Search Results

Search found 9970 results on 399 pages for 'regular john'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 165/399 | < Previous Page | 161 162 163 164 165 166 167 168 169 170 171 172  | Next Page >

  • What's the smallest DirectX installer I can distribute in my Software?

    - by John
    My application uses DirectX 9.0c. There are many installers for the end-user run-times, ranging from 400Kb to 100Mb+ and obviously I don't want to bloat my installer file. However, I believe there are potentially legal restrictions which mean I can't just distribute whichever MS installers I might choose. This is the one I'd ideally like to include, is it the best /correct one?

    Read the article

  • Color Themes for Eclipse?

    - by John Stauffer
    I am a recovering Emacs user, who is trying to ease into Eclipse usage. (Since I'm encouraging the rest of the team to use it, I guess I should at least try to get along). My current excuse is that it hurts my eyes. I'm currently using the excellent zenburn theme in emacs, and would love to find it for eclipse. However, I find that changing my color theme every few months makes for a great way to procrastinate, so ideally I'd like to find a repository for eclipse color themes. There don't appear to be any eclipse themes indexed by Google, so all the great themes must be sitting on your hard disk somewhere. Please share them. Thanks

    Read the article

  • A Surface view and a canvas to move Bitmap

    - by John Apple Sim
    I have a SurfaceView and I want the Bitmap Logo inside it in the canvas to be movable What I'm doing wrong ? static float x, y; Bitmap logo; SurfaceView ss = (SurfaceView) findViewById(R.id.svSS); logo = BitmapFactory.decodeResource(getResources(), R.drawable.logo); x = 40; y = 415; ss.setOnTouchListener(new View.OnTouchListener() { @Override public boolean onTouch(View v, MotionEvent me) { try { Thread.sleep(50); } catch (InterruptedException e) { e.printStackTrace(); } switch(me.getAction()) { case MotionEvent.ACTION_DOWN: x = me.getX(); y = me.getY(); break; case MotionEvent.ACTION_UP: x = me.getX(); y = me.getY(); break; case MotionEvent.ACTION_MOVE: x = me.getX(); y = me.getY(); break; } return true; } }); public class OurView extends SurfaceView implements Runnable{ Thread t = null; SurfaceHolder holder; boolean isItOK = false; public OurView(Context context) { super(context); holder = getHolder(); } public void run (){ while (isItOK == true){ //canvas DRAWING if (!holder.getSurface().isValid()){ continue; } Canvas c = holder.lockCanvas(); c.drawARGB(255, 200, 100, 100); c.drawBitmap(logo, x,y,null); holder.unlockCanvasAndPost(c); } } public void pause(){ isItOK = false; while(true){ try { t.join(); } catch (InterruptedException e) { e.printStackTrace(); } break; } t = null; } public void resume(){ isItOK = true; t = new Thread(this); t.start(); } } Now the surface view is just black .. nothing happens also its not colored 200, 100, 100

    Read the article

  • How to display only selected data in combo box at run time from database?

    - by Joy1979
    I am new to .Net and I am working on one task. Below is my scenario. I have 2 tables: Table 1: Students StudentID StudentDetail 1 StudentName 2 StudentGrade Table 2: Student_data StudentDetail StudentRecords StudentName John (Default) StudentName Jacob StudentName Smith StudentGrade A (default) StudentGrade B StudentGrade C Question: When window form loads (run time) I need to display StudentRecords in combo box with StudentName = "John" and StudentGrade = "A" as default followed by other values. StudentName and StudentRecords are in Labels and values are in a ComboBox. I am using VB.Net and VS 2010 with SQL 2008r2. I would appreciate any step by step help. Apologies If my request is simple.

