Search Results

Search found 48557 results on 1943 pages for 'oracle text'.

Page 167/1943 | < Previous Page | 163 164 165 166 167 168 169 170 171 172 173 174  | Next Page >

  • ArchBeat Link-o-Rama Top 10 for October 7-13, 2012

    - by Bob Rhubart
    The Top 10 items shared via the OTN ArchBeat Facebook page for the week of October 7-13, 2012. OOW12: Oracle Business Process Management/Oracle ADF Integration Best Practices | Andrejus Baranovskis The Oracle OpenWorld presentations keep coming! Oracle ACE Director Andrejus Baranovskis shares the slides from "Oracle Business Process Management/Oracle ADF Integration Best Practices," co-presented with Danilo Schmiedel from Opitz Consulting. Oracle's Analytics, Engineered Systems, and Big Data Strategy | Mark Rittman Part 1 of 3 in Oracle ACE Director Mark Rittman's series on Oracle Exalytics, Oracle R Enterprise and Endeca. Adaptive ADF/WebCenter template for the iPad | Maiko Rocha Oracle Fusion Middleware A-Team member Maiko Rocha responds to a a customer request for information about how to create an adaptive iPad template for their WebCenter Portal application, "a specific template to streamline their workflow on the iPad." Following the Thread in OSB | Antony Reynolds Antony Reynolds recently led an Oracle Service Bus POC in which his team needed to get high throughput from an OSB pipeline. "Imagine our surprise when, on stressing the system, we saw it lock up, with large numbers of blocked threads." He shares the details of the problem and the solution in this extensive technical post. WebCenter Sites Gadget Development Concepts Quickstart | John Brunswick What are Gadgets? "At their most basic level they can be thought of as lightweight portlets that run largely on the client side of an architecture," says John Brunswick. "Gadgets provide a cross-platform container to run reusable UI modules that generally expose dynamic information to an end user, allowing for some level of end user customization." Oracle Fusion Middleware Security: OAM and OIM 11g Academies Looking for technical how-to content covering Oracle Access Manager and Oracle Identity Manager? The people behind the Oracle Middleware Security blog have indexed relevant blog posts into what they call Academies. "These indexes contain the articles we've written that we believe provide long lasting guidance on OAM and OIM. Posts covered in these series include articles on key aspects of OAM and OIM 11g, best practice architectural guidance, integrations, and customizations." Fusion Applications Technical Tips | Naveen Nahata "Setting memory parameters for Admin and Managed servers of various domains in Fusion Applications can be, let us say, a little daunting," says Oracle Fusion Middleware A-Team member Naveen Nahata. "While all this may look complicated and intimidating, it is actually relatively simple once you understand how it all works." Updated Agenda for OTN Architect Day Los Angeles (Oct 25) In less than two weeks Oracle Architect Day rolls into Los Angeles, with a full slate of sessions devoted to cloud computing, engineered systems, and SOA. Follow the link for the updated event agenda. ORCLville: OOW 2012 - A Not So Brief Recap Oracle ACE Director Floyd Teter, an Applications & Apps Technology specialists, shares his personal, frank, and and extensive recap or Oracle OpenWorld 2012. SOA Suite create partition in Enterprise Manager | Peter Paul van de Beek "In Oracle SOA Suite 10g, or more specific BPEL 10g, one could group functionality in domains," says Peter Paul van de Beek. "This feature has been away in the early versions of SOA Suite 11g. They have returned in more recent version and can be used for all SCA composites (instead of BPEL only). Nowadays these 10g domains are called partitions." Thought for the Day "I strive for an architecture from which nothing can be taken away." — Helmut Jahn Source: BrainyQuote.com

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • John Hitchcock of Pace Describes the Oracle Agile PLM Customer Experience

    John Hitchcock, Senior Manager of Configuration Management at Pace (formerly 2Wire, Inc.), sat down for an interview during Oracle's Innovation Summit with Kerrie Foy, Manager of PLM Product Marketing at Oracle. Learn why his organization upgraded to the latest version of Agile and expanded the footprint to achieve impressive savings and productivity gains across the global, networked product value-chain.

