Search Results

Search found 17528 results on 702 pages for 'row height'.

Page 158/702 | < Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >

  • Fetch image from folder via datatable does not work after placing image in subdirectory

    - by Arnold Bishkoff
    I am having trouble wrapping my head around the following I have code that fetches an image via smarty in a line img src="getsnap.php?picid={$data[$smarty.section.sec.index].picno|default:$nextpic}&typ=pic&width={$config.disp_snap_width}&height={$config.disp_snap_height}" class="smallpic" alt="" / this works if i pull the image from /temp/userimages/userid/imageNo.ext but because an OS can segfault if you store too many folders or images in a directory i have code that assigns the user image to a subdirectory based upon division of a subdir per 1000 userids. so in thise case i have user id 94 whos images get stored in /siteroot/temp/userimages/000000/94/pic_1.jpg (through 10) or tn_1 (through 10).jpg here is the code for getsnap.php <?php ob_start(); if ( !defined( 'SMARTY_DIR' ) ) { include_once( 'init.php' ); } include('core/snaps_functions.php'); if (isset($_REQUEST['username']) && $_REQUEST['username'] != '') { $userid = $osDB-getOne('select id from ! where username = ?',array(USER_TABLE, $_REQUEST['username']) ); } else { // include ( 'sessioninc.php' ); if( !isset($_GET['id']) || (isset($_GET['id'])&& (int)$_GET['id'] <= 0 ) ) { $userid = $_SESSION['UserId']; } else { $userid = $_GET['id']; } } if (!isset($_GET['picid']) ) { if ((isset($_REQUEST['type']) && $_REQUEST['type'] != 'gallery') || !isset($_REQUEST['type']) ) { $defpic = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and default_pic = ? and active = ? ',array(USER_SNAP_TABLE, $userid,'0','Y','Y' ) ); if ($defpic != '') { $picid = $defpic; } else { $picid = $osDB-getOne('select picno from ! where userid = ? and ( album_id is null or album_id = ?) and active=? order by rand()',array(USER_SNAP_TABLE, $userid,'0','Y' ) ); } unset( $defpic); } } else { $picid = $_GET['picid']; } $typ = isset( $_GET['typ'])?$_GET['typ']:'pic' ; $cond = ''; if ( ($config['snaps_require_approval'] == 'Y' || $config['snaps_require_approval'] == '1') && $userid != $_SESSION['UserId'] ) { $cond = " and active = 'Y' "; } $sql = 'select * from ! where userid = ? and picno = ? '.$cond; //Get the pic $row =& $osDB-getRow ( $sql, array( USER_SNAP_TABLE, $userid, $picid ) ); //Okay pic was found in the DB, Lets actually do something // $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; $img = getPicture($zimg, $userid, $picid, $typ, $row); //$img = getPicture($userid, $picid, $typ, $row); //$img = getPicture($dir, $userid, $picid, $typ, $row); $ext = ($typ = 'tn')?$row['tnext']:$row['picext']; // Now pic is built as // something pic_x.ext ie pic_2.jpg if ( $img != '' && ( ( hasRight('seepictureprofile') && ( $config['snaps_require_approval'] == 'Y' && $row['active'] == 'Y' ) ||$config['snaps_require_approval'] == 'N' ) || $userid == $_SESSION['UserId'] ) ) { $img2 = $img; //$img2 = $dir.'/'.$img; } else { $gender = $osDB-getOne( 'select gender from ! where id = ?', array( USER_TABLE, $userid ) ) ; if ($gender == 'M') { $nopic = SKIN_IMAGES_DIR.'male.jpg'; } elseif ($gender == 'F') { $nopic = SKIN_IMAGES_DIR.'female.jpg'; } elseif ($gender == 'D') { $nopic = SKIN_IMAGES_DIR.'director.jpg'; } $img2 = imagecreatefromjpeg($nopic); $ext = 'jpg'; } ob_end_clean(); header("Pragma: public"); header("Content-Type: image/".$ext); header("Content-Transfer-Encoding: binary"); header("Cache-Control: must-revalidate"); $ExpStr = "Expires: " . gmdate("D, d M Y H:i:s", time() - 30) . " GMT"; header($ExpStr); $id = $userid; $dir = str_pad(($id - ($id % 1000))/100000,6,'0',STR_PAD_LEFT); $zimg = USER_IMAGES_DIR.$dir; //header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); //header("Content-Disposition: attachment; filename=$dir.'/'.profile_".$userid."".$typ.".".$ext); //header("Content-Disposition: attachment; filename=profile"$dir".'/'.".$userid."_".$typ.".".$ext); header("Content-Disposition: attachment; filename=profile_".$userid."_".$typ.".".$ext); /* if ($_SESSION['browser'] != 'MSIE') { header("Content-Disposition: inline" ); } */ if ($ext == 'jpg') { imagejpeg($img2); } elseif ($ext == 'gif') { imagegif($img2); } elseif ($ext == 'png') { imagepng($img2); } elseif ($ext == 'bmp') { imagewbmp($img2); } imagedestroy($img2); ?

    Read the article

  • Which workaround to use for the following SQL deadlock?