    Read the article

  • Where is the best place to call the .tolist(); inside my controller classes or inside my model repository classes

    - by john G
    I have the following action method, inside my asp.net mvc web application:- public JsonResult LoadZoneByDataCenter(string id) { var zonelist = repository.getrealtedzone(Convert.ToInt32(id)).ToList(); //code goes here Which calls the following model repository method:- public IQueryable<Zone> getrealtedzone(int? dcid) { return tms.Zones.Where(a=> a.DataCenterID == dcid || dcid == null); } Currently I am calling the .tolist() which will interpret the Database from my action method, but my question is where is the best place to call the .tolist() inside the controller or inside the model classes and why ? thanks

    Read the article

  • C++ Multiple Inheritance Question

    - by John
    The scenario generating this is quite complex so I'll strip out a few pieces and give an accurate representation of the classes involved. /* This is inherited using SI by many classes, as normal */ class IBase { virtual string toString()=0; }; /* Base2 can't inherit IBase due to other methods on IBase which aren't appropriate */ class Base2 { string toString() { ... } }; /* a special class, is this valid? */ class Class1 : public IBase, public Base2 { }; So, is this valid? Will there be conflicts on the toString? Or can Class1 use Base2::toString to satisfy IBase? Like I say there are lots of other things not shown, so suggestions for major design changes on this example are probably not that helpful... though any general suggestions/advice are welcome.

    Read the article

  • Do you think Microsoft is finally on the right track with its Windows 7?

    - by Saif Bechan
    It has been a while now since Windows 7 has been released. So far I didn't hear of many major complaints about it. I can remember the time that Windows Vista hist the shelves. There were major complaints from both experts and just regular users. I do a lot of OS installs for just regular users. These are mostly family and friends, and sometimes there are some customers. Up till now I mostly still use Windows XP SP3, because it is stable and most people are familiar with it. I did Vista for some users but they always call me back with all sorts of questions and in the end I had to downgrade them to XP. Do you think it is safe now to recommend Windows 7 as a good operating system? Offcourse their hardware has to support it, but let's say that is the case. If you install Windows 7 a lot for people, what are the complaints about if you get them?

    Read the article

  • Sending XML to Servlet from Action Script

    - by John Doe
    I am only getting empty arrays on output. Anyone know what Exactly I'm doing wrong? package myDungeonAccessor; /* * To change this template, choose Tools | Templates * and open the template in the editor. */ import java.io.IOException; import java.io.ObjectInputStream; import java.io.ObjectOutputStream; import java.io.PrintWriter; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; public class myDungeonAccessorServlet extends HttpServlet { private myDungeonAccessor dataAccessor; /** * Processes requests for both HTTP <code>GET</code> and <code>POST</code> methods. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ protected void processRequest(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { response.setContentType("text/html;charset=UTF-8"); PrintWriter out = response.getWriter(); try { /* TODO output your page here out.println("<html>"); out.println("<head>"); out.println("<title>Servlet myDungeonAccessorServlet</title>"); out.println("</head>"); out.println("<body>"); out.println("<h1>Servlet myDungeonAccessorServlet at " + request.getContextPath () + "</h1>"); out.println("</body>"); out.println("</html>"); */ } finally { out.close(); } } // <editor-fold defaultstate="collapsed" desc="HttpServlet methods. Click on the + sign on the left to edit the code."> /** * Handles the HTTP <code>GET</code> method. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ @Override protected void doGet(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { processRequest(request, response); // PrintWriter out = response.getWriter(); System.out.println("yo mom"); } /** * Handles the HTTP <code>POST</code> method. * @param request servlet request * @param response servlet response * @throws ServletException if a servlet-specific error occurs * @throws IOException if an I/O error occurs */ @Override protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { //System.out.println("heppo"); //dataAccessor = new myDungeonAccessor(); System.out.println("Hello"); try { System.out.println("HEADERS: " + request.getHeaderNames()); ObjectInputStream in = new ObjectInputStream(request.getInputStream()); ObjectOutputStream out = new ObjectOutputStream(response.getOutputStream()); } catch(Exception e) { e.printStackTrace(); } System.out.println("WAZZUP"); byte [] buffer = new byte[4096]; //in.read(buffer); System.out.println("TEST!"); String s = new String(buffer); System.out.println("Update S:" + s); } /** * Returns a short description of the servlet. * @return a String containing servlet description */ @Override public String getServletInfo() { return "Short description"; } }

    Read the article

  • Why does Apple create it's views this way

    - by John Smith
    In the hope of fixing a bug of mine from another post i would like to know why apple writes this (for it's Elements example) UIView *localContainerView = [[UIView alloc] initWithFrame:[[UIScreen mainScreen] applicationFrame]]; self.containerView = localContainerView; [localContainerView release]; instead of the simpler method: containerView = [[UIView alloc] initWithFrame:[[UIScreen mainScreen] applicationFrame]]; ?

    Read the article

  • What is a simple way to add a timer to a method

    - by John
    The following is in C#. I'm trying to do something very simple (I think). I have a method that loads an XML document XDocument doc = XDocument.Load(uri); , but I don't want to tie up pc resources if there are issues (connectivity, document size, etc.). So I'd like to be able to add a timeout variable that will cut the method off after a given number of seconds. I'm a newbie when it comes to asynchronous programming and find it confusing that there are so many examples written so many different ways . . . and none of them appear simple. I'd like a simple solution, if possible. Here's my thoughts so far on possible solution paths: 1) A method that wraps the existing load public XDocument LoadXDocument(string uri, int timeout){ //code } 2) A wrapper, but as an extension method XDocument doc = XDocument.LoadWithTimeout(string uri, int timeout); 3) A generic extension method. Object obj = SomeStaticClass.LoadWithTimeout(??? method, int timeout); 3), on its face seems really nice, because it would mean being able to generically add timeouts to many different method calls and not specifically tied to one type of object, but I suspect that it is either i)impossible or ii) very difficult. Please assist. Thanks.

    Read the article

  • Microsoft learning support for VS2010

    - by John
    OK, I am a big fan of WPF, and while it is large area to fully understand, Microsoft has been great in posting loads of training video at http://windowsclient.net/learn/videos_wpf.aspx However with the release of 2010 it all seams to have gone very quiet. I expected a lot of the support to be updated for 2010 and I also expected a lot of new videos on the best way to use the new features in 2010. Currently I find myself working through videos based on 2008 (or even 2005) and trying to apply them to 2010. Don't get me wrong it not that I mind doing this, it just that I fear I may be learning methods which have better or different solutions in 2010. It is just me expecting too much of Microsoft, or have I missed out on a new website?

    Read the article

  • Search backward through a string using a regex (in Python)?

    - by John Mulder
    I'm parsing some code and want to match the doxygen comments before a function. However, because I want to match for a specific function name, getting only the immediately previous comment is giving me problems. Is there a way to search backward through a string using the Python Regex library? Is there a better (easier) approach that I'm missing?

    Read the article

  • I wired up a z 80 using telephone wire and put a jump to 0000 0000 0000 0000

    - by john
    I put 1100 0011 0000 0000 0000 0000 in the 2764 eprom --- this is supposed to test the z80 -- I have a 555 timer running at 500 khz. Can this small program work with the z80 ? I looked at the address pins on a m465 oscilloscope. The address shows highs up to 0100 0000. I think it should only count to 0000 0000 0000 0011. Can the z80 be tested? The Santa Clara Valley also made the lm1871 radio control chip that could not show a high or a low without completing the entire rc loop.

    Read the article

  • Problem deleting .svn directories on Windows XP

    - by John L
    I don't seem to have this problem on my home laptop with Windows XP, but then I don't do much work there. On my work laptop, with Windows XP, I have a problem deleting directories when it has directories that contain .svn directories. When it does eventually work, I have the same issue emptying the Recycle bin. The pop-up window says "Cannot remove folder text-base: The directory is not empty" or prop-base or other folder under .svn This continued to happen after I changed config of TortoiseSVN to stop the TSVN cache process from running and after a reboot of the system. Multiple tries will eventually get it done. But it is a huge annoyance because there are other issues I'm trying to fix, so I'm hoping it is related. 'Connected Backup PC' also runs on the laptop and the real problem is that cygwin commands don't always work. So I keep thinking the dot files and dot directories have something to do with both problems and/or the backup or other process scanning the directories is doing it. But I've run out of ideas of what to try or how to identify the problem further.

    Read the article

  • Checking deployed port in ruby on rails application

    - by john chan
    Is there an elegant way to check which port you deployed a ruby on rails application using mongrel? I could not find a directive (i.e. such as #{RAILS_ROOT} which contains the root directory of the application) that I can use to perform a check. I need this to do a check since I am deploying the same application on different ports and I need the app to do different things according to the port that is being accessed. Any help would be appreciated, Thanks

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • PHP - How can I check if return() was called from an include()'d file?

