Search Results

Search found 10693 results on 428 pages for 'raw disk'.

Page 169/428 | < Previous Page | 165 166 167 168 169 170 171 172 173 174 175 176  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • exim4, avoid emails end up in spam folder

    - by MultiformeIngegno
    I have a VPS: I set up exim, problem is emails always go in the spam folder.. this is a sample header: http://pastebin.com/raw.php?i=4NJ2ZaUs As you can see it PASSes SPF test but still emails don't pass spam filters (I tried with Gmail).. Here's my exim config: dc_eximconfig_configtype='internet' dc_other_hostnames='MY_DOMAIN' dc_local_interfaces='' dc_readhost='MY_DOMAIN' dc_relay_domains='MY_DOMAIN' dc_minimaldns='false' dc_relay_nets='' dc_smarthost='MY_DOMAIN' CFILEMODE='644' dc_use_split_config='false' dc_hide_mailname='' dc_mailname_in_oh='true' dc_localdelivery='mail_spool' Why does this happen?

    Read the article

  • how to disable these logs on the screen?

    - by user62367
    using Fedora 14: http://pastebin.com/raw.php?i=jUvcfugw i mount an anonym Samba share [checks it in every 5 sec] it's working, ok, great! But: when i shut down my Fedora box, i can see the lines containing this scripts lines! Many times, about ~50x on the screen. How could i disable these lines when shutting down? I [and other people] don't want to see those lines for about ~ 5 sec Thank you!

    Read the article

  • mdadm: Win7-install created a boot partition on one of my RAID6 drives. How to rebuild?