    - by Marko
    I found a SQL deadlock scenario in my application during concurrency. I belive that the two statements that cause the deadlock are (note - I'm using LINQ2SQL and DataContext.ExecuteCommand(), that's where this.studioId.ToString() comes into play): exec sp_executesql N'INSERT INTO HQ.dbo.SynchronizingRows ([StudioId], [UpdatedRowId]) SELECT @p0, [t0].[Id] FROM [dbo].[UpdatedRows] AS [t0] WHERE NOT (EXISTS( SELECT NULL AS [EMPTY] FROM [dbo].[ReceivedUpdatedRows] AS [t1] WHERE ([t1].[StudioId] = @p0) AND ([t1].[UpdatedRowId] = [t0].[Id]) ))',N'@p0 uniqueidentifier',@p0='" + this.studioId.ToString() + "'; and exec sp_executesql N'INSERT INTO HQ.dbo.ReceivedUpdatedRows ([UpdatedRowId], [StudioId], [ReceiveDateTime]) SELECT [t0].[UpdatedRowId], @p0, GETDATE() FROM [dbo].[SynchronizingRows] AS [t0] WHERE ([t0].[StudioId] = @p0)',N'@p0 uniqueidentifier',@p0='" + this.studioId.ToString() + "'; The basic logic of my (client-server) application is this: Every time someone inserts or updates a row on the server side, I also insert a row into the table UpdatedRows, specifying the RowId of the modified row. When a client tries to synchronize data, it first copies all of the rows in the UpdatedRows table, that don't contain a reference row for the specific client in the table ReceivedUpdatedRows, to the table SynchronizingRows (the first statement taking part in the deadlock). Afterwards, during the synchronization I look for modified rows via lookup of the SynchronizingRows table. This step is required, otherwise if someone inserts new rows or modifies rows on the server side during synchronization I will miss them and won't get them during the next synchronization (explanation scenario to long to write here...). Once synchronization is complete, I insert rows to the ReceivedUpdatedRows table specifying that this client has received the UpdatedRows contained in the SynchronizingRows table (the second statement taking part in the deadlock). Finally I delete all rows from the SynchronizingRows table that belong to the current client. The way I see it, the deadlock is occuring on tables SynchronizingRows (abbreviation SR) and ReceivedUpdatedRows (abbreviation RUR) during steps 2 and 3 (one client is in step 2 and is inserting into SR and selecting from RUR; while another client is in step 3 inserting into RUR and selecting from SR). I googled a bit about SQL deadlocks and came to a conclusion that I have three options. Inorder to make a decision I need more input about each option/workaround: Workaround 1: The first advice given on the web about SQL deadlocks - restructure tables/queries so that deadlocks don't happen in the first place. Only problem with this is that with my IQ I don't see a way to do the synchronization logic any differently. If someone wishes to dwelve deeper into my current synchronization logic, how and why it is set up the way it is, I'll post a link for the explanation. Perhaps, with the help of someone smarter than me, it's possible to create a logic that is deadlock free. Workaround 2: The second most common advice seems to be the use of WITH(NOLOCK) hint. The problem with this is that NOLOCK might miss or duplicate some rows. Duplication is not a problem, but missing rows is catastrophic! Another option is the WITH(READPAST) hint. On the face of it, this seems to be a perfect solution. I really don't care about rows that other clients are inserting/modifying, because each row belongs only to a specific client, so I may very well skip locked rows. But the MSDN documentaion makes me a bit worried - "When READPAST is specified, both row-level and page-level locks are skipped". As I said, row-level locks would not be a problem, but page-level locks may very well be, since a page might contain rows that belong to multiple clients (including the current one). While there are lots of blog posts specifically mentioning that NOLOCK might miss rows, there seems to be none about READPAST (never) missing rows. This makes me skeptical and nervous to implement it, since there is no easy way to test it (implementing would be a piece of cake, just pop WITH(READPAST) into both statements SELECT clause and job done). Can someone confirm whether the READPAST hint can miss rows? Workaround 3: The final option is to use ALLOW_SNAPSHOT_ISOLATION and READ_COMMITED_SNAPSHOT. This would seem to be the only option to work 100% - at least I can't find any information that would contradict with it. But it is a little bit trickier to setup (I don't care much about the performance hit), because I'm using LINQ. Off the top of my head I probably need to manually open a SQL connection and pass it to the LINQ2SQL DataContext, etc... I haven't looked into the specifics very deeply. Mostly I would prefer option 2 if somone could only reassure me that READPAST will never miss rows concerning the current client (as I said before, each client has and only ever deals with it's own set of rows). Otherwise I'll likely have to implement option 3, since option 1 is probably impossible... I'll post the table definitions for the three tables as well, just in case: CREATE TABLE [dbo].[UpdatedRows]( [Id] [uniqueidentifier] NOT NULL ROWGUIDCOL DEFAULT NEWSEQUENTIALID() PRIMARY KEY CLUSTERED, [RowId] [uniqueidentifier] NOT NULL, [UpdateDateTime] [datetime] NOT NULL, ) ON [PRIMARY] GO CREATE NONCLUSTERED INDEX IX_RowId ON dbo.UpdatedRows ([RowId] ASC) WITH (STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] GO CREATE TABLE [dbo].[ReceivedUpdatedRows]( [Id] [uniqueidentifier] NOT NULL ROWGUIDCOL DEFAULT NEWSEQUENTIALID() PRIMARY KEY NONCLUSTERED, [UpdatedRowId] [uniqueidentifier] NOT NULL REFERENCES [dbo].[UpdatedRows] ([Id]), [StudioId] [uniqueidentifier] NOT NULL REFERENCES, [ReceiveDateTime] [datetime] NOT NULL, ) ON [PRIMARY] GO CREATE CLUSTERED INDEX IX_Studios ON dbo.ReceivedUpdatedRows ([StudioId] ASC) WITH (STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY] GO CREATE TABLE [dbo].[SynchronizingRows]( [StudioId] [uniqueidentifier] NOT NULL [UpdatedRowId] [uniqueidentifier] NOT NULL REFERENCES [dbo].[UpdatedRows] ([Id]) PRIMARY KEY CLUSTERED ([StudioId], [UpdatedRowId]) ) ON [PRIMARY] GO PS! Studio = Client. PS2! I just noticed that the index definitions have ALLOW_PAGE_LOCK=ON. If I would turn it off, would that make any difference to READPAST? Are there any negative downsides for turning it off?

    Read the article

  • Nested <a> and <span> challenge

    - by PaddyO
    Hi all, Trying in vain to get a nested link working within a nested span. This is a working test page for the code below to explain what I'm trying to do. Any ideas on how to get this working in valid html? I guess it's either a nesting order or style syntax thing but I am at a loss. Any thoughts much appreciated. <div id="greyback"> <ul id="scrollbox"> <li class="listcat">List header</li> <li><a class="menu" href="#freeze">List item 1<span><b>This text has popped up because you have clicked the list item, which has an "a" tag and now has :focus. That "a" tag is the first of two.</b><br><br>What I am trying to do is to set the second "a" tag as a DIFFERENT "embedded" link in this box<span style="color: blue; background-color: yellow;">eg, here<a href="http://www.conservationenterprises.com" target="blank">This is the second (nested) "a" tag in this html nest. It is a link to an external site. Instead of this being an always-visible link, I want it to sit within the yellow box in the first span (click the List item 1 to display).</a></span> </a></span> </li> </a></span> </li> </ul> </div> and the CSS: #scrollbox {margin: 0 auto; margin-top: 1em; margin-bottom: 1em; width:19em; height:auto; max-height: 21em; overflow:auto; border-bottom: 0.1em solid #FFA500; border-top: 0.1em solid #FFA500;} #scrollbox a {float: left; color:#000000; text-decoration:none; width:18em; height: auto; margin-bottom: 0.5em; font-family: Arial, sans-serif; font-size: 0.9em; text-align:left;} #scrollbox a.menu {} #scrollbox a span {display:none; position:absolute; left:0em; top:0;} #scrollbox a span img {float: right; border:0; max-width:7.5em;} #scrollbox a:hover {border: 0; color: #7ebb11; font-size:0.9em;} #scrollbox a:hover span {border: 0; color: #535353;} #scrollbox a span:focus {color: blue;} #scrollbox a:active {border:none; color: #535353; text-decoration: none;} #scrollbox a:focus {border:0em solid #000; outline:0;} #scrollbox a:active span, #scrollbox li a:active span, #scrollbox a:focus span, #scrollbox li a:focus span {display: block; width: 52.5em; min-height: 20em; height: auto; left: 1.5em; top:18em; z-index:10; font-size:0.9em; text-align: left; padding: 1em; padding-bottom: 0em; background-color: #c3FFe3; color: #535353; border: solid #FFA500 0.25em;} #scrollbox li a:active span span, #scrollbox li a:focus span span{display: block; width: auto; height: auto; min-height: 2em; left: 25em; top:10em; z-index:10; font-size:0.9em; text-align: left; padding: 1em; padding-bottom: 0em; background-color: transparent; color: #535353; border: dashed red 1px;} .ul#scrollbox {padding-left: 0.1em;} #scrollbox li {float:left; list-style: none; background: url(blank.png) no-repeat left center; margin-left: 0em; font-family:Arial, sans-serif; font-size: 0.9em;} #scrollbox li.listcat {float: left; text-align:left; width: 18em; margin-left: 0em; margin-top: 0.1em; margin-bottom: 0.3em; padding-top:0.5em; color: green; font-size: 0.9em; font-weight:bold;} Cheers Patrick.