    - by John Himmelman
    How can I tell if return() was called from within the included file. The problem is that include() returns 'int 1', even if return() wasn't called. Here is an example... included_file_1.php <?php return 1; included_file_2.php <?php echo 'no return here, meep'; main.php <?php $ret = include('included_file_1.php'); // This file DID return a value, int 1, but include() returns this value even if return() wasn't called in the included file. if ($ret === 1) { echo 'file did not return anything'; } var_dump($ret); $ret = include('included_file_2.php'); // The included file DID NOT return a value, but include() returns 'int 1' if ($ret === 1) { echo 'file did not return anything'; } var_dump($ret);

    Read the article

  • very strange thread error message

    - by John Smith
    I an trying to put a method in a separate thread in the background. It nearly works except that occasionally I get a lot of error messages with the message METHODCLOSURE: OH NO SEPERATE THREAD with the bad spelling and all. Does anyone know what this means?

    Read the article

  • Flash Sprite looses focus on MOUSE_DOWN event

    - by John
    My Sprite class keeps losing focus when I click with the mouse - specifically after the MOUSE_DOWN event (before the click is complete). I have set mouseEnabled to false on the children, no change. I added a listener for FOCUS_OUT and noticed that the FocusEvent.relatedObject property is NULL, which is confusing me - doesn't that mean there is no new focus target, the focus is just getting lost? The exact sequence of events I get, by tracing them, as I click: [FocusEvent type="focusOut" bubbles=true cancelable=false eventPhase=2 relatedObject=null shiftKey=false keyCode=0] [MouseEvent type="mouseDown" bubbles=true cancelable=false eventPhase=2 localX=355 localY=362 stageX=360 stageY=367 relatedObject=null ctrlKey=false altKey=false shiftKey=false buttonDown=true delta=0]) [MouseEvent type="click" bubbles=true cancelable=false eventPhase=2 localX=355 localY=362 stageX=360 stageY=367 relatedObject=null ctrlKey=false altKey=false shiftKey=false buttonDown=false delta=0]

    Read the article

  • How do I use grep to extract a specific field value from lines

    - by Stormshadow
    I have lines in a file which look like the following ....... DisplayName="john" .......... where .... represents variable number of other fields. Using the following grep command, I am able to extract all the lines which have a valid 'DisplayName' field grep DisplayName="[0-9A-Za-z[:space:]]*" e:\test However, I wish to extract just the name (ie "john") from each line instead of the whole line which is returned by grep. I tried pipelining the output to the cut command but it does not accept string delimiters.

    Read the article

  • Reading a simple Avro file from HDFS

    - by John Galt... who
    I am trying to do a simple read of an Avro file stored in HDFS. I found out how to read it when it is on the local file system.... FileReader reader = DataFileReader.openReader(new File(filename), new GenericDatumReader()); for (GenericRecord datum : fileReader) { String value = datum.get(1).toString(); System.out.println("value = " value); } reader.close(); My file is in HDFS, however. I cannot give the openReader a Path or an FSDataInputStream. How can I simply read an Avro file in HDFS? EDIT: I got this to work by creating a custom class (SeekableHadoopInput) that implements SeekableInput. I "stole" this from "Ganglion" on github. Still, seems like there would be a Hadoop/Avro integration path for this. Thanks

    Read the article

  • Using my custom colormap in Java for images

    - by John
    Hi everyone! I've got a question concering a colormapping via index. I tried this code found on http://www.podgoretsky.pri.ee/ftp/Docs/Java/Tricks%20of%20the%20Java%20Programming%20Gurus/ch12.htm // Gradient.java // Imports import java.applet.Applet; import java.awt.; import java.awt.image.; public class Gradient extends Applet { final int colors = 32; final int width = 200; final int height = 200; Image img; public void init() { // Create the color map byte[] rbmap = new byte[colors]; byte[] gmap = new byte[colors]; for (int i = 0; i < colors; i++) gmap[i] = (byte)((i * 255) / (colors - 1)); // Create the color model int bits = (int)Math.ceil(Math.log(colors) / Math.log(2)); IndexColorModel model = new IndexColorModel(bits, colors, rbmap, gmap, rbmap); // Create the pixels int pixels[] = new int[width * height]; int index = 0; for (int y = 0; y < height; y++) for (int x = 0; x < width; x++) pixels[index++] = (x * colors) / width; // Create the image img = createImage(new MemoryImageSource(width, height, model, pixels, 0, width)); } public void paint(Graphics g) { g.drawImage(img, 0, 0, this); } } It worked great but I tried to load a custom image jpeg mapped on my own colormap but it didnt work right. I saw only a bunch of green and blue pixels drawn on a white background. My custom color map method here: public void inintByteArrays() { double[][] c = // basic color map { { 0.0000, 0.0000, 0.5625 }, { 0.0000, 0.0000, 0.6250 }, { 0.0000, 0.0000, 0.6875 }, { 0.0000, 0.0000, 0.6875 }, { 0.0000, 0.0000, 0.7500 }, { 0.0000, 0.0000, 0.8125 }, { 0.0000, 0.0000, 0.8750 }, { 0.0000, 0.0000, 0.9375 }, { 0.0000, 0.0000, 1.0000 }, { 0.0000, 0.0625, 1.0000 }, { 0.0000, 0.1250, 1.0000 }, { 0.0000, 0.1875, 1.0000 }, { 0.0000, 0.2500, 1.0000 }, { 0.0000, 0.3125, 1.0000 }, { 0.0000, 0.3750, 1.0000 }, { 0.0000, 0.4375, 1.0000 }, { 0.0000, 0.5000, 1.0000 }, { 0.0000, 0.5625, 1.0000 }, { 0.0000, 0.6250, 1.0000 }, { 0.0000, 0.6875, 1.0000 }, { 0.0000, 0.7500, 1.0000 }, { 0.0000, 0.8125, 1.0000 }, { 0.0000, 0.8750, 1.0000 }, { 0.0000, 0.9375, 1.0000 }, { 0.0000, 1.0000, 1.0000 }, { 0.0625, 1.0000, 0.9375 }, { 0.1250, 1.0000, 0.8750 }, { 0.1875, 1.0000, 0.8125 }, { 0.2500, 1.0000, 0.7500 }, { 0.3125, 1.0000, 0.6875 }, { 0.3750, 1.0000, 0.6250 }, { 0.4375, 1.0000, 0.5625 }, { 0.5000, 1.0000, 0.5000 }, { 0.5625, 1.0000, 0.4375 }, { 0.6250, 1.0000, 0.3750 }, { 0.6875, 1.0000, 0.3125 }, { 0.7500, 1.0000, 0.2500 }, { 0.8125, 1.0000, 0.1875 }, { 0.8750, 1.0000, 0.1250 }, { 0.9375, 1.0000, 0.0625 }, { 1.0000, 1.0000, 0.0000 }, { 1.0000, 0.9375, 0.0000 }, { 1.0000, 0.8750, 0.0000 }, { 1.0000, 0.8125, 0.0000 }, { 1.0000, 0.7500, 0.0000 }, { 1.0000, 0.6875, 0.0000 }, { 1.0000, 0.6250, 0.0000 }, { 1.0000, 0.5625, 0.0000 }, { 1.0000, 0.5000, 0.0000 }, { 1.0000, 0.4375, 0.0000 }, { 1.0000, 0.3750, 0.0000 }, { 1.0000, 0.3125, 0.0000 }, { 1.0000, 0.2500, 0.0000 }, { 1.0000, 0.1875, 0.0000 }, { 1.0000, 0.1250, 0.0000 }, { 1.0000, 0.0625, 0.0000 }, { 1.0000, 0.0000, 0.0000 }, { 0.9375, 0.0000, 0.0000 }, { 0.8750, 0.0000, 0.0000 }, { 0.8125, 0.0000, 0.0000 }, { 0.7500, 0.0000, 0.0000 }, { 0.6875, 0.0000, 0.0000 }, { 0.6250, 0.0000, 0.0000 }, { 0.5625, 0.0000, 0.0000 }, { 0.5000, 0.0000, 0.0000 } }; for (int i = 0; i < c.length; i++) { for (int j = 0; j < c[i].length; j++) { if (j == 0) r[i] = (byte) ((byte) c[i][j]*255); if (j == 1) g[i] = (byte) ((byte) c[i][j]*255); if (j == 2) b[i] = (byte) ((byte) c[i][j]*255); } } My question is how I can use my colormap for any image I want to load and map in the right way. Thank you very much! Greetings, protein1.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 161 162 163 164 165 166 167 168 169 170 171 172  | Next Page >