Search Results

Search found 13797 results on 552 pages for 'structured exception'.

Page 167/552 | < Previous Page | 163 164 165 166 167 168 169 170 171 172 173 174  | Next Page >

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

  • Request header is too large

    - by stck777
    I found serveral IllegalStateException Exception in the logs: [#|2009-01-28T14:10:16.050+0100|SEVERE|sun-appserver2.1|javax.enterprise.system.container.web|_ThreadID=26;_ThreadName=httpSSLWorkerThread-80-53;_RequestID=871b8812-7bc5-4ed7-85f1-ea48f760b51e;|WEB0777: Unblocking keep-alive exception java.lang.IllegalStateException: PWC4662: Request header is too large at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:740) at org.apache.coyote.http11.InternalInputBuffer.parseHeader(InternalInputBuffer.java:657) at org.apache.coyote.http11.InternalInputBuffer.parseHeaders(InternalInputBuffer.java:543) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.parseRequest(DefaultProcessorTask.java:712) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.doProcess(DefaultProcessorTask.java:577) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.process(DefaultProcessorTask.java:831) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.executeProcessorTask(DefaultReadTask.java:341) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:263) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:214) at com.sun.enterprise.web.portunif.PortUnificationPipeline$PUTask.doTask(PortUnificationPipeline.java:380) at com.sun.enterprise.web.connector.grizzly.TaskBase.run(TaskBase.java:265) at com.sun.enterprise.web.connector.grizzly.ssl.SSLWorkerThread.run(SSLWorkerThread.java:106) |#] Does anybody know configuration changes to fix this?

    Read the article

  • LINQ-to-entities - Null reference

    - by BlueRaja
    I could swear this was working the other day: var resultSet = (from o in _entities.Table1 where o.Table2.Table3.SomeColumn == SomeProperty select o ).First(); SelectedItem = resultSet.Table2.SomeOtherColumn; I am getting a null reference exception on the last line: resultSet.Table2 is null. Not only am I sure that all the foreign keys and whatnot have the correct values, but I don't see how Table2 could be null, since o.Table2.Table3.SomeColumn == SomeProperty. resultSet is being returned with all its properties set to the correct values, with the exception that Table2 is null.

    Read the article

  • TSQL: finding unique entries in a single table

    - by pcampbell
    Consider a table or CTE structured like this: Name Num ---- ---- Abc 12 Abc 12 XYZ 70 XYZ 80 Bar 50 Bar 55 Foo 44 Foo 44 Baz 88 The requirement is to determine the Name where multiple different Nums exist. The desired resultset is Name ---- XYZ Bar What TSQL statement would you use to derive this resultset?

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Techniques to avoid DeadlineExceededException in GAE/J?

    - by Tahir Akram
    I am developing an Twitter4J web application in Google App Engine/Java. I need to show two lists. One is Twitter friends and other is followers. With photo and screen name. It is working fine for people who have 20-30 followers and friends. But it gave me DeadlineExceededException when I try a user who has 150+ followers and friends. GAE throws this exception if web request take time more than 30 seconds. So what techniques I can adopt to avoid this exception. Should I generate two AJAX calls for each of my list. After page loads. So that every call will have its own 30 secs limit? Or what else you think? I am gone make it. Please help.

    Read the article

  • NHibernate ManyToMany Relationship Cascading AllDeleteOrphan StackOverflowException

    - by Chris
    I have two objects that have a ManyToMany relationship with one another through a mapping table. Though, when I try to save it, I get a stack overflow exception. The following is the code for the mappings: //EventMapping.cs HasManyToMany(x => x.Performers).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("EventId").ChildKeyColumn("PerformerId"); //PerformerMapping.cs HasManyToMany<Event>(x => x.Events).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("PerformerId").ChildKeyColumn("EventId"); When I change the performermapping.cs to Cascade.None() I get rid of the exception but then my Event Object doesn't have the performer I associate with it. //In a unit test, paraphrased event.Performers.Add(performer); //Event eventRepository.Save<Event>(event); eventResult = eventRepository.GetById<Event>(event.id); //Event eventResult.Performers[0]; //is null, should have performer in it How should I be writing this properly? Thanks

    Read the article

  • Asp.net mvc, entity framework, Poco - Architecture

    - by user1576228
    I have a "small" enterprise application, aspnet mvc 3 + entity framework with POCO entity and repository pattern. I structured the solution in 4 projects: POCO entities Domain model Services web application When the application performs a query on the database, use one of the services provided, the service uses the repository and the small classes, as a result I have some dynamic proxy objects that I would like to convert in my domain entities, before using them in mvc views, but I do not know how. Dovrebber be set as the translator? This approach is reasonable?

    Read the article

  • Update MySQL table from jsp

    - by vishnu
    I have these in a jsp file. But these values are not updated in the mysql table. May be it is not commiting. How can i solve this ? String passc1 = request.getParameter("passc1"); String accid = request.getParameter("accid"); int i = 0; String sql = " update customertb " + " set passwd = ?" + " where acc_no = ?;"; try { PreparedStatement ps = con.prepareStatement(sql); ps.setString(1, passc1); ps.setString(2, accid); i = ps.executeUpdate(); } catch (Exception e) { // do something with Exception here. Maybe just throw it up again } finally { con.close(); }

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • C# MDX RenderToSurface, where to reset after device is lost?

    - by Moritz Schöfl
    Hi, I got a problem with the RenderToSurface class. When I resize the Form of my Device, the Draw method is still called, but doesnt throw an Exception, it looks like this: device.Clear(ClearFlags.Target, Color.Red, 0, 0); device.BeginScene(); // here is out commented code device.EndScene(); device.Present(); In another method, I wrote this: renderToSurface.BeginScene(surfaces[currentIndex]); // here is out commented code renderToSurface.EndScene(Filter.None); and this method seems to throw a nullpointer exception when I resize the window; So my question is: - where to reset / restore / handle the renderToSurface class? (i tried it with the DeviceReset event like following - void OnDeviceReset(object sender, EventArgs e) { renderToSurface = new RenderToSurface(Game.Device, Game.ClientSize.Width, Game.ClientSize.Height, Format.A8R8G8B8, true, DepthFormat.D16); } )

    Read the article

  • Stack trace in website project, when debug = false

    - by chandmk
    We have a website project. We are logging unhanded exceptions via a appdomain level exception handler. When we set debug= true in web.config, the exception log is showing the offending line numbers in the stack trace. But when we set debug = false, in web.config, log is not displaying the line numbers. We are not in a position to convert the website project in to webapplication project type at this time. Its legacy application and almost all the code is in aspx pages. We also need to leave the project in 'updatable' mode. i.e. We can't user pre-compile option. We are generating pdb files. Is there anyway to tell this kind of website projects to generate the pdb files, and show the line numbers in the stack trace?

    Read the article

  • A SelfHosted WCF Service over Basic HTTP Binding doesn't support more than 1000 concurrent requests

    - by Krishnan
    I have self hosted a WCF Service over BasicHttpBinding consumed by an ASMX Client. I'm simulating a concurrent user load of 1200 users. The service method takes a string parameter and returns a string. The data exchanged is less than 10KB. The processing time for a request is fixed at 2 seconds by having a Thread.Sleep(2000) statement. Nothing additional. I have removed all the DB Hits / business logic. The same piece of code runs fine for 1000 concurrent users. I get the following error when I bump up the number to 1200 users. System.Net.WebException: The underlying connection was closed: An unexpected error occurred on a receive. ---> System.IO.IOException: Unable to read data from the transport connection: An existing connection was forcibly closed by the remote host. ---> System.Net.Sockets.SocketException: An existing connection was forcibly closed by the remote host at System.Net.Sockets.Socket.Receive(Byte[] buffer, Int32 offset, Int32 size, SocketFlags socketFlags) at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) --- End of inner exception stack trace --- at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.PooledStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.Connection.SyncRead(HttpWebRequest request, Boolean userRetrievedStream, Boolean probeRead) --- End of inner exception stack trace --- at System.Web.Services.Protocols.WebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.HttpWebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at WCF.Throttling.Client.Service.Function2(String param) This exception is often reported on DataContract mismatch and large data exchange. But never when doing a load test. I have browsed enough and have tried most of the options which include, Enabled Trace & Message log on server side. But no errors logged. To overcome Port Exhaustion MaxUserPort is set to 65535, and TcpTimedWaitDelay 30 secs. MaxConcurrent Calls is set to 600, and MaxConcurrentInstances is set to 1200. The Open, Close, Send and Receive Timeouts are set to 10 Minutes. The HTTPWebRequest KeepAlive set to false. I have not been able to nail down the issue for the past two days. Any help would be appreciated. Thank you.

    Read the article

  • jQuery/Ajax/javascript in FireFox Error when using $.post/$.get

    - by IsenGrim
    uncaught exception: [Exception... "Component returned failure code: 0x80004005 (NS_ERROR_FAILURE)" nsresult: "0x80004005 (NS_ERROR_FAILURE)" location: "JS frame :: http://localhost/scripts/jQuery.js :: anonymous :: line 808" data: no] Line 0 is the error i get when i bring up firebug. This only happens in firefox (and maybe other browsers) but the code works fine in IE8. I have codes like this in jquery: $("#Logout").live("click", function (e) { e.preventDefault(e); $.post("/logout.php", {}, function () { //--a bunch of animations--// window.location = "/login.php"; } }); I have no idea whats wrong as even the error message is not helpful at all.. inside logout.php: <?php session_start(); session_destroy(); ?> Also dont work if I used GET or inserted phantom data. Or is there a more elegant way to do this?

    Read the article

  • Java multiple connections downloading file

    - by weulerjunior
    Hello friends, I was wanting to add multiple connections in the code below to be able to download files faster. Could someone help me? Thanks in advance. public void run() { RandomAccessFile file = null; InputStream stream = null; try { // Open connection to URL. HttpURLConnection connection = (HttpURLConnection) url.openConnection(); // Specify what portion of file to download. connection.setRequestProperty("Range", "bytes=" + downloaded + "-"); // Connect to server. connection.connect(); // Make sure response code is in the 200 range. if (connection.getResponseCode() / 100 != 2) { error(); } // Check for valid content length. int contentLength = connection.getContentLength(); if (contentLength < 1) { error(); } /* Set the size for this download if it hasn't been already set. */ if (size == -1) { size = contentLength; stateChanged(); } // Open file and seek to the end of it. file = new RandomAccessFile("C:\\"+getFileName(url), "rw"); file.seek(downloaded); stream = connection.getInputStream(); while (status == DOWNLOADING) { /* Size buffer according to how much of the file is left to download. */ byte buffer[]; if (size - downloaded > MAX_BUFFER_SIZE) { buffer = new byte[MAX_BUFFER_SIZE]; } else { buffer = new byte[size - downloaded]; } // Read from server into buffer. int read = stream.read(buffer); if (read == -1) { break; } // Write buffer to file. file.write(buffer, 0, read); downloaded += read; stateChanged(); } /* Change status to complete if this point was reached because downloading has finished. */ if (status == DOWNLOADING) { status = COMPLETE; stateChanged(); } } catch (Exception e) { error(); } finally { // Close file. if (file != null) { try { file.close(); } catch (Exception e) { } } // Close connection to server. if (stream != null) { try { stream.close(); } catch (Exception e) { } } } }

    Read the article

  • Updating to Spring 2.5.5 causes a javax.servlet.UnavailableException: org.springframework.web.struts

    - by Averroes
    I have been told to update some application from Spring 2.0.8 to Spring 2.5.5. This application is using Struts 1.2.7. Once I change the Spring.jar I get the following exception while loading in JBoss 4.0.5: 10:14:57,579 ERROR [[/PortalRRHH]] Servlet /PortalRRHH threw load() exception javax.servlet.UnavailableException: org.springframework.web.struts.DelegatingTilesRequestProcessor This is defined in the struts-config.xml this way: <controller locale="true"> <set-property property="processorClass" value="org.springframework.web.struts.DelegatingTilesRequestProcessor"/> </controller> I have no clue of what is happening since it works with the old version of Spring and the DelegatingTilesRequestProcessor is still available in Spring 2.5.5. I have no previous experience with Struts so if you need anything else to figure what the problem is please ask and I will update the question. Thanks.