    Read the article

  • Need help... how to add md5 to password field in php?

    - by jones
    Hi mates, i looking some help and nice attention here.. i bought some php script many years ago and now no suport anymore... i just want to add md5 to password field.. here my form: <?php $SQL = "SELECT * from USERS WHERE USERNAME = '$_SESSION[username]'"; $result = @mysql_query( $SQL ); $row = @mysql_fetch_array( $result ); include 'menu.php'; ?> <FORM METHOD="post" ACTION="?page=query_client"> <INPUT TYPE="hidden" NAME="controller" VALUE="USERS~update~account_details&up=1~<?php echo $row[ID]; ?>"> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdmenu" WIDTH="40%">Username</TD> <TD CLASS="tdmenu" WIDTH="60%"> <b><?php echo $row[USERNAME]; ?></b> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Password *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="PASSWORD" NAME="PASSWORD" SIZE="40" VALUE="<?php echo $row[PASSWORD]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Email Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="EMAIL" SIZE="40" VALUE="<?php echo $row[EMAIL]; ?>"> </TD> </TR> <TR> <TD CLASS="tdmenu" WIDTH="40%">Full Name *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="FULLNAME" SIZE="40" VALUE="<?php echo $row[FULLNAME]; ?>"> </TD> <TR> <TD CLASS="tdmenu" WIDTH="40%">Address *</TD> <TD CLASS="tdmenu" WIDTH="60%"> <INPUT TYPE="text" NAME="ADDRESS1" SIZE="40" VALUE="<?php echo $row[ADDRESS1]; ?>"> </TD> </TR> <BR> <TABLE CLASS="basictable"> <TR> <TD CLASS="tdhead2" > <DIV ALIGN="CENTER"><B> <INPUT TYPE="submit" NAME="Submit" VALUE="Submit"> </B></DIV> </TD> </TR> </TABLE> </FORM> and the it self as query_client.php inside look like: <?PHP @session_start(); $controller = $_POST['controller']; $pieces = explode("~", $controller); $table = $pieces[0]; $qt = $pieces[1]; $return = $pieces[2]; $id = $pieces[3]; $hack = $pieces[4]; if ($qt == insert) $qt = 'INSERT INTO'; if ($qt == update) { $qt = 'UPDATE'; $end = "WHERE ID = '$id'"; } $pre = array_keys( $_POST ); mysql_query ("CREATE TABLE IF NOT EXISTS `$table` (`ID` INT NOT NULL AUTO_INCREMENT , PRIMARY KEY ( `id` ) )"); $count = count($pre); $count = $count - 2; $sql = "$qt $table SET"; for ($i=0; $i < $count; $i++) { $x=$i+1; $y = $_POST[$pre[$x]]; $d = $y; mysql_query ("ALTER TABLE `$table` ADD `$pre[$x]` TEXT NOT NULL"); $sql .= " `$pre[$x]` = '$d',"; } $sql .= " ID = '$id' $end"; $query = mysql_query($sql) or die("$sql_error" . mysql_error()); if (empty($hack)) { } else { $pieces = explode("/", $hack); $h0 = $pieces[0]; $h1 = $pieces[1]; $h2 = $pieces[2]; $h3 = $pieces[3]; $h4 = $pieces[4]; $h5 = $pieces[5]; mysql_query ("ALTER TABLE `$table` $h0 $h1 $h2 $h3 $h4 $h5"); $query = mysql_query($sql) or die("$sql_error" . mysql_error()); } if (isset($_GET[inc])) include "$_GET[inc].php"; ?> so please help me how to add md5 in PASSWORD field? thanks in advance..

    Read the article

  • How to correctly use DERIVE or COUNTER in munin plugins

    - by Johan
    I'm using munin to monitor my server. I've been able to write plugins for it, but only if the graph type is GAUGE. When I try COUNTER or DERIVE, no data is logged or graphed. The plugin i'm currently stuck on is for monitoring bandwidth usage, and is as follows: /etc/munin/plugins/bandwidth2 #!/bin/sh if [ "$1" = "config" ]; then echo 'graph_title Bandwidth Usage 2' echo 'graph_vlabel Bandwidth' echo 'graph_scale no' echo 'graph_category network' echo 'graph_info Bandwidth usage.' echo 'used.label Used' echo 'used.info Bandwidth used so far this month.' echo 'used.type DERIVE' echo 'used.min 0' echo 'remain.label Remaining' echo 'remain.info Bandwidth remaining this month.' echo 'remain.type DERIVE' echo 'remain.min 0' exit 0 fi cat /var/log/zen.log The contents of /var/log/zen.log are: used.value 61.3251953125 remain.value 20.0146484375 And the resulting database is: <!-- Round Robin Database Dump --><rrd> <version> 0003 </version> <step> 300 </step> <!-- Seconds --> <lastupdate> 1269936605 </lastupdate> <!-- 2010-03-30 09:10:05 BST --> <ds> <name> 42 </name> <type> DERIVE </type> <minimal_heartbeat> 600 </minimal_heartbeat> <min> 0.0000000000e+00 </min> <max> NaN </max> <!-- PDP Status --> <last_ds> 61.3251953125 </last_ds> <value> NaN </value> <unknown_sec> 5 </unknown_sec> </ds> <!-- Round Robin Archives --> <rra> <cf> AVERAGE </cf> <pdp_per_row> 1 </pdp_per_row> <!-- 300 seconds --> <params> <xff> 5.0000000000e-01 </xff> </params> <cdp_prep> <ds> <primary_value> NaN </primary_value> <secondary_value> NaN </secondary_value> <value> NaN </value> <unknown_datapoints> 0 </unknown_datapoints> </ds> </cdp_prep> <database> <!-- 2010-03-28 09:15:00 BST / 1269764100 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:20:00 BST / 1269764400 --> <row><v> NaN </v></row> <!-- 2010-03-28 09:25:00 BST / 1269764700 --> <row><v> NaN </v></row> <snip> The value for last_ds is correct, it just doesn't seem to make it into the actual database. If I change DERIVE to GAUGE, it works as expected. munin-run bandwidth2 outputs the contents of /var/log/zen.log I've been all over the (sparse) docs for munin plugins, and can't find my mistake. Modifying an existing plugin didn't work for me either.

