Search Results

Search found 13288 results on 532 pages for 'print expression'.

Page 171/532 | < Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >

  • Perl replace slash in variable

    - by cc96ai
    How can I replace the slash inside the variable? $string = 'a\cc\ee'; $re = 'a\\cc'; $rep = "Work"; #doesnt work in variable $string =~ s/$re/$rep/og; print $string."\n"; #work with String $string =~ s/a\\cc/$rep/og; print $string."\n"; output: a\cc\ee Work\ee

    Read the article

  • urllib open - how to control the number of retries

    - by user1641071
    how can i control the number of retries of the "opener.open"? for example, in the following code, it will send about 6 "GET" HTTP requests (i saw it in the Wireshark sniffer) before it goes to the " except urllib.error.URLError" success/no-success lines. password_mgr = urllib.request.HTTPPasswordMgrWithDefaultRealm() password_mgr.add_password(None,url, username, password) handler = urllib.request.HTTPBasicAuthHandler(password_mgr) opener = urllib.request.build_opener(handler) try: resp = opener.open(url,None,1) except urllib.error.URLError as e: print ("no success") else: print ("success!")

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Why does my table values return nil when i clearly initialized them?

    - by user3717078
    players = {} function newPlayer(name) players[name]={x = 200, y = 100} --assign each player their x and y coordinates, which is x: 200 and y: 100 end function checkPosition(name?) -- Do i need a parameter? if players[name].x == 200 and players[name].y == 100 then --says players[name].x is a nil value print("good") else print("bad") end end Error: attempt to index ? (a nil value) Current Situation: The code above says players[name].x is a nil value, I would like to know why since i thought i assigned it in the function newPlayer.

    Read the article

  • php extending but with a new constructor...possible?

    - by Patrick
    I have a class: class test { function __construct() { print 'hello'; } function func_one() { print 'world'; } } what I would like to do is a have a class that sort of extends the test class. I say 'sort of', because the class needs to be able to run whatever function the test class is able to run, but NOT run the construct unless I ask it to. I do not want to override the construct. Anyone has any idea how to achieve this?

    Read the article

  • How do I parse youtube xml for a specific entry?

    - by sharataka
    I am trying to return the duration of the video but am having trouble. #YOUTUBE FEED #download the file: file = urllib2.urlopen('http://gdata.youtube.com/feeds/api/videos/2s0vk2wEMtA') #convert to string: data = file.read() #close file because we dont need it anymore: file.close() #entire feed root = etree.fromstring(data) for entry in root: for item in entry: print item When I print item, I see as the last element: Element '{http://gdata.youtube.com/schemas/2007}duration' at 0x10c4fb7d0 But I don't know how to get the value from this. Any advice?

    Read the article

  • Space as grouping separator in printf

    - by blekione
    I know how to use comma in printf as grouping separator to print value in format like 1,000,000.00 to print it that way I'm using command System.out.printf ("%,.2f", value); but how to use space as grouping separator to format value like 1 000 000.00 I tried to find solution but solutions with using DecimalFormat look at now to complicate for me (beginner level). Is there as easy way as in example with comma to do it?

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • Is there some way to make variables like $a and $b in regard to strict?

    - by Axeman
    In light of Michael Carman's comment, I have decided to rewrite the question. Note that 11 comments appear before this edit, and give credence to Michael's observation that I did not write the question in a way that made it clear what I was asking. Question: What is the standard--or cleanest way--to fake the special status that $a and $b have in regard to strict by simply importing a module? First of all some setup. The following works: #!/bin/perl use strict; print "\$a=$a\n"; print "\$b=$b\n"; If I add one more line: print "\$c=$c\n"; I get an error at compile time, which means that none of my dazzling print code gets to run. If I comment out use strict; it runs fine. Outside of strictures, $a and $b are mainly special in that sort passes the two values to be compared with those names. my @reverse_order = sort { $b <=> $a } @unsorted; Thus the main functional difference about $a and $b--even though Perl "knows their names"--is that you'd better know this when you sort, or use some of the functions in List::Util. It's only when you use strict, that $a and $b become special variables in a whole new way. They are the only variables that strict will pass over without complaining that they are not declared. : Now, I like strict, but it strikes me that if TIMTOWTDI (There is more than one way to do it) is Rule #1 in Perl, this is not very TIMTOWDI. It says that $a and $b are special and that's it. If you want to use variables you don't have to declare $a and $b are your guys. If you want to have three variables by adding $c, suddenly there's a whole other way to do it. Nevermind that in manipulating hashes $k and $v might make more sense: my %starts_upper_1_to_25 = skim { $k =~ m/^\p{IsUpper}/ && ( 1 <= $v && $v <= 25 ) } %my_hash ;` Now, I use and I like strict. But I just want $k and $v to be visible to skim for the most compact syntax. And I'd like it to be visible simply by use Hash::Helper qw<skim>; I'm not asking this question to know how to black-magic it. My "answer" below, should let you know that I know enough Perl to be dangerous. I'm asking if there is a way to make strict accept other variables, or what is the cleanest solution. The answer could well be no. If that's the case, it simply does not seem very TIMTOWTDI.