    Read the article

  • Fluent NHibernate MappingException : could not instantiate id generator

    - by Mark Simpson
    I'm pottering around with Fluent NHibernate to try and get a simple app up and running. I'm running through this Fluent NHibernate Tutorial. Everything seems to be going fine and I've created the required classes etc. and it all builds, but when I run the test, I get an exception. Someone in the comments section of the tutorial has the same problem, but I can't find any good information on what's causing it. Any help appreciated. It's probably something trivial. Exception details: FluentNHTest.Tests.Mappings.CustomerMappingTests.ValidateMappings: FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- NHibernate.MappingException : could not instantiate id generator ---- System.FormatException : Input string was not in a correct format.

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Tutorials on packaging a java application

    - by JCH
    Hi, Can somebody point me to some tutorials and best practices that show to make a build from source code for a java desktop / jee web application ? I want to learn what needs to be packaged as a war/jar from source and how it must be structured? br /jon

    Read the article

  • Getting Data For Webpages?

    - by fuzzygoat
    When looking to get data from a web page whats the recommended method if the page does not provide a structured data feed? Am I right in thinking that its just a case of doing an NSURLRequest and then hacking what you need out of the responseData(NSData*)? I am not too concerned about the implementation in Xcode, I am more curious about actually collecting the data, before I start coding a "hunt & peck" through a list of data. gary

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • StackOverflowError being caused by a TableModelListener

    - by me_here
    I'm not sure why this is recursing. jTable1.getModel().addTableModelListener(new TableModelListener() { public void tableChanged(TableModelEvent evt) { int sum = 0; int i=0; for (i =0 ; i<2; i++){ sum = sum + Integer.parseInt(jTable1.getValueAt(0, i).toString()); } jTable1.setValueAt(sum, 0, 2); } }); The exception is: (it keeps repeating) Exception in thread "AWT-EventQueue-0" java.lang.StackOverflowError at javax.swing.table.DefaultTableColumnModel.getColumn(DefaultTableColumnModel.java:277) at javax.swing.JTable.convertColumnIndexToModel(JTable.java:2553) at javax.swing.JTable.getValueAt(JTable.java:2695) at testprogram.guitest.TestTableModel$1.tableChanged(TestTableModel.java:63) at javax.swing.table.AbstractTableModel.fireTableChanged(AbstractTableModel.java:280) at javax.swing.table.AbstractTableModel.fireTableCellUpdated(AbstractTableModel.java:259) at javax.swing.table.DefaultTableModel.setValueAt(DefaultTableModel.java:650) at javax.swing.JTable.setValueAt(JTable.java:2719) Any help appreciated.

    Read the article

  • Visual Studio 2010 failed tests throw exceptions

    - by Dave Hanson
    In VisualStudio2010 Ultimate RC I cannot figure out how to suppress {"CollectionAssert.AreEqual failed. (Element at index 0 do not match.)"} from Microsoft.VisualStudio.TestTools.UnitTesting.AssertFailedException If i Ctrl+Alt+E I get the exception dialog; however that exception doesn't seem to be in there to be suppressed. Does anyone else have any experience with this? I don't remember having to suppress these Assert fails in studio 2008 when running unit tests. My tests would fail and I could just click on the TestResults to see which tests failed instead of fighting through these dialogs. For now I guess I'll just run my tests through the command window.

    Read the article

< Previous Page | 163 164 165 166 167 168 169 170 171 172 173 174  | Next Page >