    - by EXIT_FAILURE
    My problem happened when I attempted to install Windows 7 on it's own SSD. The Linux OS I used which has knowledge of the software RAID system is on a SSD that I disconnected prior to the install. This was so that windows (or I) wouldn't inadvertently mess it up. However, and in retrospect, foolishly, I left the RAID disks connected, thinking that windows wouldn't be so ridiculous as to mess with a HDD that it sees as just unallocated space. Boy was I wrong! After copying over the installation files to the SSD (as expected and desired), it also created an ntfs partition on one of the RAID disks. Both unexpected and totally undesired! . I changed out the SSDs again, and booted up in linux. mdadm didn't seem to have any problem assembling the array as before, but if I tried to mount the array, I got the error message: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I then used qparted to delete the newly created ntfs partition on /dev/sdd so that it matched the other three /dev/sd{b,c,e}, and requested a resync of my array with echo repair > /sys/block/md0/md/sync_action This took around 4 hours, and upon completion, dmesg reports: md: md0: requested-resync done. A bit brief after a 4-hour task, though I'm unsure as to where other log files exist (I also seem to have messed up my sendmail configuration). In any case: No change reported according to mdadm, everything checks out. mdadm -D /dev/md0 still reports: Version : 1.2 Creation Time : Wed May 23 22:18:45 2012 Raid Level : raid6 Array Size : 3907026848 (3726.03 GiB 4000.80 GB) Used Dev Size : 1953513424 (1863.02 GiB 2000.40 GB) Raid Devices : 4 Total Devices : 4 Persistence : Superblock is persistent Update Time : Mon May 26 12:41:58 2014 State : clean Active Devices : 4 Working Devices : 4 Failed Devices : 0 Spare Devices : 0 Layout : left-symmetric Chunk Size : 4K Name : okamilinkun:0 UUID : 0c97ebf3:098864d8:126f44e3:e4337102 Events : 423 Number Major Minor RaidDevice State 0 8 16 0 active sync /dev/sdb 1 8 32 1 active sync /dev/sdc 2 8 48 2 active sync /dev/sdd 3 8 64 3 active sync /dev/sde Trying to mount it still reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so and dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I'm a bit unsure where to proceed from here, and trying stuff "to see if it works" is a bit too risky for me. This is what I suggest I should attempt to do: Tell mdadm that /dev/sdd (the one that windows wrote into) isn't reliable anymore, pretend it is newly re-introduced to the array, and reconstruct its content based on the other three drives. I also could be totally wrong in my assumptions, that the creation of the ntfs partition on /dev/sdd and subsequent deletion has changed something that cannot be fixed this way. My question: Help, what should I do? If I should do what I suggested , how do I do that? From reading documentation, etc, I would think maybe: mdadm --manage /dev/md0 --set-faulty /dev/sdd mdadm --manage /dev/md0 --remove /dev/sdd mdadm --manage /dev/md0 --re-add /dev/sdd However, the documentation examples suggest /dev/sdd1, which seems strange to me, as there is no partition there as far as linux is concerned, just unallocated space. Maybe these commands won't work without. Maybe it makes sense to mirror the partition table of one of the other raid devices that weren't touched, before --re-add. Something like: sfdisk -d /dev/sdb | sfdisk /dev/sdd Bonus question: Why would the Windows 7 installation do something so st...potentially dangerous? Update I went ahead and marked /dev/sdd as faulty, and removed it (not physically) from the array: # mdadm --manage /dev/md0 --set-faulty /dev/sdd # mdadm --manage /dev/md0 --remove /dev/sdd However, attempting to --re-add was disallowed: # mdadm --manage /dev/md0 --re-add /dev/sdd mdadm: --re-add for /dev/sdd to /dev/md0 is not possible --add, was fine. # mdadm --manage /dev/md0 --add /dev/sdd mdadm -D /dev/md0 now reports the state as clean, degraded, recovering, and /dev/sdd as spare rebuilding. /proc/mdstat shows the recovery progress: md0 : active raid6 sdd[4] sdc[1] sde[3] sdb[0] 3907026848 blocks super 1.2 level 6, 4k chunk, algorithm 2 [4/3] [UU_U] [>....................] recovery = 2.1% (42887780/1953513424) finish=348.7min speed=91297K/sec nmon also shows expected output: ¦sdb 0% 87.3 0.0| > |¦ ¦sdc 71% 109.1 0.0|RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR > |¦ ¦sdd 40% 0.0 87.3|WWWWWWWWWWWWWWWWWWWW > |¦ ¦sde 0% 87.3 0.0|> || It looks good so far. Crossing my fingers for another five+ hours :) Update 2 The recovery of /dev/sdd finished, with dmesg output: [44972.599552] md: md0: recovery done. [44972.682811] RAID conf printout: [44972.682815] --- level:6 rd:4 wd:4 [44972.682817] disk 0, o:1, dev:sdb [44972.682819] disk 1, o:1, dev:sdc [44972.682820] disk 2, o:1, dev:sdd [44972.682821] disk 3, o:1, dev:sde Attempting mount /dev/md0 reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so And on dmesg: [44984.159908] EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! [44984.159912] EXT4-fs (md0): group descriptors corrupted! I'm not sure what do do now. Suggestions? Output of dumpe2fs /dev/md0: dumpe2fs 1.42.8 (20-Jun-2013) Filesystem volume name: Atlas Last mounted on: /mnt/atlas Filesystem UUID: e7bfb6a4-c907-4aa0-9b55-9528817bfd70 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: user_xattr acl Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 244195328 Block count: 976756712 Reserved block count: 48837835 Free blocks: 92000180 Free inodes: 243414877 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 791 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 RAID stripe width: 2 Flex block group size: 16 Filesystem created: Thu May 24 07:22:41 2012 Last mount time: Sun May 25 23:44:38 2014 Last write time: Sun May 25 23:46:42 2014 Mount count: 341 Maximum mount count: -1 Last checked: Thu May 24 07:22:41 2012 Check interval: 0 (<none>) Lifetime writes: 4357 GB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: e177a374-0b90-4eaa-b78f-d734aae13051 Journal backup: inode blocks dumpe2fs: Corrupt extent header while reading journal super block

    Read the article

  • cannot access new drive through nfs

    - by l.thee.a
    I am running nfs-kernel-server to access my files on my linux machine(ubuntu - /share). The disk I have been using is full. So I have added a new disk and mounted it to /share/data. My other pc mounts the /share folder to /mnt/nfs; but cannot see the contents of /mnt/nfs/data. I have tried adding /share/data to /etc/exports, but it did not help. What do I do?

    Read the article

  • Is it possible to "intercept" a 3rd party library's "WriteFile" operation

    - by stout
    This is likely a long shot, but I thought I'd ask anyway. I'm using a document management system's API. They provide a "WriteFile" method to save a given document to disk. However, the library does not have a way to simply read a document into memory. My only option, it seems, is to write to disk, then read it back in again. I'm wondering if there is a better way to work around this obvious limitation. Thanks in advance!

    Read the article

  • Descending list ordered by file modification time

    - by LanceBaynes
    How can I generate a list of files in a directory [for example, "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ But if a file is changed in a directory, it lists the full directory, so the pastebined link isn't good [I don't want a list ordered by "directories", I need a "per file" ordered list] OS: OpenWrt [no Perl - not enough space for it :( + no "stat", or "file" command].

    Read the article

  • use hg to synchronize my project between my two computer

    - by hguser
    Hi: I have two computer : the desktop in my company and the portable computer in my home. Now I want to use the hg to synchronize the project between them using a "USB removable disk". So I wonder how to implement it? THe pro in my desktop is : D:\work\mypro. I use the following command to init it: hg init Then I connect to the USB disk whose volume label is "H",and get a clone using: cd H: hg init hg clone D:\work\mypro mypro-usb ANd in my portable computer I use: cd D: hg clone H:\mypro-usb mypro-home However I do not know how to do if I modify some files(remove or add and modify) in the mypro-home,how to make the mypro-usb changed synchronizely,also I want the mypro in my desktop synchronizely. How to do it?

    Read the article

  • How to keep group-writeable shares on Samba with OSX clients?

    - by Oliver Salzburg
    I have a FreeNAS server on a network with OSX and Windows clients. When the OSX clients interact with SMB/CIFS shares on the server, they are causing permission problems for all other clients. Update: I can no longer verify any answers because we abandoned the project, but feel free to post any help for future visitors. The details of this behavior seem to also be dependent on the version of OSX the client is running. For this question, let's assume a client running 10.8.2. When I mount the CIFS share on an OSX client and create a new directory on it, the directory will be created with drwxr-x-rx permissions. This is undesirable because it will not allow anyone but me to write to the directory. There are other users in my group which should have write permissions as well. This behavior happens even though the following settings are present in smb.conf on the server: [global] create mask= 0666 directory mask= 0777 [share] force directory mode= 0775 force create mode= 0660 I was under the impression that these settings should make sure that directories are at least created with rwxrwxr-x permissions. But, I guess, that doesn't stop the client from changing the permissions after creating the directory. When I create a folder on the same share from a Windows client, the new folder will have the desired access permissions (rwxrwxrwx), so I'm currently assuming that the problem lies with the OSX client. I guess this wouldn't be such an issue if you could easily change the permissions of the directories you've created, but you can't. When opening the directory info in Finder, I get the old "You have custom access" notice with no ability to make any changes. I'm assuming that this is caused because we're using Windows ACLs on the share, but that's just a wild guess. Changing the write permissions for the group through the terminal works fine, but this is unpractical for the deployment and unreasonable to expect from anyone to do. This is the complete smb.conf: [global] encrypt passwords = yes dns proxy = no strict locking = no read raw = yes write raw = yes oplocks = yes max xmit = 65535 deadtime = 15 display charset = LOCALE max log size = 10 syslog only = yes syslog = 1 load printers = no printing = bsd printcap name = /dev/null disable spoolss = yes smb passwd file = /var/etc/private/smbpasswd private dir = /var/etc/private getwd cache = yes guest account = nobody map to guest = Bad Password obey pam restrictions = Yes # NOTE: read smb.conf. directory name cache size = 0 max protocol = SMB2 netbios name = freenas workgroup = COMPANY server string = FreeNAS Server store dos attributes = yes hostname lookups = yes security = user passdb backend = ldapsam:ldap://ldap.company.local ldap admin dn = cn=admin,dc=company,dc=local ldap suffix = dc=company,dc=local ldap user suffix = ou=Users ldap group suffix = ou=Groups ldap machine suffix = ou=Computers ldap ssl = off ldap replication sleep = 1000 ldap passwd sync = yes #ldap debug level = 1 #ldap debug threshold = 1 ldapsam:trusted = yes idmap uid = 10000-39999 idmap gid = 10000-39999 create mask = 0666 directory mask = 0777 client ntlmv2 auth = yes dos charset = CP437 unix charset = UTF-8 log level = 1 [share] path = /mnt/zfs0 printable = no veto files = /.snap/.windows/.zfs/ writeable = yes browseable = yes inherit owner = no inherit permissions = no vfs objects = zfsacl guest ok = no inherit acls = Yes map archive = No map readonly = no nfs4:mode = special nfs4:acedup = merge nfs4:chown = yes hide dot files force directory mode = 0775 force create mode = 0660

    Read the article

  • How to scale MongoDB

    - by terence410
    I know that MongoDB can scale vertically. What about if I running out of disk? I am currently using EC2 with EBS. As you know, I have to assign EBS for a fixed size. What if the mongodb growth bigger than the EBS size? Do I have to create a larger EBS and Copy & Paste the files? Or shall we start more MongoDB instance and each connect to different EBS disk? In such case, I could connect to a different instance for different databases.