    Read the article

  • list in loop, Nonetype errors

    - by user2926755
    Here is my Code def printList(stringlist): empty = [] if stringlist is None: print empty else: print stringlist def add (stringlist, string): string = [] if string is None else string if stringlist is not None: stringlist.insert(0, string) else: stringlist.append(1) it somehow appears "AttributeError: 'NoneType' object has no attribute 'append'" I was originally looking for the code to be run like this: >>> myList = None >>> printList(myList) [] >>> for word in ['laundry','homework','cooking','cleaning']: myList = add(myList, word) printList(myList) [laundry] [homework, laundry] [cooking, homework, laundry] [cleaning, cooking, homework, laundry]

    Read the article

  • Merge decorator function as class

    - by SyetemHog
    How to make this merge function as class decorator? def merge(*arg, **kwarg): # get decorator args & kwargs def func(f): def tmp(*args, **kwargs): # get function args & kwargs kwargs.update(kwarg) # merge two dictionaries return f(*args, **kwargs) # return merged data return tmp return func Usage: @other_decorator # return *args and **kwarg @merge(list=['one','two','three']) # need to merge with @other_decorator def test(*a, **k): # get merged args and kwargs print 'args:', a print 'kwargs:', k

    Read the article

  • Enable "Current Page" in PrintDialog

    - by mizipzor
    Im using a System.Windows.Controls.PrintDialog to let the user print one or more pages from my application. This is what I currently got: PrintDialog printDialog = new PrintDialog(); printDialog.PageRangeSelection = PageRangeSelection.AllPages; printDialog.UserPageRangeEnabled = true; if (printDialog.ShowDialog() == true) { // do print ... } Im looking for the option to enable the Current Page radio button in the dialog. How to enable it?

    Read the article

  • passing back answers in prolog

    - by AhmadAssaf
    i have this code than runs perfectly .. returns a true .. when tracing the values are ok .. but its not returning back the answer .. it acts strangely when it ends and always return empty list .. uninstantiated variable .. test :- extend(4,12,[4,3,1,2],[[1,5],[3,4],[6]],_ExtendedBins). %printing basic information about the extend(NumBins,Capacity,RemainingNumbers,BinsSoFar,_ExtendedBins) :- getNumberofBins(BinsSoFar,NumberOfBins), msort(RemainingNumbers,SortedRemaining),nl, format("Current Number of Bins is :~w\n",[NumberOfBins]), format("Allowed Capacity is :~w\n",[Capacity]), format("maximum limit in bin is :~w\n",[NumBins]), format("Trying to fit :~w\n\n",[SortedRemaining]), format("Possible Solutions :\n\n"), fitElements(NumBins,NumberOfBins, Capacity,SortedRemaining,BinsSoFar,[]). %this is were the creation for possibilities will start %will check first if the number of bins allowed is less than then %we create a new list with all the possible combinations %after that we start matching to other bins with capacity constraint fitElements(NumBins,NumberOfBins, Capacity,RemainingNumbers,Bins,ExtendedBins) :- ( NumberOfBins < NumBins -> print('Creating new set: '); print('Sorry, Cannot create New Sets')), createNewList(Capacity,RemainingNumbers,Bins,ExtendedBins). createNewList(Capacity,RemainingNumbers,Bins,ExtendedBins) :- createNewList(Capacity,RemainingNumbers,Bins,[],ExtendedBins), print(ExtendedBins). createNewList(0,Bins,Bins,ExtendedBins,ExtendedBins). createNewList(_,[],_,ExtendedBins,ExtendedBins). createNewList(Capacity,[Element|Rest],Bins,Temp,ExtendedBins) :- conjunct_to_list(Element,ListedElement), append(ListedElement,Temp,NewList), sumlist(NewList,Sum), (Sum =< Capacity, append(ListedElement,ExtendedBins,Result); Capacity = 0), createNewList(Capacity,Rest,Bins,NewList,Result). fit(0,[],ExtendedBins,ExtendedBins). fit(Capacity,[Element|Rest],Bin,ExtendedBins) :- conjunct_to_list(Element,Listed), append(Listed,Bin,NewBin), sumlist(NewBin,Sum), (Sum =< Capacity -> fit(Capacity,Rest,NewBin,ExtendedBins); Capacity = 0, append(NewBin,ExtendedBins,NewExtendedBins), print(NewExtendedBins), fit(0,[],NewBin,ExtendedBins)). %get the number of bins provided getNumberofBins(List,NumberOfBins) :- getNumberofBins(List,0,NumberOfBins). getNumberofBins([],NumberOfBins,NumberOfBins). getNumberofBins([_List|Rest],TempCount,NumberOfBins) :- NewCount is TempCount + 1, %calculate the count getNumberofBins(Rest,NewCount,NumberOfBins). %recursive call %Convert set of terms into a list - used when needed to append conjunct_to_list((A,B), L) :- !, conjunct_to_list(A, L0), conjunct_to_list(B, L1), append(L0, L1, L). conjunct_to_list(A, [A]). Greatly appreciate the help

    Read the article

  • UnicodeDecodeError in pyton 2.7

    - by user2913962
    i try to write this code to process Arabic language by python import codecs file = codecs.open("C:\Python27\CCA_raw_utf8.txt","r","utf-8") text= file.read() #################################### print "\n "," --------------------------------------------" text=text[1:] words=text.split() for w in words: if w == unicode ("?????","utf-8"): print w but it doesn't and take error " if w == unicode ("?????","utf-8"): UnicodeDecodeError: 'utf8' codec can't decode byte 0xc7 in position 0: invalid continuation byte " why program gives this result and how we can correct that??

    Read the article

  • Specifics of List Membership

    - by phasetwenty
    How does Python (2.6.4, specifically) determine list membership in general? I've run some tests to see what it does: def main(): obj = fancy_obj(arg='C:\\') needle = (50, obj) haystack = [(50, fancy_obj(arg='C:\\')), (1, obj,), needle] print (1, fancy_obj(arg='C:\\'),) in haystack print needle in haystack if __name__ == '__main__': main() Which yields: False True This tells me that Python is probably checking the object references, which makes sense. Is there something more definitive I can look at?

    Read the article

  • perl, module variable

    - by Mike
    I don't really understand how scoping works in perl modules. This doesn't print anything. I would like it if running a.pl printed 1 b.pm $f=1; a.pl use b; print $f

    Read the article

  • Unable to get set intersection to work

    - by chavanak
    Sorry for the double post, I will update this question if I can't get things to work :) I am trying to compare two files. I will list the two file content: File 1 File 2 "d.complex.1" "d.complex.1" 1 4 5 5 48 47 65 21 d.complex.10 d.complex.10 46 6 21 46 109 121 192 192 TI am trying to compare the contents of the two file but not in a trivial way. I will explain what I want with an example. If you observe the file content I have typed above, the d.complex.1 of file_1 has "5" similar to d.complex.1 in file_2; the same d.complex.1 in file_1 has nothing similar to d.complex.10 in file_2. What I am trying to do is just to print out those d.complex. which has nothing in similar with the other d.complex. Consider the d.complex. as a heading if you want. But all I am trying is compare the numbers below each d.complex. and if nothing matches, I want that particular d.complex. from both files to be printed. If even one number is present in both d.complex. of both files, I want it to be rejected. My Code: The method I chose to achieve this was to use sets and then do a difference. Code I wrote was: first_complex=open( "file1.txt", "r" ) first_complex_lines=first_complex.readlines() first_complex_lines=map( string.strip, first_complex_lines ) first_complex.close() second_complex=open( "file2.txt", "r" ) second_complex_lines=second_complex.readlines() second_complex_lines=map( string.strip, second_complex_lines ) second_complex.close() list_1=[] list_2=[] res_1=[] for line in first_complex_lines: if line.startswith( "d.complex" ): res_1.append( [] ) res_1[-1].append( line ) res_2=[] for line in second_complex_lines: if line.startswith( "d.complex" ): res_2.append( [] ) res_2[-1].append( line ) h=len( res_1 ) k=len( res_2 ) for i in res_1: for j in res_2: print i[0] print j[0] target_set=set ( i ) target_set_1=set( j ) for s in target_set: if s not in target_set_1: if s[0] != "d": print s The above code is giving an output like this (just an example): d.complex.1.dssp d.complex.1.dssp 1 48 65 d.complex.1.dssp d.complex.10.dssp 46 21 109 What I would like to have is: d.complex.1 d.complex.1 (name from file2) d.complex.1 d.complex.10 (name from file2) I am sorry for confusing you guys, but this is all that is required. I am so new to python so my concept above might be flawed. Also I have never used sets before :(. Can someone give me a hand here?

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

< Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >