Search Results

Search found 14016 results on 561 pages for 'exception specification'.

Page 174/561 | < Previous Page | 170 171 172 173 174 175 176 177 178 179 180 181  | Next Page >

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • What are the essential COM componenets required for burning DVD in c#.net in Windows XP?

    - by shruti
    im trying to burn DVD/CD through frontend C#.net code... i have used IMAPI2 for buring CD/DVD in windows XP..but it is giving me unhandeled exception... as:- System.InvalidCastException: Unable to cast COM object of type 'IMAPI2.Interop.MsftFileSystemImageClass' to interface type 'IMAPI2.Interop.MsftFileSystemImage'. This operation failed because the QueryInterface call on the COM component for the interface with IID '{7CFF842C-7E97-4807-8304-910DD8F7C051}' failed due to the following error: No such interface supported (Exception from HRESULT: 0x80004002 (E_NOINTERFACE)) can anyone plz help me out to solve this pbm...im not able to solve this error.. this project is working fine in Windows7 but unable to work with XP...???

    Read the article

  • Graphics.FromHwnd(IntPtr.Zero) returns null, why?

    - by Martin Moser
    I'm currently investigating a problem with a 3rd party component (DevExpress) in my application. My issue is quite similar to this one DevExpress KB article. I get the same exception with more less the same stacktrace. So I used .NET Reflector to find out, what may be null in this scenario, and the only object which is a candiate to be null is Graphics. This is created with Graphics.FromHwnd(IntPtr.Zero). Because I don't have a broad knowledge about GDI, I would like to know if somebody can tell me possible scenarios when this may return null... I tried to reproduce it in a scenario where windows is out of GDI handle's, but then I'm getting a "out of handles" - exception at least once, which is not the case in the issue I'm investigating tia, Martin

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • C# MDX RenderToSurface, where to reset after device is lost?

    - by Moritz Schöfl
    Hi, I got a problem with the RenderToSurface class. When I resize the Form of my Device, the Draw method is still called, but doesnt throw an Exception, it looks like this: device.Clear(ClearFlags.Target, Color.Red, 0, 0); device.BeginScene(); // here is out commented code device.EndScene(); device.Present(); In another method, I wrote this: renderToSurface.BeginScene(surfaces[currentIndex]); // here is out commented code renderToSurface.EndScene(Filter.None); and this method seems to throw a nullpointer exception when I resize the window; So my question is: - where to reset / restore / handle the renderToSurface class? (i tried it with the DeviceReset event like following - void OnDeviceReset(object sender, EventArgs e) { renderToSurface = new RenderToSurface(Game.Device, Game.ClientSize.Width, Game.ClientSize.Height, Format.A8R8G8B8, true, DepthFormat.D16); } )

    Read the article

  • SQL Server (2005) Linked Server Issue

    - by David.Chu.ca
    I have SQL Server 2005 with several linked server defined. One of them is a connection to an Oracle server and another one is an ODBC bridge to another server on a remote machine (ODBC server). Recently I tried to use the linked server to Oracle to update data with two large size tables by using several joints. The update query took too long time and finally there was exception thrown: Update O set value = l.value FROM OracleServer..schema.largesizeTable O Join localLargeSizeTable l on .... The problem is that after the exception, I realized that another linked server to ODBC was not working any more. I had to restart SQL server to get the ODBC linked server back. It looks that the linked server pool could be crashed if any of them failed(not like sandbox in Chrome for each tab and no impact on other tabs or Chrome application at all). I am not sure if my assumption is correct or not. Is this a known issue of SQL server 2005?

    Read the article

  • If XmlException.SourceUri is read-only, what good is it?

    - by East of Nowhere
    I have a couple places in my code where it throwing a new System.Xml.XmlException seems appropriate. I could just do throw new XmlException("Your XML sucks go fix it then try again."); But I think it's better to take advantage whenever possible of members particular to the exception class (otherwise ya might as well throw a plain ol' Exception every time). SourceUri and LineNumber would be helpful, but they only have get methods, there's no way I can assign a value to them! There's only 3 constructor overloads and none of them have parameters for those members either; I can only initialize Message, nothing else. There has got to be some way to populate those data members with values, otherwise why does XmlException bother with them? I suppose I could make a new class that inherits XmlException and write a new constructor that initializes SourceUri etc. but still, there must be a way to just use XmlException. Right?

    Read the article

  • A generic error occurred in GDI+.

    - by Pinu
    A generic error occurred in GDI+ [ExternalException (0x80004005): A generic error occurred in GDI+.] System.Drawing.Image.Save(Stream stream, ImageCodecInfo encoder, EncoderParameters encoderParams) +615257 I have a webpage in which a pdf is converted to png, and using the response.outputstream it is displayed. when i run this on my local machine is works fine. but when i run the same code on server is throws this exception. my question is , where i could look in for error. as there is no inner exception or any other information provided. only clue is that it's happening on Image.Save , but the same code works perfectly fine on my local machine , then y is it not working on production???

    Read the article

  • NHibernate ManyToMany Relationship Cascading AllDeleteOrphan StackOverflowException

    - by Chris
    I have two objects that have a ManyToMany relationship with one another through a mapping table. Though, when I try to save it, I get a stack overflow exception. The following is the code for the mappings: //EventMapping.cs HasManyToMany(x => x.Performers).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("EventId").ChildKeyColumn("PerformerId"); //PerformerMapping.cs HasManyToMany<Event>(x => x.Events).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("PerformerId").ChildKeyColumn("EventId"); When I change the performermapping.cs to Cascade.None() I get rid of the exception but then my Event Object doesn't have the performer I associate with it. //In a unit test, paraphrased event.Performers.Add(performer); //Event eventRepository.Save<Event>(event); eventResult = eventRepository.GetById<Event>(event.id); //Event eventResult.Performers[0]; //is null, should have performer in it How should I be writing this properly? Thanks

    Read the article

  • Request header is too large

    - by stck777
    I found serveral IllegalStateException Exception in the logs: [#|2009-01-28T14:10:16.050+0100|SEVERE|sun-appserver2.1|javax.enterprise.system.container.web|_ThreadID=26;_ThreadName=httpSSLWorkerThread-80-53;_RequestID=871b8812-7bc5-4ed7-85f1-ea48f760b51e;|WEB0777: Unblocking keep-alive exception java.lang.IllegalStateException: PWC4662: Request header is too large at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:740) at org.apache.coyote.http11.InternalInputBuffer.parseHeader(InternalInputBuffer.java:657) at org.apache.coyote.http11.InternalInputBuffer.parseHeaders(InternalInputBuffer.java:543) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.parseRequest(DefaultProcessorTask.java:712) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.doProcess(DefaultProcessorTask.java:577) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.process(DefaultProcessorTask.java:831) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.executeProcessorTask(DefaultReadTask.java:341) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:263) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:214) at com.sun.enterprise.web.portunif.PortUnificationPipeline$PUTask.doTask(PortUnificationPipeline.java:380) at com.sun.enterprise.web.connector.grizzly.TaskBase.run(TaskBase.java:265) at com.sun.enterprise.web.connector.grizzly.ssl.SSLWorkerThread.run(SSLWorkerThread.java:106) |#] Does anybody know configuration changes to fix this?

    Read the article

  • Cannot execute a program. The command being executed "dqiitg0c.cmdline"

    - by Laxman
    i have used impersonation in this application. whenever this error occurs i required to restart the IIS.. please guide me to solve this issue. Error: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline". Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Runtime.InteropServices.ExternalException: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline".

    Read the article

  • A SelfHosted WCF Service over Basic HTTP Binding doesn't support more than 1000 concurrent requests

    - by Krishnan
    I have self hosted a WCF Service over BasicHttpBinding consumed by an ASMX Client. I'm simulating a concurrent user load of 1200 users. The service method takes a string parameter and returns a string. The data exchanged is less than 10KB. The processing time for a request is fixed at 2 seconds by having a Thread.Sleep(2000) statement. Nothing additional. I have removed all the DB Hits / business logic. The same piece of code runs fine for 1000 concurrent users. I get the following error when I bump up the number to 1200 users. System.Net.WebException: The underlying connection was closed: An unexpected error occurred on a receive. ---> System.IO.IOException: Unable to read data from the transport connection: An existing connection was forcibly closed by the remote host. ---> System.Net.Sockets.SocketException: An existing connection was forcibly closed by the remote host at System.Net.Sockets.Socket.Receive(Byte[] buffer, Int32 offset, Int32 size, SocketFlags socketFlags) at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) --- End of inner exception stack trace --- at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.PooledStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.Connection.SyncRead(HttpWebRequest request, Boolean userRetrievedStream, Boolean probeRead) --- End of inner exception stack trace --- at System.Web.Services.Protocols.WebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.HttpWebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at WCF.Throttling.Client.Service.Function2(String param) This exception is often reported on DataContract mismatch and large data exchange. But never when doing a load test. I have browsed enough and have tried most of the options which include, Enabled Trace & Message log on server side. But no errors logged. To overcome Port Exhaustion MaxUserPort is set to 65535, and TcpTimedWaitDelay 30 secs. MaxConcurrent Calls is set to 600, and MaxConcurrentInstances is set to 1200. The Open, Close, Send and Receive Timeouts are set to 10 Minutes. The HTTPWebRequest KeepAlive set to false. I have not been able to nail down the issue for the past two days. Any help would be appreciated. Thank you.

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • LINQ-to-entities - Null reference

    - by BlueRaja
    I could swear this was working the other day: var resultSet = (from o in _entities.Table1 where o.Table2.Table3.SomeColumn == SomeProperty select o ).First(); SelectedItem = resultSet.Table2.SomeOtherColumn; I am getting a null reference exception on the last line: resultSet.Table2 is null. Not only am I sure that all the foreign keys and whatnot have the correct values, but I don't see how Table2 could be null, since o.Table2.Table3.SomeColumn == SomeProperty. resultSet is being returned with all its properties set to the correct values, with the exception that Table2 is null.

    Read the article

  • Do minidump files contain the timestamp of the crash?

    - by Roger Lipscombe
    The MiscInfoStream in a minidump file contains the process create time. I'd like to find out how long the process has been running for before the crash. Does a minidump file contain the exception timestamp anywhere? WinDbg on this dump file displays the following, which implies that it's in there somewhere... Debug session time: Tue Dec 29 15:49:20.000 2009 (GMT+0) System Uptime: not available Process Uptime: 0 days 0:33:03.000 Note that today's Mar 15, so this is almost certainly the timestamp of the crash. I'd like a programmatic way to retrieve that value and the "Process Uptime" value. I found the MINIDUMP_MISC_INFO_3 structure, which contains some timezone information, but it doesn't seem to contain the exception time.

    Read the article

  • Django - I got TemplateSyntaxError when I try open the admin page. (http://DOMAIN_NAME/admin)

    - by user140827
    I use grappelly plugin. When I try open the admin page (/admin) I got TemplateSyntaxError. It says 'get_generic_relation_list' is invalid block tag. TemplateSyntaxError at /admin/ Invalid block tag: 'get_generic_relation_list', expected 'endblock' Request Method: GET Request URL: http://DOMAIN_NAME/admin/ Django Version: 1.4 Exception Type: TemplateSyntaxError Exception Value: Invalid block tag: 'get_generic_relation_list', expected 'endblock' Exception Location: /opt/python27/django/1.4/lib/python2.7/site-packages/django/template/base.py in invalid_block_tag, line 320 Python Executable: /opt/python27/django/1.4/bin/python Python Version: 2.7.0 Python Path: ['/home/vhosts/DOMAIN_NAME/httpdocs/media', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov/lib', '/home/vhosts/DOMAIN_NAME/httpdocs/', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private', '/opt/python27/django/1.4', '/home/vhosts/DOMAIN_NAME/httpdocs', '/opt/python27/django/1.4/lib/python2.7/site-packages/setuptools-0.6c12dev_r88846-py2.7.egg', '/opt/python27/django/1.4/lib/python2.7/site-packages/pip-0.8.1-py2.7.egg', '/opt/python27/django/1.4/lib/python27.zip', '/opt/python27/django/1.4/lib/python2.7', '/opt/python27/django/1.4/lib/python2.7/plat-linux2', '/opt/python27/django/1.4/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/lib-old', '/opt/python27/django/1.4/lib/python2.7/lib-dynload', '/opt/python27/lib/python2.7', '/opt/python27/lib/python2.7/plat-linux2', '/opt/python27/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/setuptools-0.6c11-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/flup-1.0.3.dev_20100525-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/virtualenv-1.5.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLAlchemy-0.6.4-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLObject-0.14.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/FormEncode-1.2.3dev-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/MySQL_python-1.2.3-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/psycopg2-2.2.2-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/pysqlite-2.6.0-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/PIL'] Server time: ???, 7 ??? 2012 04:19:42 +0700 Error during template rendering In template /home/vhosts/DOMAIN_NAME/httpdocs/templates/grappelli/admin/base.html, error at line 28 Invalid block tag: 'get_generic_relation_list', expected 'endblock' 18 <!--[if lt IE 8]> 19 <script src="http://ie7-js.googlecode.com/svn/version/2.0(beta3)/IE8.js" type="text/javascript"></script> 20 <![endif]--> 21 {% block javascripts %} 22 <script type="text/javascript" src="{% admin_media_prefix %}jquery/jquery-1.3.2.min.js"></script> 23 <script type="text/javascript" src="{% admin_media_prefix %}js/admin/Bookmarks.js"></script> 24 <script type="text/javascript"> 25 // Admin URL 26 var ADMIN_URL = "{% get_admin_url %}"; 27 // Generic Relations 28 {% get_generic_relation_list %} 29 // Get Bookmarks 30 $(document).ready(function(){ 31 $.ajax({ 32 type: "GET", 33 url: '{% url grp_bookmark_get %}', 34 data: "path=" + escape(window.location.pathname + window.location.search), 35 dataType: "html", 36 success: function(data){ 37 $('ul#bookmarks').replaceWith(data); 38 }

    Read the article

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

  • How to use third party themes in swing application?

    - by swift
    I want to use some third party themes (like synthetica http://www.javasoft.de/synthetica/themes/) in my swing appliaction. i am using eclipse ide, got the jar file of theme and did the following modification(according to the readme file from the theme) in my code try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); } but after this modification its showing the following error The type de.javasoft.plaf.synthetica.SyntheticaLookAndFeel cannot be resolved. It is indirectly referenced from required .class files what does this mean? i tried searching on net but cant really find any useful answers Contents of Readme file: System Requirements =================== Java SE 5 (JRE 1.5.0) or above Synthetica V2.2.0 or above Integration =========== 1. Ensure that your classpath contains all Synthetica libraries (including Synthetica's core library 'synthetica.jar'). 2. Enable the Synthetica Look and Feel at startup time in your application: import de.javasoft.plaf.synthetica.SyntheticaBlackMoonLookAndFeel; try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); }

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • jQuery: Use of undefined constant data assumed 'data'

    - by morpheous
    I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

    Read the article

  • Java multiple connections downloading file

    - by weulerjunior
    Hello friends, I was wanting to add multiple connections in the code below to be able to download files faster. Could someone help me? Thanks in advance. public void run() { RandomAccessFile file = null; InputStream stream = null; try { // Open connection to URL. HttpURLConnection connection = (HttpURLConnection) url.openConnection(); // Specify what portion of file to download. connection.setRequestProperty("Range", "bytes=" + downloaded + "-"); // Connect to server. connection.connect(); // Make sure response code is in the 200 range. if (connection.getResponseCode() / 100 != 2) { error(); } // Check for valid content length. int contentLength = connection.getContentLength(); if (contentLength < 1) { error(); } /* Set the size for this download if it hasn't been already set. */ if (size == -1) { size = contentLength; stateChanged(); } // Open file and seek to the end of it. file = new RandomAccessFile("C:\\"+getFileName(url), "rw"); file.seek(downloaded); stream = connection.getInputStream(); while (status == DOWNLOADING) { /* Size buffer according to how much of the file is left to download. */ byte buffer[]; if (size - downloaded > MAX_BUFFER_SIZE) { buffer = new byte[MAX_BUFFER_SIZE]; } else { buffer = new byte[size - downloaded]; } // Read from server into buffer. int read = stream.read(buffer); if (read == -1) { break; } // Write buffer to file. file.write(buffer, 0, read); downloaded += read; stateChanged(); } /* Change status to complete if this point was reached because downloading has finished. */ if (status == DOWNLOADING) { status = COMPLETE; stateChanged(); } } catch (Exception e) { error(); } finally { // Close file. if (file != null) { try { file.close(); } catch (Exception e) { } } // Close connection to server. if (stream != null) { try { stream.close(); } catch (Exception e) { } } } }

    Read the article

  • OpenID: Trying to Get Email Address from Google OP

    - by Zaff
    I’m using dotnetopenauth 3.2 to implement Openid and can’t figure out how to get Google to pass the email address in the Claims Response. I know that Google doesn’t support simple registration, but I can’t determine what they do support. Caveat to this question is that I just started learning OpenID and I know I don’t have a solid grasp on the specification which I think is leading to my confusion. Any help would be appreciated!

    Read the article

  • jQuery/Ajax/javascript in FireFox Error when using $.post/$.get

    - by IsenGrim
    uncaught exception: [Exception... "Component returned failure code: 0x80004005 (NS_ERROR_FAILURE)" nsresult: "0x80004005 (NS_ERROR_FAILURE)" location: "JS frame :: http://localhost/scripts/jQuery.js :: anonymous :: line 808" data: no] Line 0 is the error i get when i bring up firebug. This only happens in firefox (and maybe other browsers) but the code works fine in IE8. I have codes like this in jquery: $("#Logout").live("click", function (e) { e.preventDefault(e); $.post("/logout.php", {}, function () { //--a bunch of animations--// window.location = "/login.php"; } }); I have no idea whats wrong as even the error message is not helpful at all.. inside logout.php: <?php session_start(); session_destroy(); ?> Also dont work if I used GET or inserted phantom data. Or is there a more elegant way to do this?

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Stack trace in website project, when debug = false

    - by chandmk
    We have a website project. We are logging unhanded exceptions via a appdomain level exception handler. When we set debug= true in web.config, the exception log is showing the offending line numbers in the stack trace. But when we set debug = false, in web.config, log is not displaying the line numbers. We are not in a position to convert the website project in to webapplication project type at this time. Its legacy application and almost all the code is in aspx pages. We also need to leave the project in 'updatable' mode. i.e. We can't user pre-compile option. We are generating pdb files. Is there anyway to tell this kind of website projects to generate the pdb files, and show the line numbers in the stack trace?

    Read the article

< Previous Page | 170 171 172 173 174 175 176 177 178 179 180 181  | Next Page >