    Read the article

  • why use mixed-based replication for mysql

    - by Alistair Prestidge
    I am in the process of configuring MySQL replication and am intending to use row-based-replication but I was also reading up about mixed-based replication. This is where statement-based is the default and then for certain circumstances (http://dev.mysql.com/doc/refman/5.1/en/binary-log-mixed.html) MySQL will switch to row-based. The list is quit vast on when it will switch to row-based. My questions are: Does any one use mixed? If yes why did you chose this over just using one or the other? Thanks in advance

    Read the article

  • Merging multiple versions of same excel spreadsheet

    - by GrinReaper
    So here's the situation: I have multiple versions of the same spreadsheet-- each one has the exact same row and column labels. The difference between any two given spreadsheets is that data in one spreadsheet shouldn't be in the other (but sometimes it might.) Is there anyway to merge all of them into a "master copy" (or just a blank version) of the spreadsheet? (basically, using the data from various versions of that worksheet to fill out the main one) Copy-pasting is extremely tedious, and doesn't allow me to copy blocks of rows IF the row numbering is non-contiguous. (For example, Rows 1, 2, 3, 6 are in a block, but row 4 and 5 just don't exist.) Ideas? Googling hasn't turned up anything that seemed directly relevant to this problem.

    Read the article

  • conditional formatting for subsequent rows or columns

    - by Trailokya Saikia
    I have data in a range of cells (say six columns and one hundred rows). The first four column contains data and the sixth column has a limiting value. For data in every row the limiting value is different. I have one hundred such rows. I am successfully using Conditional formatting (e.g. cells containing data less than limiting value in first five columns are made red) for 1st row. But how to copy this conditional formatting so that it is applicable for entire hundred rows with respective limiting values. I tried with format painter. But it retains the same source cell (here limiting value) for the purpose of conditional formatting in second and subsequent rows. So, now I am required to use conditional formatting for each row separately s

    Read the article

  • How do I extract excel data from multiple worksheets and put into one sheet?

    - by user167210
    In a workbook I have 7 sheets(Totals and then Mon to Sat),I want to extract rows which have the word "CHEQ" in its cell (this is a dropdown list with two options-CHEQ/PAID)from all sheets. On my front sheet I used this formula: =IF(ROWS(A$13:A13)>$C$10,"",INDEX(Monday!A$3:A$62,SMALL(IF(Monday[Paid]=$A$10,ROW(Monday[Paid])-ROW(Monday!$I$3)+1),ROWS(A$13:A13)))) This formula works fine for one worksheet (eg. Monday) but is it possible to show the extracted rows from all 6 sheets on the front page? I only have Excel NOT Access. These are the 12 headers on row A12 Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted The exported data appears like this (this just an example): Col Name Cod House Car Date Discount 2nd Paid Extra Letter Posted 12 Robbs 1244 Ren 11/10 10% 5 CHEQ 0 0 No 15 Jones 7784 Ren 12/10 15% 1 CHEQ 0 0 No 18 Doese 1184 Ren 12/11 12% 1 CHEQ 0 0 No Any ideas on what to do to this formula? I am using Excel 2010.

    Read the article

  • Nested IF's in Excel

    - by user1590499
    I have two columns with the following possibilities (0 for first column, and then 0 or 1 for second column; or a string for first column, and a 0 or 1 for second column). name,flag 0,0 david,0 0,1 sammy,1 How would I create a third column that looks like the following: name+flag 0 david 1 sammy Basically, if there are 2 0's in the two columns in a row, put a 0 in the new column. if there is a string in the first column in the row, no matter what the second column in the row says, put the string in the new column. and if there is a 0 in the first column and a 1 on the second column, put a 1 in the third column. Can I do this best with nested-if's? I tried something like name, flag, name+flag 0,0,=IF(A2<>0,A2,IF(B2=1,B2,0),0) But it didn't seem to work for me...

    Read the article

  • In Excel, given a worksheet "A", how do you create a sheet "B" that has a subset of the rows in "A"?

    - by user32706
    In Excel 2007, I have a sheet full of data "A". One of the columns in sheet "B" is called "Valid" and has either "yes" or "no". I've created a second sheet "B". It's easy to make each row in "A" appear in "B" if the row is valid using an 'if' statement in each cell. But if it's invalid, there's a blank row. I need "B" to show only the rows from "A" that are valid. TWO BIG CAVEATS: - No macros - No filtering (for long and complicated reasons). I feel like it might be possible with vlookup used cleverly, but so far, I'm stumped.

    Read the article

  • Indentation-based Folding for TextMate

    - by Craig Walker
    SASS and HAML have indentation-based syntax, much like Python. Blocks of related code have the same number of spaces at the start of a line. Here's some example code: #drawer height: 100% color: #c2c7c4 font: size: 10px .slider overflow: hidden height: 100% .edge background: url('/images/foo') repeat-y .tab margin-top = !drawer_top width: 56px height: 161px display: block I'm using phuibonhoa's SASS bundle, and I'd like to enhance it so that the various sections can fold. For instance, I'd like to fold everything under #drawer, everything under .slider, everything under .edge, etc. The bundle currently includes the following folding code: foldingStartMarker = '/\*|^#|^\*|^\b|^\.'; foldingStopMarker = '\*/|^\s*$'; How can I enhance this to fold similarly-indented blocks?

    Read the article

  • Can't insert cells in Excel 2010 - "operation not allowed" error message

    - by Force Flow
    I was working on a spreadsheet in Excel 2010, and all of a sudden when I attempted to insert a new row of cells, I saw that the insert and delete options were grayed out. I attempted to copy a different row and insert it as a new row, but I got the error message: "This operation is not allowed. The operation is attempting to shift cells in a table on your worksheet." I have not merged or hidden any cells/rows/columns. There are no formulas. There is no data verification. I tried closing and re-opening the spreadsheet. Searching for answers brings up nothing useful.