    Read the article

  • Business Success with BPM: Customer Experiences

    - by Ajay Khanna
    Oracle OpenWorld provides a unique opportunity to listen to Oracle Business Process Management Customers. This year we have many customers including Novartis, University of Melbourne, McAfee, Nagravision, Amadeus among others speaking at various sessions. One of such session is the customer panel hosted by Manas Deb from Oracle Product Management team. In this session, you will hear your peers discuss how they have overcome technical and organizational challenges; delivered success; and brought improved efficiency, visibility, and business agility to their companies. If you are interested in hearing more about how our customers use Oracle Business Process Management Suite, join us for the following session: Business Success with BPM: Customer Experiences Monday, Oct 1, 4:45 PM - 5:45 Moscone South - 308 Oracle Business Process Management Track covers a variety of topics, and speakers covering technology, methodology and best practices. You can see the list of Business process Management sessions here. Come back to this blog for more coverage from Oracle OpenWorld!

    Read the article

  • Oracle OnTrack - Ist Ihre Kommunikation auf Schiene ?

    - by Philipp Weckerle
    Oracle OnTrack erlaubt aber nicht nur einfache, chat-ähnliche Gespräche zu führen, sondern auch Bilder und Dokumente einzubinden, diese zu Annotieren, und auch Voice Kommentare und Telefonkonversationen in die Gespräche einzuflechten. Ein System zum ganzheitlichen Erfassen von "Gesprächen". Mit Integration in Microsoft Outlook, iPhone, iPad und anderen mobilen Endgeräten bietet es eine einfach zu erreichende Plattform für struktorierte Kommunikation. Weitere Informationen finden Sie hier und auf oracle.com.

    Read the article

  • Partners, Start your Engines

    - by Kristin Rose
    Normal 0 false false false EN-US X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Hello speed racer - OPN here to inform you that in case you missed it, our ISV Focused PartnerCast took place last week in Oracle’s Redwood Shores studio. Without a roadblock in site, Oracle’s key drivers discussed topics like Optimized and Oracle’s Cloud offerings; even OPN partner MSC took it to the next level by stopping by to share with us their first hand experience with the Oracle Exastack Optimized program. By stepping into Oracle’s ”Motor Speedway”, better known as the Exastack lab, MSC was able to fine tune, test and optimize their application on Oracle Exadata, as well as gain outstanding expertise on several technical areas such as optimizing multithreaded applications and database tuning. By optimizing their solution, MSC has “decreased their deployment time and saw a 30 percent performance improvement in database.” Sounds like someone’s gearing up for an “Oracle Indy 500.” By achieving Oracle Exadata Optimized status, MSC is putting performance in the driver’s seat, and their customers at the front of the race by delivering a solution that is tuned for performance, scalability and reliability. So go ahead and let the Oracle Exastack Optimized pit crew take you to the finish line. Learn how to go from 0-60 by watching MSC’s segment of the ISV Focused PartnerCast below. Ready… Set… Optimize! The OPN Communications Team

    Read the article

  • Registre des ventes pour les partenaires Oracle CRM et Inquira

    - by swalker
    Découvrez plus en détail le positionnement et les fonctionnalités d'Oracle CRM et d'InQuira. Grâce à ce guide pour la vente Oracle CRM & InQuira Playbook, vous avez toutes les cartes en main pour vendre, identifier et qualifier des opportunités et appliquer des scénarios de vente spécifiques. Découvrez également comment concentrer vos ressources et tirer profit des tremplins OPN Specialized pour élargir votre offre.

    Read the article

  • Today in the OTN Lounge (Monday October 1, 2012)

    - by Bob Rhubart
    Here's a quick rundown of today's activities in the OTN Lounge: (OTN Lounge hours today: 8:00 am - 7:00 pm)  9:00 am - 1:00 pm RAC Attack Learn about Oracle Real Application Clustering (RAC) in this collaborative event. You'll work with experts from the IOUG RAC SIG to get an Oracle Database 11gR2 RAC cluster running inside a virtual machine. For more information: RAC attack at Oracle Open World (Pythian Blog) RAC Attack - Oracle Cluster Database at Home/Events (WikiBooks) 4:00 pm - 8:00 pm Oracle Social Network Developer Challenge Office Hours Find information, expertise, and a collaborative work environment for those participating in the OSN Developer Challenge. Click here for more information. The OTN Lounge is located in the Howard St. Tent, between 3rd and 4th, directly between Moscone North and Moscone South. Access to the OTN Lounge requires an Oracle OpenWorld or JavaOne conference badge.

    Read the article

  • Adoption of Exadata - Gartner research note

    - by Javier Puerta
    Independent research note by Gartner acknowledges Oracle Exadata Database Machine has achieved significant early adoption and acceptance of its database appliance value proposition. Analyst Merv Adrian looks at some of the main issues that IT professionals have solved as they assess or deploy the Oracle Exadata solution, including: OLTP and DSS workload support workload consolidation increasing performance and scalability demands data compression improvements  Gartner reports clients using Oracle Exadata experienced the following: report significant performance improvements substantial amounts of cache memory which greatly improves processing speed Oracle Advanced Compression providing 2-4X data compression delivering significant reductions in storage requirements and driving shorter times for backup operations Tables compressed with Oracle Advanced Compression automatically recompress as data is added/updated. One client specifically reported consolidating more than 400 applications onto the Oracle Exadata platform Read the full Gartner note

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Advisor Commentary on BPO Powered by Oracle

    Hear Lowell Williams, Executive Director for Global Human Resources Outsourcing at EquaTerra and Russell Handley, Director Oracle BPO Marketing speak with Fred about current trends in Business Process Outsourcing, the relevance of Oracle's BPO entry into the space, and finally what customers and providers should be thinking about.

    Read the article

  • UI Design Patterns : Are you developing a Fusion Apps extension, an ADF or Webcenter App?

    - by asantaga
    A big question I get asked when speaking to partners who are developing Oracle ADF, or Webcenter, Apps is how to make it look nice.. Some of the big SIs ask me, "Do we have any design patterns/guidelines we can use?". .. Alas website design is a very personal thing and each website will have different requirements and needs, however I am now pleased to say we've just launched "Oracle Fusion Applications Design Patterns" website.   The website is the result of many years of Oracle R&D into user interface design for Fusion applications and features a really cool web app which allows you to visualise the UI components in action. Although many of the design patterns are related to ADF , its worth noting that ADF took its lead from Oracle Fusion Applications User Interface needs - not the other way around, its just taken us a while to publish these. Coupled together with the dashboard patterns this makes are really cool extra asset for your kit bag Design Patterns Oracle dashboard patterns and guidelines Usable Apps.oracle.com Enjoy

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • New Amazon EC2 image for Oracle SOA (and BPM) Suite

    - by Demed L'Her
    Want to test-drive the Oracle SOA Suite, including the brand new BPMN capabilities, without having to install anything? Check out our new image on Amazon EC2 for Oracle SOA (and BPM) Suite 11gR1 PS2. The full instructions are here: BPM 11gR1 now available on Amazon EC2 Thanks Prasen for posting that new image!

    Read the article

  • ADF Essentials - Available for free and certified on GlassFish!

    - by delabassee
    If you are an Oracle customer, you are probably familiar with Oracle ADF (Application Development Framework). If you are not, ADF is, in a nutshell, a Java EE based framework that simplifies the development of enterprise applications. It is the development framework that was used, among other things, to build Oracle Fusion Applications. Oracle has just released ADF Essentials, a free to develop and deploy version of Oracle ADF's core technologies. As a good news never come alone, GlassFish 3.1.2 is now a certified container for ADF Essentials! ADF Essentials leverage core ADF features and includes: Oracle ADF Faces - a set of more than 150 JSF 2.0 rich components that simplify the creation of rich Web user interfaces (charting, data vizualization, advanced tables, drag and drop, touch gesture support, extensive windowing capabilities, etc.) Oracle ADF Controller - an extension of the JSF controller that helps build reusable process flows and provides the ability to create dynamic regions within Web pages. Oracle ADF Binding - an XML-based, meta-data abstraction layer to connect user interfaces to business services. Oracle ADF Business Components – a declaratively-configured layer that simplifies developing business services against relational databases by providing reusable components that implement common design patterns. ADF is a highly declarative framework, it has always had a very good tooling support. Visual development for Oracle ADF Essentials is provided in Oracle JDeveloper 11.1.2.3. Eclispe support is planned for a later OEPE (Oracle Enterprise Pack for Eclipse) release. Here are some relevant links to quickly learn on how to use ADF Essentials on GlassFish: Video : Oracle ADF Essentials Overview and Demo Deploying Oracle ADF Essentials Applications to Glassfish OTN : Oracle ADF Essentials Ressources

    Read the article

  • OpenWorld hands on labs: HOL9558, HOL9559 and HOL9870

    - by cpauliat
    In the upcoming event Oracle OpenWorld that will start in 2 days in San Francisco, Olivier Canonge, Simon Coter, Eric Bezille and I will run 3 hands on lab about Cloud using Oracle VM for X86 virtualization tool (details below) For each lab, a detailed document (in PDF format) explains all steps. If you don't have the opportunity to attend OpenWorld labs sessions, you can still run the labs at home or office using those documents. Lab 9558: Deploying Infrastructure as a Service (IaaS) with Oracle VM Session ID: HOL9558 Tuesday October 2nd, 2012, 10:15am – 11:15amLocation: Marriott Marquis - Salon 14/15PDF Document: part1 part2 part3 (right click and save link for each part then use winzip on file .001 to extract the PDF doc from the 3 zip files) Lab 9559: Virtualize and Deploy Oracle Applications Using Oracle VM Templates Session ID: HOL9559 Tuesday October 2nd, 2012, 11:45am – 12:45pmLocation: Marriott Marquis - Salon 14/15 PDF Document Lab 9870: x86 Enterprise Cloud Infrastructure with Oracle VM 3.x and Sun ZFS Storage Appliance Session ID: HOL 9870 Wednesday, 3 Oct, 2012, 5:00 PM - 6:00 PMLocation: Marriott Marquis - Salon 14/15 PDF Document: part1 part2 part3 (right click and save link for each part then use winzip on file .001 to extract the PDF doc from the 3 zip files)

    Read the article

  • The Benefits of BPO Powered by Oracle

    Sonny Singh, Oracle's Industry Business Unit Senior Vice President, speaks with Fred about the unique attributes of Oracle's BPO strategy, shares examples of customer and provider successes and explains how listeners -- both customers and providers -- can benefit from this offering.

    Read the article

  • New Worklist features on 12.1.3

    - by Vijay Shanmugam
    Following new Worklist features are available on E-Business Suite 12.1.3 via Patch 13646173. Ability to view comments on top of a notification If an action is performed on a notification such as Reassign, Request for Information or Provide Information, the recipient of the notification will see who performed the last action and the associated comment on top of the notification. Reassigning a request for information notification If an approver requests more information on a notification from it's submitter, the submitter now has two options Answer Request for More Information Transfer Request for More Information If the submitter thinks the requested information can be provided by another user, he/she can transfer the request to the other user. Please note that only Transfer is supported for Request for More Information. Once transferred, the submitter cannot access the notification and provide the requested information. Use actual sent date when reassigning a notification The Sent field in notification header always showed the date on which the notification was first created. If the notification was later reassigned, the Sent date was not updated to show the last action date. This caused problems in following scenario Approval notification was sent to JACK on 01-JAN-2012 JACK waited for 10 days before reassigning to JILL on 10-JAN-2012 JILL does not see the notification as sent on 10-JAN-2012, instead sees it as sent on 01-JAN-2012 Although the notification was originally created on 01-JAN-2012, it was sent to JILL only on 10-JAN-2012 The enhancement now shows the correct sent date in Worklist and Notification Details page. Figure 1 - Depicts all the above 3 features Related Action History for response required notification So far it was possible to embed Action History of an response-required notification into another FYI notification using #RELATED_HISTORY attribute (Please refer to Workflow Developer Guide for details about this attribute). The enhancement now enables developers to embed Action History of one response-required notification into another response-required notification. To embed Action History of one response-required notification into another, create message attribute #RELATED_HISTORY. To this attribute set a value during run-time in the following format. {TITLE}[ITEM_TYPE:ITEM_KEY]PROCESS_NAME:ACTIVITY_LABEL_NAMEThe TITLE, ITEM_TYPE and ITEM_KEY are optional values. TITLE is used as Related Action History header title. If TITLE is not present, then a default title "Related Action History" is shown. If ITEM_TYPE is present and ITEM_KEY is not, For Example: {TITLE}[ITEM_TYPE]PROCESS_NAME:ACTIVITY_LABEL_NAME , the Related Action History is populated from parent item type of the current item. If both ITEM_TYPE and ITEM_KEY is present, For Example: {TITLE}[ITEM_TYPE:ITEM_KEY]PROCESS_NAME:ACTIVITY_LABEL_NAME , the Related Action History is populated from that specific instance activity. Figure 2 - Depicts Related Action History feature

    Read the article

  • You're invited : Oracle Solaris Forum, Dec 18th, Petah Tikva

    - by Frederic Pariente
    The local ISV Engineering will be attending and speaking at the Oracle and ilOUG Solaris Forum next week in Israel. Come meet us there! This free event requires registration, thanks. YOU'RE INVITED Oracle Solaris Forum Date : Tuesday, December 18th, 2012 Time : 14:00 Location :  Dan Academic CenterPetach TikvaIsrael Agenda : New Features in Solaris 11.1SPARC T4 & T5Solaris 11 Serviceability See you there!

    Read the article

  • 1.6 or 1.7: Browser side Java version for Oracle VM console

    - by katsumii
    I noticed one of the recent FAQ in OVM forum is about console.OTN Discussion Forums : Oracle VM Server for x86vnc console not running on Oracle VM 3.1.1 One of the variable for running console is Java version. I myself hit the bug below on Windows with JDK1.7 This is Windows only bug. I had success with JDK1.7 on Linux.Bug ID: 7191616 javaws.exe crashes when starting jnlp filejnlp file provided in the steps to reproduce always crashes javaws.exe in Java 7 Update 6.No problems in Update 4

    Read the article

  • ArchBeat Link-o-Rama for 2012-04-12

    - by Bob Rhubart
    2012 Real World Performance Tour Dates |Performance Tuning | Performance Engineering www.ioug.org Coming to your town: a full day of real world database performance with Tom Kyte, Andrew Holdsworth, and Graham Wood. Rochester, NY - March 8 Los Angeles, CA - April 30 Orange County, CA - May 1 Redwood Shores, CA - May 3 Oracle Technology Network Developer Day: MySQL - New York www.oracle.com Wednesday, May 02, 2012 8:00 AM – 4:30 PM Grand Hyatt New York 109 East 42nd Street, Grand Central Terminal New York, NY 10017 Webcast Series: Data Warehousing Best Practices event.on24.com April 19, 2012 - Best Practices for Workload Management of a Data Warehouse on Oracle Exadata May 10, 2012 - Best Practices for Extreme Data Warehouse Performance on Oracle Exadata Webcast: Untangle Your Business with Oracle Unified SOA and Data Integration event.on24.com Date: Tuesday, April 24, 2012 Time: 10:00 AM PT / 1:00 PM ET Speakers: Mala Narasimharajan - Senior Product Marketing Manager, Oracle Data Integration, Oracle Bruce Tierney - Director of Product Marketing, Oracle SOA Suite, Oracle The Increasing Focus on Architecture (ArchBeat) blogs.oracle.com As a "third wave" of computing, Cloud computing is changing how IT organizations and individuals within those organizations approach the creation of solutions. Updated SOA Documents now available in ITSO Reference Library blogs.oracle.com Nine updated documents have just been added to the IT Strategies from Oracle library, including SOA Practitioner Guides, SOA Reference Architectures, and SOA White Papers and Data Sheets. Access to all documents within the ITSO library is free to those with a free Oracle.com membership. WebLogic JMS Clustering and Spring | Rene van Wijk middlewaremagic.com Oracle ACE Rene van Wijk sets up a WebLogic cluster that includes a JMS environment, which will be used by Spring. Running Built-In Test Simulator with SOA Suite Healthcare 11g in PS4 and PS5 | Shub Lahiri blogs.oracle.com Shub Lahiri shows how the pre-installed simulator that comes with the SOA Suite for Healthcare Integration pack can be used as an external endpoint to generate inbound and outbound HL7 traffic on specified MLLP ports. In the cloud era, let's start calling IT what it is: 'Innovation Team' | Joe McKendrick www.zdnet.com Cloud, the third great shift in 50 years of computing, presents a golden opportunity for IT to get out in front and lead. Thought for the Day "Why do we never have time to do it right, but always have time to do it over?" — Anonymous

    Read the article

< Previous Page | 163 164 165 166 167 168 169 170 171 172 173 174  | Next Page >