> </xsl:apply-templates> </tr> <xsl:apply-templates select="DATASET/DATA" /> </table> </body> </html> </xsl:template> <xsl:template match="COL"> <!--Template for generating the table header--> <td> <xsl:value-of select="@colName"/> </td> </xsl:template> <xsl:template match="DATA"> <xsl:variable name="pos" select="position()" /> <tr> <xsl:for-each select="/ROOT/STRUCT/COL"> <xsl:sort data-type="number" select="@order"/> <xsl:variable name="elementName" select="@nodeName" /> <td> <xsl:value-of select="/ROOT/DATASET/DATA[$pos]/*[name() = $elementName]" /> </td> </xsl:for-each> </tr> </xsl:template> </xsl:stylesheet> It almost works, the problem I have is to retrieve the correct DATA node from the path specified in the "nodeName" attribute value of the STRUCT block.

    Read the article

  • PHP: Strange behaviour while calling custom php functions

    - by baltusaj
    I am facing a strange behavior while coding in PHP with Flex. Let me explain the situation: I have two funcions lets say: populateTable() //puts some data in a table made with flex createXML() //creates an xml file which is used by Fusion Charts to create a chart Now, if i call populateTable() alone, the table gets populated with data but if i call it with createXML(), the table doesn't get populated but createXML() does it's work i.e. creates an xml file. Even if i run following code, only xml file gets generated but table remains empty whereas i called populateTable() before createXML(). Any idea what may be going wrong? MXML Part <mx:HTTPService id="userRequest" url="request.php" method="POST" resultFormat="e4x"> <mx:request xmlns=""> <getResult>send</getResult> </mx:request> and <mx:DataGrid id="dgUserRequest" dataProvider="{userRequest.lastResult.user}" x="28.5" y="36" width="525" height="250" > <mx:columns> <mx:DataGridColumn headerText="No." dataField="no" /> <mx:DataGridColumn headerText="Name" dataField="name"/> <mx:DataGridColumn headerText="Age" dataField="age"/> </mx:columns> PHP Part <?php //-------------------------------------------------------------------------- function initialize($username,$password,$database) //-------------------------------------------------------------------------- { # Connect to the database $link = mysql_connect("localhost", $username,$password); if (!$link) { die('Could not connected to the database : ' . mysql_error()); } # Select the database $db_selected = mysql_select_db($database, $link); if (!$db_selected) { die ('Could not select the DB : ' . mysql_error()); } // populateTable(); createXML(); # Close database connection } //-------------------------------------------------------------------------- populateTable() //-------------------------------------------------------------------------- { if($_POST['getResult'] == 'send') { $Result = mysql_query("SELECT * FROM session" ); $Return = "<Users>"; $no = 1; while ( $row = mysql_fetch_object( $Result ) ) { $Return .= "<user><no>".$no."</no><name>".$row->name."</name><age>".$row->age."</age><salary>". $row->salary."</salary></session>"; $no=$no+1; $Return .= "</Users>"; mysql_free_result( $Result ); print ($Return); } //-------------------------------------------------------------------------- createXML() //-------------------------------------------------------------------------- { $users=array ( "0"=>array("",0), "1"=>array("Obama",0), "2"=>array("Zardari",0), "3"=>array("Imran Khan",0), "4"=>array("Ahmadenijad",0) ); $selectedUsers=array(1,4); //this means only obama and ahmadenijad are selected and the xml file will contain info related to them only //Extracting salaries of selected users $size=count($users); for($i = 0; $i<$size; $i++) { //initialize temp which will calculate total throughput for each protocol separately $salary = 0; $result = mysql_query("SELECT salary FROM userInfo where name='$users[$selectedUsers[$i]][0]'"); $row = mysql_fetch_array($result)) $salary = $row['salary']; } $users[$selectedUsers[$i]][1]=$salary; } //creating XML string $chartContent = "<chart caption=\"Users Vs Salaries\" formatNumberScale=\"0\" pieSliceDepth=\"30\" startingAngle=\"125\">"; for($i=0;$i<$size;$i++) { $chartContent .= "<set label=\"".$users[$selectedUsers[$i]][0]."\" value=\"".$users[$selectedUsers[$i]][1]."\"/>"; } $chartContent .= "<styles>" . "<definition>" . "<style type=\"font\" name=\"CaptionFont\" size=\"16\" color=\"666666\"/>" . "<style type=\"font\" name=\"SubCaptionFont\" bold=\"0\"/>" . "</definition>" . "<application>" . "<apply toObject=\"caption\" styles=\"CaptionFont\"/>" . "<apply toObject=\"SubCaption\" styles=\"SubCaptionFont\"/>" . "</application>" . "</styles>" . "</chart>"; $file_handle = fopen('ChartData.xml','w'); fwrite($file_handle,$chartContent); fclose($file_handle); } initialize("root","","hiddenpeak"); ?>

    Read the article

  • rsync over ssh is not working anymore, while ssh itself is working fine (Write failed: broken pipe)

    - by brazorf
    This issue started happening after i changed router. This is the scenario: Windows7 Host Ubuntu 10.04 Guest (VirtualBox) Ubuntu 10.04 remote server What i used to do is run a very basic rsync command: rsync -avz --delete /local/path/ username@host:/path/to/remote/directory This worked perfect until i did change adsl provider, and i changed router aswell: now, this happens: rsync on Ubuntu Guest is not working anymore (to any random server), if using this new router rsync on Ubuntu Guest is WORKING, if i switch back to old router i tried a new virtual box ubuntu install, and the command is WORKING with both the routers So, the not-working-combo is oldUbuntu + newRouter. To get things worst, i can state that (on the not-working ubuntu) i ping the remote host plain ssh connection to the remote host is working fine (i can auth, connect, and do stuff on the remote host) scp is NOT working (this is just a further thing i tried) This is the console output of the execution, with ssh verbose set to vvvv: root@client:~# rsync -ae 'ssh -vvvv' /root/test-rsync/ {username}@{hostname}:/home/{username}/test/ OpenSSH_5.3p1 Debian-3ubuntu7, OpenSSL 0.9.8k 25 Mar 2009 debug1: Reading configuration data /root/.ssh/config debug1: Applying options for {hostname} debug1: Reading configuration data /etc/ssh/ssh_config debug1: Applying options for * debug2: ssh_connect: needpriv 0 debug1: Connecting to {hostname} [{ip.add.re.ss}] port 22. debug1: Connection established. debug1: permanently_set_uid: 0/0 debug3: Not a RSA1 key file /root/.ssh/{private_key}. debug2: key_type_from_name: unknown key type '-----BEGIN' debug3: key_read: missing keytype debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug3: key_read: missing whitespace debug2: key_type_from_name: unknown key type '-----END' debug3: key_read: missing keytype debug1: identity file /root/.ssh/{private_key} type 1 debug1: Checking blacklist file /usr/share/ssh/blacklist.RSA-2048 debug1: Checking blacklist file /etc/ssh/blacklist.RSA-2048 debug1: Remote protocol version 2.0, remote software version OpenSSH_5.3p1 Debian-3ubuntu7 debug1: match: OpenSSH_5.3p1 Debian-3ubuntu7 pat OpenSSH* debug1: Enabling compatibility mode for protocol 2.0 debug1: Local version string SSH-2.0-OpenSSH_5.3p1 Debian-3ubuntu7 debug2: fd 3 setting O_NONBLOCK debug1: SSH2_MSG_KEXINIT sent debug3: Wrote 792 bytes for a total of 831 debug1: SSH2_MSG_KEXINIT received debug2: kex_parse_kexinit: diffie-hellman-group-exchange-sha256,diffie-hellman-group-exchange-sha1,diffie-hellman-group14-sha1,diffie-hellman-group1-sha1 debug2: kex_parse_kexinit: ssh-rsa,ssh-dss debug2: kex_parse_kexinit: aes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,[email protected] debug2: kex_parse_kexinit: aes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,[email protected] debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: [email protected],zlib,none debug2: kex_parse_kexinit: [email protected],zlib,none debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: first_kex_follows 0 debug2: kex_parse_kexinit: reserved 0 debug2: kex_parse_kexinit: diffie-hellman-group-exchange-sha256,diffie-hellman-group-exchange-sha1,diffie-hellman-group14-sha1,diffie-hellman-group1-sha1 debug2: kex_parse_kexinit: ssh-rsa,ssh-dss debug2: kex_parse_kexinit: aes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,[email protected] debug2: kex_parse_kexinit: aes128-ctr,aes192-ctr,aes256-ctr,arcfour256,arcfour128,aes128-cbc,3des-cbc,blowfish-cbc,cast128-cbc,aes192-cbc,aes256-cbc,arcfour,[email protected] debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: hmac-md5,hmac-sha1,[email protected],hmac-ripemd160,[email protected],hmac-sha1-96,hmac-md5-96 debug2: kex_parse_kexinit: none,[email protected] debug2: kex_parse_kexinit: none,[email protected] debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: debug2: kex_parse_kexinit: first_kex_follows 0 debug2: kex_parse_kexinit: reserved 0 debug2: mac_setup: found hmac-md5 debug1: kex: server->client aes128-ctr hmac-md5 [email protected] debug2: mac_setup: found hmac-md5 debug1: kex: client->server aes128-ctr hmac-md5 [email protected] debug1: SSH2_MSG_KEX_DH_GEX_REQUEST(1024<1024<8192) sent debug1: expecting SSH2_MSG_KEX_DH_GEX_GROUP debug3: Wrote 24 bytes for a total of 855 debug2: dh_gen_key: priv key bits set: 125/256 debug2: bits set: 525/1024 debug1: SSH2_MSG_KEX_DH_GEX_INIT sent debug1: expecting SSH2_MSG_KEX_DH_GEX_REPLY debug3: Wrote 144 bytes for a total of 999 debug3: check_host_in_hostfile: filename /root/.ssh/known_hosts debug3: check_host_in_hostfile: match line 4 debug3: check_host_in_hostfile: filename /root/.ssh/known_hosts debug3: check_host_in_hostfile: match line 5 debug1: Host '{hostname}' is known and matches the RSA host key. debug1: Found key in /root/.ssh/known_hosts:4 debug2: bits set: 512/1024 debug1: ssh_rsa_verify: signature correct debug2: kex_derive_keys debug2: set_newkeys: mode 1 debug1: SSH2_MSG_NEWKEYS sent debug1: expecting SSH2_MSG_NEWKEYS debug3: Wrote 16 bytes for a total of 1015 debug2: set_newkeys: mode 0 debug1: SSH2_MSG_NEWKEYS received debug1: SSH2_MSG_SERVICE_REQUEST sent debug3: Wrote 48 bytes for a total of 1063 debug2: service_accept: ssh-userauth debug1: SSH2_MSG_SERVICE_ACCEPT received debug2: key: /root/.ssh/{private_key} (0x7f3ad0e7f9b0) debug3: Wrote 80 bytes for a total of 1143 debug1: Authentications that can continue: publickey,password debug3: start over, passed a different list publickey,password debug3: preferred gssapi-keyex,gssapi-with-mic,gssapi,publickey,keyboard-interactive,password debug3: authmethod_lookup publickey debug3: remaining preferred: keyboard-interactive,password debug3: authmethod_is_enabled publickey debug1: Next authentication method: publickey debug1: Offering public key: /root/.ssh/{private_key} debug3: send_pubkey_test debug2: we sent a publickey packet, wait for reply debug3: Wrote 368 bytes for a total of 1511 debug1: Server accepts key: pkalg ssh-rsa blen 277 debug2: input_userauth_pk_ok: fp 1b:65:36:92:59:b3:12:3e:8c:c6:03:28:d4:81:09:dc debug3: sign_and_send_pubkey debug1: read PEM private key done: type RSA debug3: Wrote 656 bytes for a total of 2167 debug1: Enabling compression at level 6. debug1: Authentication succeeded (publickey). debug2: fd 4 setting O_NONBLOCK debug3: fd 5 is O_NONBLOCK debug1: channel 0: new [client-session] debug3: ssh_session2_open: channel_new: 0 debug2: channel 0: send open debug1: Requesting [email protected] debug1: Entering interactive session. debug3: Wrote 112 bytes for a total of 2279 debug2: callback start debug2: client_session2_setup: id 0 debug1: Sending environment. debug3: Ignored env TERM debug3: Ignored env SHELL debug3: Ignored env SSH_CLIENT debug3: Ignored env SSH_TTY debug1: Sending env LC_ALL = en_US.UTF-8 debug2: channel 0: request env confirm 0 debug3: Ignored env USER debug3: Ignored env LS_COLORS debug3: Ignored env MAIL debug3: Ignored env PATH debug3: Ignored env PWD debug1: Sending env LANG = en_US.UTF-8 debug2: channel 0: request env confirm 0 debug3: Ignored env SHLVL debug3: Ignored env HOME debug3: Ignored env LANGUAGE debug3: Ignored env LOGNAME debug3: Ignored env SSH_CONNECTION debug3: Ignored env LESSOPEN debug3: Ignored env LESSCLOSE debug3: Ignored env _ debug1: Sending command: rsync --server -logDtpre.iLsf . /home/{username}/test/ debug2: channel 0: request exec confirm 1 debug2: fd 3 setting TCP_NODELAY debug2: callback done debug2: channel 0: open confirm rwindow 0 rmax 32768 debug3: Wrote 208 bytes for a total of 2487 At this point everything freeze for lots of minutes, ending in Write failed: Broken pipe rsync: connection unexpectedly closed (0 bytes received so far) [sender] rsync error: unexplained error (code 255) at io.c(601) [sender=3.0.7] Any suggestion? Thank You F. Edit 2012/09/13: i am changing title and issue definition, since i made some TINY step ahead and i think i can give more detailed clues.

    Read the article

  • Error using CreateFileMapping - C

    - by Jamie Keeling
    Hello, I am using the tutorial on this MSDN link to implement a way of transferring data from one process to another. Although I was advised in an earlier question to use the Pipe methods, due to certain constraints I have no choice but to use the CreateFileMapping method. Now, i've succesfully managed to make two seperate window form projects within the same solution and by editing some properties both of the forms load at the same time. Furthermore I have managed to implement the code given in the MSDN sample into the first (Producer) and second (Consumer) program without any compilation errors. The problem I am having now is when I run the first program and try to create the handle to the mapped file, I am given an error saying it was unsuccesful and I do not understand why this is happening. I have added both the Producer and Consumer code files to demonstrate what I am trying to do. Producer: #include <windows.h> #include <stdio.h> #include <conio.h> //File header definitions #define IDM_FILE_ROLLDICE 1 #define IDM_FILE_QUIT 2 #define BUF_SIZE 256 TCHAR szName[]=TEXT("Global\\MyFileMappingObject"); TCHAR szMsg[]=TEXT("Message from first process!"); void AddMenus(HWND); LRESULT CALLBACK WindowFunc(HWND, UINT, WPARAM, LPARAM); ////Standard windows stuff - omitted to save space. ////////////////////// // WINDOWS FUNCTION // ////////////////////// LRESULT CALLBACK WindowFunc(HWND hMainWindow, UINT message, WPARAM wParam, LPARAM lParam) { WCHAR buffer[256]; LPCTSTR pBuf; struct DiceData storage; HANDLE hMapFile; switch(message) { case WM_CREATE: { // Create Menus AddMenus(hMainWindow); } break; case WM_COMMAND: // Intercept menu choices switch(LOWORD(wParam)) { case IDM_FILE_ROLLDICE: { //Roll dice and store results in variable //storage = RollDice(); ////Copy results to buffer //swprintf(buffer,255,L"Dice 1: %d, Dice 2: %d",storage.dice1,storage.dice2); ////Show via message box //MessageBox(hMainWindow,buffer,L"Dice Result",MB_OK); hMapFile = CreateFileMapping( (HANDLE)0xFFFFFFFF, // use paging file NULL, // default security PAGE_READWRITE, // read/write access 0, // maximum object size (high-order DWORD) BUF_SIZE, // maximum object size (low-order DWORD) szName); // name of mapping object if (hMapFile == NULL) { MessageBox(hMainWindow,L"Could not create file mapping object",L"Error",NULL); return 1; } pBuf = (LPTSTR) MapViewOfFile(hMapFile, // handle to map object FILE_MAP_ALL_ACCESS, // read/write permission 0, 0, BUF_SIZE); if (pBuf == NULL) { MessageBox(hMainWindow,L"Could not map view of file",L"Error",NULL); CloseHandle(hMapFile); return 1; } CopyMemory((PVOID)pBuf, szMsg, (_tcslen(szMsg) * sizeof(TCHAR))); _getch(); UnmapViewOfFile(pBuf); CloseHandle(hMapFile); } break; case IDM_FILE_QUIT: SendMessage(hMainWindow, WM_CLOSE, 0, 0); break; } break; case WM_DESTROY: PostQuitMessage(0); break; } return DefWindowProc(hMainWindow, message, wParam, lParam); } // //Setup menus // Consumer: #include <windows.h> #include <stdio.h> #include <conio.h> //File header definitions #define IDM_FILE_QUIT 1 #define IDM_FILE_POLL 2 #define BUF_SIZE 256 TCHAR szName[]=TEXT("Global\\MyFileMappingObject"); //Prototypes void AddMenus(HWND); LRESULT CALLBACK WindowFunc(HWND, UINT, WPARAM, LPARAM); //More standard windows creation, again omitted. ////////////////////// // WINDOWS FUNCTION // ////////////////////// LRESULT CALLBACK WindowFunc(HWND hMainWindow, UINT message, WPARAM wParam, LPARAM lParam) { HANDLE hMapFile; LPCTSTR pBuf; switch(message) { case WM_CREATE: { // Create Menus AddMenus(hMainWindow); break; } case WM_COMMAND: { // Intercept menu choices switch(LOWORD(wParam)) { case IDM_FILE_POLL: { hMapFile = OpenFileMapping( FILE_MAP_ALL_ACCESS, // read/write access FALSE, // do not inherit the name szName); // name of mapping object if (hMapFile == NULL) { MessageBox(hMainWindow,L"Could not open file mapping object",L"Error",NULL); return 1; } pBuf = (LPTSTR) MapViewOfFile(hMapFile, // handle to map object FILE_MAP_ALL_ACCESS, // read/write permission 0, 0, BUF_SIZE); if (pBuf == NULL) { MessageBox(hMainWindow,L"Could not map view of file",L"Error",NULL); CloseHandle(hMapFile); return 1; } MessageBox(NULL, pBuf, TEXT("Process2"), MB_OK); UnmapViewOfFile(pBuf); CloseHandle(hMapFile); break; } case IDM_FILE_QUIT: SendMessage(hMainWindow, WM_CLOSE, 0, 0); break; } break; } case WM_DESTROY: { PostQuitMessage(0); break; } } return DefWindowProc(hMainWindow, message, wParam, lParam); } // //Setup menus // It's by no means tidy and final but it's just a start, thanks for any help.

    Read the article

  • Pointers to Derived Class Objects Losing vfptr

    - by duckworthd
    To begin, I am trying to write a run-of-the-mill, simple Ray Tracer. In my Ray Tracer, I have multiple types of geometries in the world, all derived from a base class called "SceneObject". I've included the header for it here. /** Interface for all objects that will appear in a scene */ class SceneObject { public: mat4 M, M_inv; Color c; SceneObject(); ~SceneObject(); /** The transformation matrix to be applied to all points of this object. Identity leaves the object in world frame. */ void setMatrix(mat4 M); void setMatrix(MatrixStack mStack); void getMatrix(mat4& M); /** The color of the object */ void setColor(Color c); void getColor(Color& c); /** Alter one portion of the color, leaving the rest as they were. */ void setDiffuse(vec3 rgb); void setSpecular(vec3 rgb); void setEmission(vec3 rgb); void setAmbient(vec3 rgb); void setShininess(double s); /** Fills 'inter' with information regarding an intersection between this object and 'ray'. Ray should be in world frame. */ virtual void intersect(Intersection& inter, Ray ray) = 0; /** Returns a copy of this SceneObject */ virtual SceneObject* clone() = 0; /** Print information regarding this SceneObject for debugging */ virtual void print() = 0; }; As you can see, I've included a couple virtual functions to be implemented elsewhere. In this case, I have only two derived class -- Sphere and Triangle, both of which implement the missing member functions. Finally, I have a Parser class, which is full of static methods that do the actual "Ray Tracing" part. Here's a couple snippets for relevant portions void Parser::trace(Camera cam, Scene scene, string outputFile, int maxDepth) { int width = cam.getNumXPixels(); int height = cam.getNumYPixels(); vector<vector<vec3>> colors; colors.clear(); for (int i = 0; i< width; i++) { vector<vec3> ys; for (int j = 0; j<height; j++) { Intersection intrsct; Ray ray; cam.getRay(ray, i, j); vec3 color; printf("Obtaining color for Ray[%d,%d]\n", i,j); getColor(color, scene, ray, maxDepth); ys.push_back(color); } colors.push_back(ys); } printImage(colors, width, height, outputFile); } void Parser::getColor(vec3& color, Scene scene, Ray ray, int numBounces) { Intersection inter; scene.intersect(inter,ray); if(inter.isIntersecting()){ Color c; inter.getColor(c); c.getAmbient(color); } else { color = vec3(0,0,0); } } Right now, I've forgone the true Ray Tracing part and instead simply return the color of the first object hit, if any. As you have no doubt noticed, the only way the computer knows that a ray has intersected an object is through Scene.intersect(), which I also include. void Scene::intersect(Intersection& i, Ray r) { Intersection result; result.setDistance(numeric_limits<double>::infinity()); result.setIsIntersecting(false); double oldDist; result.getDistance(oldDist); /* Cycle through all objects, making result the closest one */ for(int ind=0; ind<objects.size(); ind++){ SceneObject* thisObj = objects[ind]; Intersection betterIntersect; thisObj->intersect(betterIntersect, r); double newDist; betterIntersect.getDistance(newDist); if (newDist < oldDist){ result = betterIntersect; oldDist = newDist; } } i = result; } Alright, now for the problem. I begin by creating a scene and filling it with objects outside of the Parser::trace() method. Now for some odd reason, I cast Ray for i=j=0 and everything works wonderfully. However, by the time the second ray is cast all of the objects stored in my Scene no longer recognize their vfptr's! I stepped through the code with a debugger and found that the information to all the vfptr's are lost somewhere between the end of getColor() and the continuation of the loop. However, if I change the arguments of getColor() to use a Scene& instead of a Scene, then no loss occurs. What crazy voodoo is this?

    Read the article

  • How to embed a progressbar into a HTML form?

    - by Noah Brainey
    I have this code below and want it to show the progress of a form submission of a file upload. I want it to work on my website visit it through this IP (24.148.156.217). So if you saw the website I want the progress bar to be displayed when the user fills in the information and then hits the submit button. Then the progress bar displays with the time until it's finished. <style> <!-- .hide { position:absolute; visibility:hidden; } .show { position:absolute; visibility:visible; } --> </style> <SCRIPT LANGUAGE="JavaScript"> //Progress Bar script- by Todd King ([email protected]) //Modified by JavaScript Kit for NS6, ability to specify duration //Visit JavaScript Kit (http://javascriptkit.com) for script var duration=3 // Specify duration of progress bar in seconds var _progressWidth = 50; // Display width of progress bar. var _progressBar = "|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||" var _progressEnd = 5; var _progressAt = 0; // Create and display the progress dialog. // end: The number of steps to completion function ProgressCreate(end) { // Initialize state variables _progressEnd = end; _progressAt = 0; // Move layer to center of window to show if (document.all) { // Internet Explorer progress.className = 'show'; progress.style.left = (document.body.clientWidth/2) - (progress.offsetWidth/2); progress.style.top = document.body.scrollTop+(document.body.clientHeight/2) - (progress.offsetHeight/2); } else if (document.layers) { // Netscape document.progress.visibility = true; document.progress.left = (window.innerWidth/2) - 100+"px"; document.progress.top = pageYOffset+(window.innerHeight/2) - 40+"px"; } else if (document.getElementById) { // Netscape 6+ document.getElementById("progress").className = 'show'; document.getElementById("progress").style.left = (window.innerWidth/2)- 100+"px"; document.getElementById("progress").style.top = pageYOffset+(window.innerHeight/2) - 40+"px"; } ProgressUpdate(); // Initialize bar } // Hide the progress layer function ProgressDestroy() { // Move off screen to hide if (document.all) { // Internet Explorer progress.className = 'hide'; } else if (document.layers) { // Netscape document.progress.visibility = false; } else if (document.getElementById) { // Netscape 6+ document.getElementById("progress").className = 'hide'; } } // Increment the progress dialog one step function ProgressStepIt() { _progressAt++; if(_progressAt > _progressEnd) _progressAt = _progressAt % _progressEnd; ProgressUpdate(); } // Update the progress dialog with the current state function ProgressUpdate() { var n = (_progressWidth / _progressEnd) * _progressAt; if (document.all) { // Internet Explorer var bar = dialog.bar; } else if (document.layers) { // Netscape var bar = document.layers["progress"].document.forms["dialog"].bar; n = n * 0.55; // characters are larger } else if (document.getElementById){ var bar=document.getElementById("bar") } var temp = _progressBar.substring(0, n); bar.value = temp; } // Demonstrate a use of the progress dialog. function Demo() { ProgressCreate(10); window.setTimeout("Click()", 100); } function Click() { if(_progressAt >= _progressEnd) { ProgressDestroy(); return; } ProgressStepIt(); window.setTimeout("Click()", (duration-1)*1000/10); } function CallJS(jsStr) { //v2.0 return eval(jsStr) } </script> <SCRIPT LANGUAGE="JavaScript"> // Create layer for progress dialog document.write("<span id=\"progress\" class=\"hide\">"); document.write("<FORM name=dialog id=dialog>"); document.write("<TABLE border=2 bgcolor=\"#FFFFCC\">"); document.write("<TR><TD ALIGN=\"center\">"); document.write("Progress<BR>"); document.write("<input type=text name=\"bar\" id=\"bar\" size=\"" + _progressWidth/2 + "\""); if(document.all||document.getElementById) // Microsoft, NS6 document.write(" bar.style=\"color:navy;\">"); else // Netscape document.write(">"); document.write("</TD></TR>"); document.write("</TABLE>"); document.write("</FORM>"); document.write("</span>"); ProgressDestroy(); // Hides </script> <form name="form1" method="post"> <center> <input type="button" name="Demo" value="Display progress" onClick="CallJS('Demo()')"> </center> </form> <a href="javascript:CallJS('Demo()')">Text link example</a>

    Read the article

  • Error while applying overlay on a location on a Google map in Android

    - by Hiccup
    This is my Activity for getting Location: public class LocationActivity extends MapActivity{ Bundle bundle = new Bundle(); MapView mapView; MapController mc; GeoPoint p; ArrayList <String> address = new ArrayList<String>(); List<Address> addresses; private LocationManager locationManager; double lat, lng; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map); mapView = (MapView) findViewById(R.id.mapView1); mapView.displayZoomControls(true); mc = mapView.getController(); LocationManager lm = (LocationManager)getSystemService(Context.LOCATION_SERVICE); Criteria criteria = new Criteria(); // criteria.setAccuracy(Criteria.ACCURACY_FINE); criteria.setAltitudeRequired(false); criteria.setBearingRequired(false); criteria.setCostAllowed(true); String strLocationProvider = lm.getBestProvider(criteria, true); //Location location = lm.getLastKnownLocation(strLocationProvider); Location location = lm.getLastKnownLocation(LocationManager.NETWORK_PROVIDER); lat = (double) location.getLatitude(); lng = (double) location.getLongitude(); p = new GeoPoint( (int) (lat * 1E6), (int) (lng * 1E6)); mc.animateTo(p); mc.setZoom(17); MapOverlay mapOverlay = new MapOverlay(); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); Geocoder gcd = new Geocoder(this, Locale.getDefault()); try { addresses = gcd.getFromLocation(lat,lng,1); if (addresses.size() > 0 && addresses != null) { address.add(addresses.get(0).getFeatureName()); address.add(addresses.get(0).getAdminArea()); address.add(addresses.get(0).getCountryName()); bundle.putStringArrayList("id1", address); } bundle.putDouble("lat", lat); bundle.putDouble("lon", lng); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } class MapOverlay extends com.google.android.maps.Overlay { @Override public boolean draw(Canvas canvas, MapView mapView, boolean shadow, long when) { super.draw(canvas, mapView, shadow); //---translate the GeoPoint to screen pixels--- Point screenPts = new Point(); mapView.getProjection().toPixels(p, screenPts); //---add the marker--- Bitmap bmp = BitmapFactory.decodeResource( getResources(), R.drawable.logo); canvas.drawBitmap(bmp, screenPts.x, screenPts.y-50, null); return true; } @Override public boolean onTouchEvent(MotionEvent event, MapView mapView) { //---when user lifts his finger--- if (event.getAction() == 1) { Bundle bundle = new Bundle(); ArrayList <String> address = new ArrayList<String>(); GeoPoint p = mapView.getProjection().fromPixels( (int) event.getX(), (int) event.getY()); Geocoder geoCoder = new Geocoder( getBaseContext(), Locale.getDefault()); try { List<Address> addresses = geoCoder.getFromLocation( p.getLatitudeE6() / 1E6, p.getLongitudeE6() / 1E6, 1); addOverLay(); MapOverlay mapOverlay = new MapOverlay(); Bitmap bmp = BitmapFactory.decodeResource( getResources(), R.drawable.crumbs_logo); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); String add = ""; if (addresses.size() > 0) { address.add(addresses.get(0).getFeatureName()); address.add(addresses.get(0).getLocality()); address.add(addresses.get(0).getAdminArea()); address.add(addresses.get(0).getCountryName()); bundle.putStringArrayList("id1", address); for(int i = 0; i <= addresses.size();i++) add += addresses.get(0).getAddressLine(i) + "\n"; } bundle.putDouble("lat", p.getLatitudeE6() / 1E6); bundle.putDouble("lon", p.getLongitudeE6() / 1E6); Toast.makeText(getBaseContext(), add, Toast.LENGTH_SHORT).show(); } catch (IOException e) { e.printStackTrace(); } return true; } else return false; } } public void onClick_mapButton(View v) { Intent intent = this.getIntent(); this.setResult(RESULT_OK, intent); intent.putExtras(bundle); finish(); } public void addOverLay() { MapOverlay mapOverlay = new MapOverlay(); List<Overlay> listOfOverlays = mapView.getOverlays(); listOfOverlays.clear(); listOfOverlays.add(mapOverlay); } @Override protected boolean isRouteDisplayed() { // TODO Auto-generated method stub return false; } public void FindLocation() { LocationManager locationManager = (LocationManager) this .getSystemService(Context.LOCATION_SERVICE); LocationListener locationListener = new LocationListener() { public void onLocationChanged(Location location) { // updateLocation(location); Toast.makeText( LocationActivity.this, String.valueOf(lat) + "\n" + String.valueOf(lng), 5000) .show(); } public void onStatusChanged(String provider, int status, Bundle extras) { } public void onProviderEnabled(String provider) { } public void onProviderDisabled(String provider) { } }; locationManager.requestLocationUpdates( LocationManager.NETWORK_PROVIDER, 0, 0, locationListener); } } I face two problems here. One is that when I click (do a tap) on any location, the overlay is not changing to that place. Also, the app crashes when I am on the MapView page and I click on back button. What might be the error?

    Read the article

  • deadlock when using WCF Duplex Polling with Silverlight

    - by Kobi Hari
    Hi all. I have followed Tomek Janczuk's demonstration on silverlight tv to create a chat program that uses WCF Duplex Polling web service. The client subscribes to the server, and then the server initiates notifications to all connected clients to publish events. The Idea is simple, on the client, there is a button that allows the client to connect. A text box where the client can write a message and publish it, and a bigger text box that presents all the notifications received from the server. I connected 3 clients (in different browsers - IE, Firefox and Chrome) and it all works nicely. They send messages and receive them smoothly. The problem starts when I close one of the browsers. As soon as one client is out, the other clients get stuck. They stop getting notifications. I am guessing that the loop in the server that goes through all the clients and sends them the notifications is stuck on the client that is now missing. I tried catching the exception and removing it from the clients list (see code) but it still does not help. any ideas? The server code is as follows: using System; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Activation; using System.Collections.Generic; using System.Runtime.Remoting.Channels; namespace ChatDemo.Web { [ServiceContract] public interface IChatNotification { // this will be used as a callback method, therefore it must be one way [OperationContract(IsOneWay=true)] void Notify(string message); [OperationContract(IsOneWay = true)] void Subscribed(); } // define this as a callback contract - to allow push [ServiceContract(Namespace="", CallbackContract=typeof(IChatNotification))] [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] [ServiceBehavior(InstanceContextMode=InstanceContextMode.Single)] public class ChatService { SynchronizedCollection<IChatNotification> clients = new SynchronizedCollection<IChatNotification>(); [OperationContract(IsOneWay=true)] public void Subscribe() { IChatNotification cli = OperationContext.Current.GetCallbackChannel<IChatNotification>(); this.clients.Add(cli); // inform the client it is now subscribed cli.Subscribed(); Publish("New Client Connected: " + cli.GetHashCode()); } [OperationContract(IsOneWay = true)] public void Publish(string message) { SynchronizedCollection<IChatNotification> toRemove = new SynchronizedCollection<IChatNotification>(); foreach (IChatNotification channel in this.clients) { try { channel.Notify(message); } catch { toRemove.Add(channel); } } // now remove all the dead channels foreach (IChatNotification chnl in toRemove) { this.clients.Remove(chnl); } } } } The client code is as follows: void client_NotifyReceived(object sender, ChatServiceProxy.NotifyReceivedEventArgs e) { this.Messages.Text += string.Format("{0}\n\n", e.Error != null ? e.Error.ToString() : e.message); } private void MyMessage_KeyDown(object sender, KeyEventArgs e) { if (e.Key == Key.Enter) { this.client.PublishAsync(this.MyMessage.Text); this.MyMessage.Text = ""; } } private void Button_Click(object sender, RoutedEventArgs e) { this.client = new ChatServiceProxy.ChatServiceClient(new PollingDuplexHttpBinding { DuplexMode = PollingDuplexMode.MultipleMessagesPerPoll }, new EndpointAddress("../ChatService.svc")); // listen for server events this.client.NotifyReceived += new EventHandler<ChatServiceProxy.NotifyReceivedEventArgs>(client_NotifyReceived); this.client.SubscribedReceived += new EventHandler<System.ComponentModel.AsyncCompletedEventArgs>(client_SubscribedReceived); // subscribe for the server events this.client.SubscribeAsync(); } void client_SubscribedReceived(object sender, System.ComponentModel.AsyncCompletedEventArgs e) { try { Messages.Text += "Connected!\n\n"; gsConnect.Color = Colors.Green; } catch { Messages.Text += "Failed to Connect!\n\n"; } } And the web config is as follows: <system.serviceModel> <extensions> <bindingExtensions> <add name="pollingDuplex" type="System.ServiceModel.Configuration.PollingDuplexHttpBindingCollectionElement, System.ServiceModel.PollingDuplex, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35"/> </bindingExtensions> </extensions> <behaviors> <serviceBehaviors> <behavior name=""> <serviceMetadata httpGetEnabled="true"/> <serviceDebug includeExceptionDetailInFaults="false"/> </behavior> </serviceBehaviors> </behaviors> <bindings> <pollingDuplex> <binding name="myPollingDuplex" duplexMode="MultipleMessagesPerPoll"/> </pollingDuplex> </bindings> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true"/> <services> <service name="ChatDemo.Web.ChatService"> <endpoint address="" binding="pollingDuplex" bindingConfiguration="myPollingDuplex" contract="ChatDemo.Web.ChatService"/> <endpoint address="mex" binding="mexHttpBinding" contract="IMetadataExchange"/> </service> </services> </system.serviceModel>

    Read the article

  • Embedding mercurial revision information in Visual Studio c# projects automatically

    - by Mark Booth
    Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

< Previous Page | 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586  | Next Page >