    Read the article

  • How to link data in different worksheets

    - by user2961726
    I tried consolidation but I can not get the following to work as it keeps saying no data consolidated. Can somebody try this dummy application and if they figure out how to do the following below can give me a step by step guide so I can attempt myself to learn. I'm not sure if I need to use any coding for this: In the dummy application I have 2 worksheets. One known as "1st", the other "Cases". In the "1st" worksheet you can insert and delete records for the "Case" table at the bottom, what I want to do is insert a row into the Case Table in worksheet "1st" and enter in the data for that row. What should happen is that data should be automatically be updated in the table in the "Cases" worksheet. But I can't seem to get this to work. Also if I delete a row from the table in Worksheet "1st" it should automatically remove that record from the "Cases" worksheet table. Please help. Below is the spreadsheet: http://ge.tt/8sjdkVx/v/0

    Read the article

  • Changing size of window when testing Adobe AIR mobile applications

    - by Peter
    Im making a mobile phone Android application in Flash CS 5.5. I set the width/height of the stage to 480/800 px. When I hit CTRL+ENTER to test run the application I get a window that is 480/800 px. It cannot be resized. I want to change the size of that window WITHOUT changing the stage width/height. For example if I run the APK on a mobile phone with a 1000x1000 display the flash will scale automatically to fit the 480/800 stage to the 1000x1000 screen. So it should be possible to change the window size to 1000x1000 without having to change the stage width/height. But how?

    Read the article

  • Repeat the csv header twice without "Append" (PowerShell 1.0)

    - by Mark
    I have prepared a PowerShell script to export a list of system users in CSV format. The script can output the users list with Export-csv with single header row (the header row at top). However my requirement is to repeat the header row twice in my file. It is easy to achieve in PowerShell 3.0 with "Append" (e.g. $header | out-file $filepath -Append) Our server envirnoment is running PowerShell 1.0. Hence I cannot do it. Is there any workaround? I cannot manually add it myself. Thank you.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Hide/Unhide rows based on more than one cell value

    - by Mike
    Please help me I am using the following code to hide rows if cell values are 0: Private Sub Worksheet_Calculate() Dim LastRow As Long, c As Range Application.EnableEvents = False LastRow = Cells(Cells.Rows.Count, "I").End(xlUp).Row On Error Resume Next For Each c In Range("I9:I48") If c.Value = 0 Then c.EntireRow.Hidden = True ElseIf c.Value > 0 Then c.EntireRow.Hidden = False End If Next On Error GoTo 0 Application.EnableEvents = True End Sub It works perfectly, but I would like for the code to also check column K (the same range K9:K48) if both cells in a row are 0 then the row must be hidden. How can I change the code to do this?

    Read the article

  • C# Bind DataTable to Existing DataGridView Column Definitions

    - by Timothy
    I've been struggling with a NullReferenceException and hope someone here will be able to point me in the right direction. I'm trying to create and populate a DataTable and then show the results in a DataGridView control. The basic code follows, and Execution stops with a NullReferenceException at the point where I invoke the new UpdateResults_Delegate. Oddly enough, I can trace entries.Rows.Count successfully before I return it from QueryEventEntries, so I can at least show 1) entries is not a null reference, and 2) the DataTable contains rows of data. I know I have to be doing something wrong, but I just don't know what. private void UpdateResults(DataTable entries) { dataGridView.DataSource = entries; } private void button_Click(object sender, EventArgs e) { PerformQuery(); } private void PerformQuery() { DateTime start = new DateTime(dateTimePicker1.Value.Year, dateTimePicker1.Value.Month, dateTimePicker1.Value.Day, 0, 0, 0); DateTime stop = new DateTime(dateTimePicker2.Value.Year, dateTimePicker2.Value.Month, dateTimePicker2.Value.Day, 0, 0, 0); DataTable entries = QueryEventEntries(start, stop); UpdateResults(entries); } private DataTable QueryEventEntries(DateTime start, DateTime stop) { DataTable entries = new DataTable(); entries.Columns.AddRange(new DataColumn[] { new DataColumn("event_type", typeof(Int32)), new DataColumn("event_time", typeof(DateTime)), new DataColumn("event_detail", typeof(String))}); using (SqlConnection conn = new SqlConnection(DSN)) { using (SqlDataAdapter adapter = new SqlDataAdapter( "SELECT event_type, event_time, event_detail FROM event_log " + "WHERE event_time >= @start AND event_time <= @stop", conn)) { adapter.SelectCommand.Parameters.AddRange(new Object[] { new SqlParameter("@start", start), new SqlParameter("@stop", stop)}); adapter.Fill(entries); } } return entries; } Update I'd like to summarize and provide some additional information I've learned from the discussion here and debugging efforts since I originally posted this question. I am refactoring old code that retrieved records from a database, collected those records as an array, and then later iterated through the array to populate a DataGridView row by row. Threading was originally implemented to compensate and keep the UI responsive during the unnecessary looping. I have since stripped out Thread/Invoke; everything now occurs on the same execution thread (thank you, Sam). I am attempting to replace the slow, unwieldy approach using a DataTable which I can fill with a DataAdapter, and assign to the DataGridView through it's DataSource property (above code updated). I've iterated through the entries DataTable's rows to verify the table contains the expected data before assigning it as the DataGridView's DataSource. foreach (DataRow row in entries.Rows) { System.Diagnostics.Trace.WriteLine( String.Format("{0} {1} {2}", row[0], row[1], row[2])); } One of the column of the DataGridView is a custom DataGridViewColumn to stylize the event_type value. I apologize I didn't mention this before in the original post but I wasn't aware it was important to my problem. I have converted this column temporarily to a standard DataGridViewTextBoxColumn control and am no longer experiencing the Exception. The fields in the DataTable are appended to the list of fields that have been pre-specified in Design view of the DataGridView. The records' values are being populated in these appended fields. When the run time attempts to render the cell a null value is provided (as the value that should be rendered is done so a couple columns over). In light of this, I am re-titling and re-tagging the question. I would still appreciate it if others who have experienced this can instruct me on how to go about binding the DataTable to the existing column definitions of the DataGridView.

    Read the article

  • Delphi Indy IDHTTP question

    - by user327175
    I am trying to get the captcha image from a AOL, and i keep getting an error 418. unit imageunit; /// /// h t t p s://new.aol.com/productsweb/ /// interface uses Windows, Messages, SysUtils, Variants, Classes, Graphics, Controls, Forms, Dialogs, StdCtrls, IdIOHandler, IdIOHandlerSocket, IdIOHandlerStack, IdSSL, IdSSLOpenSSL, IdIntercept, IdZLibCompressorBase, IdCompressorZLib, IdCookieManager, IdBaseComponent, IdComponent, IdTCPConnection, IdTCPClient, IdHTTP,jpeg,GIFImg, ExtCtrls; type TForm2 = class(TForm) IdHTTP1: TIdHTTP; IdCookieManager1: TIdCookieManager; IdCompressorZLib1: TIdCompressorZLib; IdConnectionIntercept1: TIdConnectionIntercept; IdSSLIOHandlerSocketOpenSSL1: TIdSSLIOHandlerSocketOpenSSL; Panel1: TPanel; Image1: TImage; Panel2: TPanel; Button1: TButton; Edit1: TEdit; procedure Button1Click(Sender: TObject); private { Private declarations } public { Public declarations } end; var Form2: TForm2; implementation {$R *.dfm} procedure TForm2.Button1Click(Sender: TObject); var JPI : TJPEGImage; streamdata:TMemoryStream; begin streamdata := TMemoryStream.Create; try idhttp1.Get(edit1.Text, Streamdata); Except { Handle exceptions } On E : Exception Do Begin MessageDlg('Exception: '+E.Message,mtError, [mbOK], 0); End; End; //h t t p s://new.aol.com/productsweb/WordVerImage?20890843 //h t t p s://new.aol.com/productsweb/WordVerImage?91868359 /// /// gives error 418 unused /// streamdata.Position := 0; JPI := TJPEGImage.Create; Try JPI.LoadFromStream ( streamdata ); Finally Image1.Picture.Assign ( JPI ); JPI.Free; streamdata.Free; End; end; end. Form: object Form2: TForm2 Left = 0 Top = 0 Caption = 'Form2' ClientHeight = 247 ClientWidth = 480 Color = clBtnFace Font.Charset = DEFAULT_CHARSET Font.Color = clWindowText Font.Height = -11 Font.Name = 'Tahoma' Font.Style = [] OldCreateOrder = False PixelsPerInch = 96 TextHeight = 13 object Panel1: TPanel Left = 0 Top = 41 Width = 480 Height = 206 Align = alClient TabOrder = 0 ExplicitLeft = -8 ExplicitTop = 206 ExplicitHeight = 41 object Image1: TImage Left = 1 Top = 1 Width = 478 Height = 204 Align = alClient ExplicitLeft = 5 ExplicitTop = 17 ExplicitWidth = 200 ExplicitHeight = 70 end end object Panel2: TPanel Left = 0 Top = 0 Width = 480 Height = 41 Align = alTop TabOrder = 1 ExplicitLeft = 40 ExplicitTop = 32 ExplicitWidth = 185 object Button1: TButton Left = 239 Top = 6 Width = 75 Height = 25 Caption = 'Button1' TabOrder = 0 OnClick = Button1Click end object Edit1: TEdit Left = 16 Top = 8 Width = 217 Height = 21 TabOrder = 1 end end object IdHTTP1: TIdHTTP Intercept = IdConnectionIntercept1 IOHandler = IdSSLIOHandlerSocketOpenSSL1 MaxAuthRetries = 100 AllowCookies = True HandleRedirects = True RedirectMaximum = 100 ProxyParams.BasicAuthentication = False ProxyParams.ProxyPort = 0 Request.ContentLength = -1 Request.Accept = 'image/gif, image/jpeg, image/pjpeg, image/pjpeg, application/x-s' + 'hockwave-flash, application/cade, application/xaml+xml, applicat' + 'ion/vnd.ms-xpsdocument, application/x-ms-xbap, application/x-ms-' + 'application, /' Request.BasicAuthentication = False Request.Referer = 'http://www.yahoo.com' Request.UserAgent = 'Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.9.2.1) Gecko/201001' + '22 firefox/3.6.1' HTTPOptions = [hoForceEncodeParams] CookieManager = IdCookieManager1 Compressor = IdCompressorZLib1 Left = 240 Top = 80 end object IdCookieManager1: TIdCookieManager Left = 360 Top = 136 end object IdCompressorZLib1: TIdCompressorZLib Left = 368 Top = 16 end object IdConnectionIntercept1: TIdConnectionIntercept Left = 304 Top = 72 end object IdSSLIOHandlerSocketOpenSSL1: TIdSSLIOHandlerSocketOpenSSL Intercept = IdConnectionIntercept1 MaxLineAction = maException Port = 0 DefaultPort = 0 SSLOptions.Mode = sslmUnassigned SSLOptions.VerifyMode = [] SSLOptions.VerifyDepth = 0 Left = 192 Top = 136 end end If you go to: h t t p s://new.aol.com/productsweb/ you will notice the captcha image has a url like: h t t p s://new.aol.com/productsweb/WordVerImage?91868359 I put that url in the edit box and get an error. What is wrong with this code.

    Read the article

  • Drawing a WPF UserControl with DataBinding to an Image

    - by LorenVS
    Hey Everyone, So I'm trying to use a WPF User Control to generate a ton of images from a dataset where each item in the dataset would produce an image... I'm hoping I can set it up in such a way that I can use WPF databinding, and for each item in the dataset, create an instance of my user control, set the dependency property that corresponds to my data item, and then draw the user control to an image, but I'm having problems getting it all working (not sure whether databinding or drawing to the image is my problem) Sorry for the massive code dump, but I've been trying to get this working for a couple of hours now, and WPF just doesn't like me (have to learn at some point though...) My User Control looks like this: <UserControl x:Class="Bleargh.ImageTemplate" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:c="clr-namespace:Bleargh" x:Name="ImageTemplateContainer" Height="300" Width="300"> <Canvas> <TextBlock Canvas.Left="50" Canvas.Top="50" Width="200" Height="25" FontSize="16" FontFamily="Calibri" Text="{Binding Path=Booking.Customer,ElementName=ImageTemplateContainer}" /> <TextBlock Canvas.Left="50" Canvas.Top="100" Width="200" Height="25" FontSize="16" FontFamily="Calibri" Text="{Binding Path=Booking.Location,ElementName=ImageTemplateContainer}" /> <TextBlock Canvas.Left="50" Canvas.Top="150" Width="200" Height="25" FontSize="16" FontFamily="Calibri" Text="{Binding Path=Booking.ItemNumber,ElementName=ImageTemplateContainer}" /> <TextBlock Canvas.Left="50" Canvas.Top="200" Width="200" Height="25" FontSize="16" FontFamily="Calibri" Text="{Binding Path=Booking.Description,ElementName=ImageTemplateContainer}" /> </Canvas> </UserControl> And I've added a dependency property of type "Booking" to my user control that I'm hoping will be the source for the databound values: public partial class ImageTemplate : UserControl { public static readonly DependencyProperty BookingProperty = DependencyProperty.Register("Booking", typeof(Booking), typeof(ImageTemplate)); public Booking Booking { get { return (Booking)GetValue(BookingProperty); } set { SetValue(BookingProperty, value); } } public ImageTemplate() { InitializeComponent(); } } And I'm using the following code to render the control: List<Booking> bookings = Booking.GetSome(); for(int i = 0; i < bookings.Count; i++) { ImageTemplate template = new ImageTemplate(); template.Booking = bookings[i]; RenderTargetBitmap bitmap = new RenderTargetBitmap( (int)template.Width, (int)template.Height, 120.0, 120.0, PixelFormats.Pbgra32); bitmap.Render(template); BitmapEncoder encoder = new PngBitmapEncoder(); encoder.Frames.Add(BitmapFrame.Create(bitmap)); using (Stream s = File.OpenWrite(@"C:\Code\Bleargh\RawImages\" + i.ToString() + ".png")) { encoder.Save(s); } } EDIT: I should add that the process works without any errors whatsoever, but I end up with a directory full of plain-white images, not text or anything... And I have confirmed using the debugger that my Booking objects are being filled with the proper data... EDIT 2: Did something I should have done a long time ago, set a background on my canvas, but that didn't change the output image at all, so my problem is most definitely somehow to do with my drawing code (although there may be something wrong with my databinding too)

    Read the article

  • Scaling MKMapView Annotations relative to the zoom level

    - by Jonathan
    The Problem I'm trying to create a visual radius circle around a annonation, that remains at a fixed size in real terms. Eg. So If i set the radius to 100m, as you zoom out of the Map view the radius circle gets progressively smaller. I've been able to achieve the scaling, however the radius rect/circle seems to "Jitter" away from the Pin Placemark as the user manipulates the view. The Manifestation Here is a video of the behaviour. The Implementation The annotations are added to the Mapview in the usual fashion, and i've used the delegate method on my UIViewController Subclass (MapViewController) to see when the region changes. -(void)mapView:(MKMapView *)pMapView regionDidChangeAnimated:(BOOL)animated{ //Get the map view MKCoordinateRegion region; CGRect rect; //Scale the annotations for( id<MKAnnotation> annotation in [[self mapView] annotations] ){ if( [annotation isKindOfClass: [Location class]] && [annotation conformsToProtocol:@protocol(MKAnnotation)] ){ //Approximately 200 m radius region.span.latitudeDelta = 0.002f; region.span.longitudeDelta = 0.002f; region.center = [annotation coordinate]; rect = [[self mapView] convertRegion:foo toRectToView: self.mapView]; if( [[[self mapView] viewForAnnotation: annotation] respondsToSelector:@selector(setRadiusFrame:)] ){ [[[self mapView] viewForAnnotation: annotation] setRadiusFrame:rect]; } } } The Annotation object (LocationAnnotationView)is a subclass of the MKAnnotationView and it's setRadiusFrame looks like this -(void) setRadiusFrame:(CGRect) rect{ CGPoint centerPoint; //Invert centerPoint.x = (rect.size.width/2) * -1; centerPoint.y = 0 + 55 + ((rect.size.height/2) * -1); rect.origin = centerPoint; [self.radiusView setFrame:rect]; } And finally the radiusView object is a subclass of a UIView, that overrides the drawRect method to draw the translucent circles. setFrame is also over ridden in this UIView subclass, but it only serves to call [UIView setNeedsDisplay] in addition to [UIView setFrame:] to ensure that the view is redrawn after the frame has been updated. The radiusView object's (CircleView) drawRect method looks like this -(void) drawRect:(CGRect)rect{ //NSLog(@"[CircleView drawRect]"); [self setBackgroundColor:[UIColor clearColor]]; //Declarations CGContextRef context; CGMutablePathRef path; //Assignments context = UIGraphicsGetCurrentContext(); path = CGPathCreateMutable(); //Alter the rect so the circle isn't cliped //Calculate the biggest size circle if( rect.size.height > rect.size.width ){ rect.size.height = rect.size.width; } else if( rect.size.height < rect.size.width ){ rect.size.width = rect.size.height; } rect.size.height -= 4; rect.size.width -= 4; rect.origin.x += 2; rect.origin.y += 2; //Create paths CGPathAddEllipseInRect(path, NULL, rect ); //Create colors [[self areaColor] setFill]; CGContextAddPath( context, path); CGContextFillPath( context ); [[self borderColor] setStroke]; CGContextSetLineWidth( context, 2.0f ); CGContextSetLineCap(context, kCGLineCapSquare); CGContextAddPath(context, path ); CGContextStrokePath( context ); CGPathRelease( path ); //CGContextRestoreGState( context ); } Thanks for bearing with me, any help is appreciated. Jonathan

    Read the article

  • Creating a GraphicsPath from a semi-transparent bitmap

    - by Moozhe
    I want to create a GraphicsPath and a list of Points to form the outline of the non-transparent area of a bitmap. If needed, I can guarantee that each image has only one solid collection of nontransparent pixels. So for example, I should be able to record the points either clockwise or counter-clockwise along the edge of the pixels and perform a full closed loop. The speed of this algorithm is not important. However, the efficiency of the resulting points is semi-important if I can skip some points to reduce in a smaller and less complex GraphicsPath. I will list my current code below which works perfectly with most images. However, some images which are more complex end up with paths which seem to connect in the wrong order. I think I know why this occurs, but I can't come up with a solution. public static Point[] GetOutlinePoints(Bitmap image) { List<Point> outlinePoints = new List<Point>(); BitmapData bitmapData = image.LockBits(new Rectangle(0, 0, image.Width, image.Height), ImageLockMode.ReadOnly, PixelFormat.Format32bppArgb); byte[] originalBytes = new byte[image.Width * image.Height * 4]; Marshal.Copy(bitmapData.Scan0, originalBytes, 0, originalBytes.Length); for (int x = 0; x < bitmapData.Width; x++) { for (int y = 0; y < bitmapData.Height; y++) { byte alpha = originalBytes[y * bitmapData.Stride + 4 * x + 3]; if (alpha != 0) { Point p = new Point(x, y); if (!ContainsPoint(outlinePoints, p)) outlinePoints.Add(p); break; } } } for (int y = 0; y < bitmapData.Height; y++) { for (int x = bitmapData.Width - 1; x >= 0; x--) { byte alpha = originalBytes[y * bitmapData.Stride + 4 * x + 3]; if (alpha != 0) { Point p = new Point(x, y); if (!ContainsPoint(outlinePoints, p)) outlinePoints.Add(p); break; } } } for (int x = bitmapData.Width - 1; x >= 0; x--) { for (int y = bitmapData.Height - 1; y >= 0; y--) { byte alpha = originalBytes[y * bitmapData.Stride + 4 * x + 3]; if (alpha != 0) { Point p = new Point(x, y); if (!ContainsPoint(outlinePoints, p)) outlinePoints.Add(p); break; } } } for (int y = bitmapData.Height - 1; y >= 0; y--) { for (int x = 0; x < bitmapData.Width; x++) { byte alpha = originalBytes[y * bitmapData.Stride + 4 * x + 3]; if (alpha != 0) { Point p = new Point(x, y); if (!ContainsPoint(outlinePoints, p)) outlinePoints.Add(p); break; } } } // Added to close the loop outlinePoints.Add(outlinePoints[0]); image.UnlockBits(bitmapData); return outlinePoints.ToArray(); } public static bool ContainsPoint(IEnumerable<Point> points, Point value) { foreach (Point p in points) { if (p == value) return true; } return false; } And when I turn the points into a path: GraphicsPath outlinePath = new GraphicsPath(); outlinePath.AddLines(_outlinePoints); Here's an example showing what I want. The red outline should be an array of points which can be made into a GraphicsPath in order to perform hit detection, draw an outline pen, and fill it with a brush.