    Read the article

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • Grub Error 18 - Solid State Drive

    - by clint
    I recently used Raw Copy to make an image of my 300gb Raptor Hd to a OCZ Vertex SSD 60GB. And When I pluged in the SSD to boot I get a Grub Error 18. I have tried to changed in the BIOS setting to LBA, Large, Auto, trying different combination's. Any advice. thanks, Clint

    Read the article

  • How can I compress a movie to a specific file size in Windows 7's Live Movie Maker?

    - by Nathan Fellman
    In previous versions of Windows Movie Maker I could take a raw video file and specify the file size to compress it to, and Movie Maker would compress it accordingly (with the appropriate loss in quality). Live Movie Maker, which comes with Windows 7, doesn't seem to have this option. I can only set specify the requested quality. Is there any way to specify the size of the target file for Windows Live Movie Maker?

    Read the article

  • How to Import flip video to Final Cut Pro and edit flip video in Final Cut Pro?

    - by Yinahd
    Final Cut Pro is a professional video editing application for Mac users and it is widely used even by many Hollywood people on professional movie post-production. If you are a flip video fan and you want to give professional editing to your flip videos, Final Cut Pro is a great choice. However, Final Cut Pro does not allow raw flip videos to be imported to Final Cut Pro and you will need to convert flip video to Final Cut Pro supported formats.

    Read the article

  • IIS 7.0 - Every site suddenly redirecting root request to forms authentication

    - by Pittsburgh DBA
    Suddenly, IIS 7.0 is redirecting every request for the root of any domain hosted on the box to ~/Account/Logon, which is our Forms Authentication redirect. Additionally, some JavaScript and image requests are being similarly redirected, but not other aspx pages. This is not desirable. Nobody will admit to changing anything. Any ideas? EDIT: It turns out that something has gone wrong with the disk permissions. Can anyone point me to the way things are supposed to be in Windows Server 2008 for a standard ASP.Net installation? The disk permissions are out of whack now.

    Read the article

  • I need to monitor a physical RS232 port on an appliance?

    - by Kendor
    I need to verify what's being output on an RS232 port of an appliance that's running proprietary software (e.g. NOT Windows or Linux). The port is sending data to a target app on another appliance, but I need to verify/log the actual data raw outside of the appliances. Would appreciate a recommendation on process/software to attach to the physical sending port (I have a straight through RS232 cable) and grab sample output of that port.

    Read the article

  • Red Hat cluster: Failure of one of two services sharing the same virtual IP tears down IP

    - by js.
    I'm creating a 2+1 failover cluster under Red Hat 5.5 with 4 services of which 2 have to run on the same node, sharing the same virtual IP address. One of the services on each node needs a (SAN) disk, the other doesn't. I'm using HA-LVM. When I shut down (via ifdown) the two interfaces connected to the SAN to simulate SAN failure, the service needing the disk is disabled, the other keeps running, as expected. Surprisingly (and unfortunately), the virtual IP address shared by the two services on the same machine is also removed, rendering the still-running service useless. How can I configure the cluster to keep the IP address up?

    Read the article

  • Autocomplete server-side implementation

    - by toluju
    What is a fast and efficient way to implement the server-side component for an autocomplete feature in an html input box? I am writing a service to autocomplete user queries in our web interface's main search box, and the completions are displayed in an ajax-powered dropdown. The data we are running queries against is simply a large table of concepts our system knows about, which matches roughly with the set of wikipedia page titles. For this service obviously speed is of utmost importance, as responsiveness of the web page is important to the user experience. The current implementation simply loads all concepts into memory in a sorted set, and performs a simple log(n) lookup on a user keystroke. The tailset is then used to provide additional matches beyond the closest match. The problem with this solution is that it does not scale. It currently is running up against the VM heap space limit (I've set -Xmx2g, which is about the most we can push on our 32 bit machines), and this prevents us from expanding our concept table or adding more functionality. Switching to 64-bit VMs on machines with more memory isn't an immediate option. I've been hesitant to start working on a disk-based solution as I am concerned that disk seek time will kill performance. Are there possible solutions that will let me scale better, either entirely in memory or with some fast disk-backed implementations? Edits: @Gandalf: For our use case it is important the the autocompletion is comprehensive and isn't just extra help for the user. As for what we are completing, it is a list of concept-type pairs. For example, possible entries are [("Microsoft", "Software Company"), ("Jeff Atwood", "Programmer"), ("StackOverflow.com", "Website")]. We are using Lucene for the full search once a user selects an item from the autocomplete list, but I am not yet sure Lucene would work well for the autocomplete itself. @Glen: No databases are being used here. When I'm talking about a table I just mean the structured representation of my data. @Jason Day: My original implementation to this problem was to use a Trie, but the memory bloat with that was actually worse than the sorted set due to needing a large number of object references. I'll read on the ternary search trees to see if it could be of use.

    Read the article

  • OpenCV to use in memory buffers or file pointers

    - by The Unknown
    The two functions in openCV cvLoadImage and cvSaveImage accept file path's as arguments. For example, when saving a image it's cvSaveImage("/tmp/output.jpg", dstIpl) and it writes on the disk. Is there any way to feed this a buffer already in memory? So instead of a disk write, the output image will be in memory. I would also like to know this for both cvSaveImage and cvLoadImage (read and write to memory buffers). Thanks! My goal is to store the Encoded (jpeg) version of the file in Memory. Same goes to cvLoadImage, I want to load a jpeg that's in memory in to the IplImage format.

    Read the article

  • Ubuntu says FAT16, windows says NTF?

    - by myforwik
    I created a partition on USB harddisk in windows and it reports to be an NTFS partition. Yet in ubuntu 9.10 fdisk says it a FAT16 partition. If I mount with -t ntfs I see nothing, but if I mount without it I see all the files. Can anyone tell me whats going on here? Windows computer disk management definately says its NTFS, and a quick look at the raw data suggests it is NTFS, as I know the FAT16 very well.

    Read the article

  • NTFS-compressing Virtual PC disks (on host and/or guest)

    - by nlawalker
    I'm hoping someone here can answer these definitively: Does putting a VHD file in an NTFS-compressed folder on the host improve performance of the virtual machine, diminish performance, or neither? What about using NTFS compression within the guest? Does using compresssion on either the host or the guest lead to any problems like read or write errors? If I were to put a VHD in a compressed folder on the host, would I benefit from compacting it? I've seen references to using NTFS compression on quite a few VPC "tips and tricks" blog posts, and it seems like half of them say to never do it and the other half say that not only does it save disk space but it actually can improve performance if you have a fast CPU and your primary performance bottleneck is the disk.

    Read the article

  • How to serve a View as CSV in ASP.NET Web Forms

    - by ChessWhiz
    Hi, I have a MS SQL view that I want to make available as a CSV download in my ASPNET Web Forms app. I am using Entity Framework for other views and tables in the project. What's the best way to enable this download? I could add a HyperLink whose click handler iterates over the view, writes its CSV form to the disk, and then serves that file. However, I'd prefer not to write to the disk if it can be avoided, and that involves iteration code that may be avoided with some other solution. Any ideas?

    Read the article

  • Descending list ordered by file modification time

    - by user62367
    How can i generate a list of files in a directory [e.g.: "/mnt/hdd/PUB/"] ordered by the files modification time? [in descending order, the oldest modified file is at the lists end] ls -A -lRt would be great: https://pastebin.com/raw.php?i=AzuSVmrJ but if a file is changed in a directory it lists the full directory...so the pastebined link isn't good [i don't want a list ordered by "directories", i need a "per file" ordered list] os: openwrt..[no perl - not enough space for it :( + no "stat", or "file" command] Thank you!

    Read the article

  • DVD ripper for Windows

    - by Shawn Miller
    I am looking for a good DVD ripper software for Windows. Looking for something that will easily rip the raw bits DVD to hard drive without any loss of quality. Looking for something that will easily copy the VOB files to a server location for use with the Window Media Center DVD Library feature.

    Read the article

  • Application_End() cannot access cache through HttpContext.Current.Cache[key]

    - by Carl J.
    I want to be able to maintain certain objects between application restarts. To do that, I want to write specific cached items out to disk in Global.asax Application_End() function and re-load them back on Application_Start(). I currently have a cache helper class, which uses the following method to return the cached value: return HttpContext.Current.Cache[key]; Problem: during Application_End(), HttpContext.Current is null since there is no web request (it's an automated cleanup procedure) - therefore, I cannot access .Cache[] to retrieve any of the items to save to disk. Question: how can I access the cache items during Application_End()?

    Read the article

< Previous Page | 165 166 167 168 169 170 171 172 173 174 175 176  | Next Page >