    Read the article

  • Getting values from Dynamic elements.

    - by nCdy
    I'm adding some dynamic elements to my WebApp this way : (Language used is Nemerele (It has a simple C#-like syntax)) unless (GridView1.Rows.Count==0) { foreach(index with row = GridView1.Rows[index] in [0..GridView1.Rows.Count-1]) { row.Cells[0].Controls.Add ({ def TB = TextBox(); TB.EnableViewState = false; unless(row.Cells[0].Text == "&nbsp;") { TB.Text = row.Cells[0].Text; row.Cells[0].Text = ""; } TB.ID=TB.ClientID; TB.Width = 60; TB }); row.Cells[0].Controls.Add ({ def B = Button(); B.EnableViewState = false; B.Width = 80; B.Text = "?????????"; B.UseSubmitBehavior=false; // Makes no sense //B.OnClientClick="select(5);"; // HERE I CAN KNOW ABOUT TB.ID //B.Click+=EventHandler(fun(_,_) : void { }); // POST BACK KILL THAT ALL B }); } } This textboxes must make first field of GridView editable so ... but now I need to save a values. I can't do it on server side because any postback will Destroy all dynamic elements so I must do it without Post Back. So I try ... <script type="text/javascript" src="Scripts/jquery-1.4.1.min.js"></script> <script type="text/javascript"> function CallPageMethod(methodName, onSuccess, onFail) { var args = ''; var l = arguments.length; if (l > 3) { for (var i = 3; i < l - 1; i += 2) { if (args.length != 0) args += ','; args += '"' + arguments[i] + '":"' + arguments[i + 1] + '"'; } } var loc = window.location.href; loc = (loc.substr(loc.length - 1, 1) == "/") ? loc + "Report.aspx" : loc; $.ajax({ type: "POST", url: loc + "/" + methodName, data: "{" + args + "}", contentType: "application/json; charset=utf-8", dataType: "json", success: onSuccess, fail: onFail }); } function select(index) { var id = $("#id" + index).html(); CallPageMethod("SelectBook", success, fail, "id",id); } function success(response) { alert(response.d); } function fail(response) { alert("&#1054;&#1096;&#1080;&#1073;&#1082;&#1072;."); } </script> So... here is a trouble string : var id = $("#id" + index).html(); I know what is ID here : TB.ID=TB.ClientID; (when I add it) but I have no idea how to send it on Web Form. If I can add something like this div : <div id="Result" onclick="select(<%= " TB.ID " %>);"> Click here. </div> from the code it will be really goal, but I can't add this element as from CodeBehind as a dynamic element. So how can I transfer TB.ID or TB.ClientID to some static div Or how can I add some clickable dynamic element without PostBack to not destroy all my dynamic elements. Thank you.

    Read the article

  • How to have two UIPickerViews together in one ViewController?

    - by 0SX
    I'm trying to put 2 UIPickerViews together in one ViewController. Each UIPickerView has different data arrays. I'm using interface builder to link the pickers up. I know I'll have to use separate delegates and dataSources but I can't seem to hook everything up with interface builder correctly. Here's all my code: pickerTesting.h #import <UIKit/UIKit.h> #import "picker2DataSource.h" @interface pickerTestingViewController : UIViewController <UIPickerViewDelegate, UIPickerViewDataSource>{ IBOutlet UIPickerView *picker; IBOutlet UIPickerView *picker2; NSMutableArray *pickerViewArray; } @property (nonatomic, retain) IBOutlet UIPickerView *picker; @property (nonatomic, retain) IBOutlet UIPickerView *picker2; @property (nonatomic, retain) NSMutableArray *pickerViewArray; @end pickerTesting.m #import "pickerTestingViewController.h" @implementation pickerTestingViewController @synthesize picker, picker2, pickerViewArray; - (void)viewDidLoad { [super viewDidLoad]; pickerViewArray = [[NSMutableArray alloc] init]; [pickerViewArray addObject:@" 100 "]; [pickerViewArray addObject:@" 200 "]; [pickerViewArray addObject:@" 400 "]; [pickerViewArray addObject:@" 600 "]; [pickerViewArray addObject:@" 1000 "]; [picker selectRow:1 inComponent:0 animated:NO]; picker2.delegate = self; picker2.dataSource = self; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker; { return 1; } - (void)pickerView:(UIPickerView *)picker didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker numberOfRowsInComponent:(NSInteger)component; { return [pickerViewArray count]; } - (NSString *)pickerView:(UIPickerView *)picker titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [pickerViewArray objectAtIndex:row]; } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end And I have a separate class for the other datasource. picker2DataSource.h @interface picker2DataSource : NSObject <UIPickerViewDataSource, UIPickerViewDelegate> { NSMutableArray *customPickerArray; } @property (nonatomic, retain) NSMutableArray *customPickerArray; @end picker2DataSource.m #import "picker2DataSource.h" @implementation picker2DataSource @synthesize customPickerArray; - (id)init { // use predetermined frame size self = [super init]; if (self) { customPickerArray = [[NSMutableArray alloc] init]; [customPickerArray addObject:@" a "]; [customPickerArray addObject:@" b "]; [customPickerArray addObject:@" c "]; [customPickerArray addObject:@" d "]; [customPickerArray addObject:@" e "]; } return self; } - (void)dealloc { [customPickerArray release]; [super dealloc]; } - (NSInteger)numberOfComponentsInPickerView:(UIPickerView *)picker2; { return 1; } - (void)pickerView:(UIPickerView *)picker2 didSelectRow:(NSInteger)row inComponent:(NSInteger)component { } - (NSInteger)pickerView:(UIPickerView *)picker2 numberOfRowsInComponent:(NSInteger)component; { return [customPickerArray count]; } - (NSString *)pickerView:(UIPickerView *)picker2 titleForRow:(NSInteger)row forComponent:(NSInteger)component; { return [customPickerArray objectAtIndex:row]; } @end Any help or code examples would be great. Thanks.

    Read the article

< Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >