Search Results

Search found 6394 results on 256 pages for 'regular expressions'.

Page 178/256 | < Previous Page | 174 175 176 177 178 179 180 181 182 183 184 185  | Next Page >

• Seemingly normal link does not work in MVC, IIS5, SparkView.

  - by Matt W

  I have a regular link being generated in MVC1.0 as: /Login/Logout This link does not work. The code for it is: <a href="${Links.Logout}" class="SignOut">Sign out</a> As I am using SparkView. I am using IIS5.1 on WinXP Pro. I cannot work out why the link on the page calls the MVC action if I open the link in a separate browser tab but not when I click directly on it in the original page. This feels like a browser bug (Chrome, Firefox, IE8) but they all perform the same way. Thanks, Matt.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• How do I put my return data from an asmx into JSON? I'm having trouble finding decent literature

  - by jphenow

  I want to return an array of javascript objects from my asp.net asmx file. ie. variable = [ { *value1*: 'value1', *value2*: 'value2', ..., }, { . . } ]; I seem have been having trouble reaching this. I'd put this into code but I've been hacking away at it so much it'd probably do more harm than good in having this answered. Basically I am using a web service to find names as people type the name. I'd use a regular text file or something but its a huge database that's always changing - and don't worry I've indexed the names so searching can be a little snappier - but I would really prefer to stick with this method and just figure out how to get usable JSON back to javascript. I've seen a few that sort of attempt to describe how one would approach this but I honestly think microsofts articles are damn near unreadable. Thanks in advance for assistance.

  Read the article

• How to skip "Loose Object" popup when running 'git gui'

  - by Michael Donohue

  When I run 'git gui' I get a popup that says This repository currently has approximately 1500 loose objects. It then suggests compressing the database. I've done this before, and it reduces the loose objects to about 250, but that doesn't suppress the popup. Compressing again doesn't change the number of loose objects. Our current workflow requires significant use of 'rebase' as we are transitioning from Perforce, and Perforce is still the canonical SCM. Once Git is the canonical SCM, we will do regular merges, and the loose objects problem should be greatly mitigated. In the mean time, I'd really like to make this 'helpful' popup go away.

  Read the article

• NSString: EOL and rangeOfString issues

  - by carloe

  Could someone please tell me if I am missing something here... I am trying to parse individual JSON objects out of a data stream. The data stream is buffered in a regular NSString, and the individual JSON objects are delineated by a EOL marker. if([dataBuffer rangeOfString:@"\n"].location != NSNotFound) { NSString *tmp = [dataBuffer stringByReplacingOccurrencesOfString:@"\n" withString:@"NEWLINE"]; NSLog(@"%@", tmp); } The code above outputs "...}NEWLINE{..." as expected. But if I change the @"\n" in the if-statement above to @"}\n", I get nothing.

  Read the article

• Open C: Directly with `FileStream` without `CreateFile` API

  - by DxCK

  I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

  Read the article

• Replace text in string with delimeters using Regex

  - by user1057735

  I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

  Read the article

• Combining aggregate functions in an (ANSI) SQL statement

  - by morpheous

  I have aggregate functions foo(), foobar(), fredstats(), barneystats() I want to create a domain specific query language (DSQL) above my DB, to facilitate using using a domain language to query the DB. The 'language' comprises of boolean expressions (or more specifically SQL like criteria) which I then 'translate' back into pure (ANSI) SQL and send to the underlying Db. The following lines are examples of what the language statements will look like, and hopefully, it will help further clarify the concept: **Example 1** DQL statement: foobar('yellow') between 1 and 3 and fredstats('weight') > 42 Translation: fetch all rows in an underlying table where computed values for aggregate function foobar() is between 1 and 3 AND computed value for AGG FUNC fredstats() is greater than 42 **Example 2** DQL statement: fredstats('weight') < barneystats('weight') AND foo('fighter') in (9,10,11) AND foobar('green') <> 42 Translation: Fetch all rows where the specified criteria matches **Example 3** DQL statement: foobar('green') / foobar('red') <> 42 Translation: Fetch all rows where the specified criteria matches **Example 4** DQL statement: foobar('green') - foobar('red') >= 42 Translation: Fetch all rows where the specified criteria matches Given the following information: The table upon which the queries above are being executed is called 'tbl' table 'tbl' has the following structure (id int, name varchar(32), weight float) The result set returns only the tbl.id, tbl.name and the names of the aggregate functions as columns in the result set - so for example the foobar() AGG FUNC column will be called foobar in the result set. So for example, the first DQL query will return a result set with the following columns: id, name, foobar, fredstats Given the above, my questions then are: What would be the underlying SQL required for Example1 ? What would be the underlying SQL required for Example3 ? Given an algebraic equation comprising of AGGREGATE functions, Is there a way of generalizing the algorithm needed to generate the required ANSI SQL statement(s)? I am using PostgreSQL as the db, but I would prefer to use ANSI SQL wherever possible.

  Read the article

• Getting Unit Tests to work with Komodo IDE for Python

  - by devoured elysium

  I've tried to run the following code on Komodo IDE (for python): import unittest class MathLibraryTests(unittest.TestCase): def test1Plus1Equals2(self): self.assertEqual(1+1, 2) Then, I created a new test plan, pointing to this project(file) directory and tried to run it the test plan. It seems to run but it doesn't seem to find any tests. If I try to run the following code with the "regular" run command (F7) class MathLibraryTests(unittest.TestCase): def testPlus1Equals2(self): self.assertEqual(1+1, 2) if __name__ == "__main__": unittest.main() it works. I get the following output: ---------------------------------------------------------------------- Ran 1 test in 0.000s OK What might I be doing wrong?

  Read the article

• MS Access 2003 - Is there a way to programmatically define the data for a chart?

  - by Justin

  So I have some VBA for taking charts built with the Form's Chart Wizard, and automatically inserting it into PowerPoint Presentation slides. I use those chart-forms as sub forms within a larger forms that has parameters the user can select to determine what is on the chart. The idea is that the user can determine the parameter, build the chart to his/her liking, and click a button and have it in a ppt slide with the company's background template, blah blah blah..... So it works, though it is very bulky in terms of the amount of objects I have to use to accomplish this. I use expressions such as the following: like forms!frmMain.Month&* to get the input values into the saved queries, which was fine when i first started, but it went over so well and they want so many options, that it is driving the number of saved queries/objects up. I need several saved forms with charts because of the number of different types of charts I need to have this be able to handle. SO FINALLY TO MY QUESTION: I would much rather do all this on the fly with some VBA. I know how to insert list boxes, and text boxes on a form, and I know how to use SQL in VBA to get the values I want from tables/queries using VBA, I just don't know if there is some vba I can use to set the data values of the charts from a resulting recordset: DIM rs AS DAO.Rescordset DIM db AS DAO.Database DIM sql AS String sql = "SELECT TOP 5 Count(tblMain.TransactionID) AS Total, tblMain.Location FROM tblMain WHERE (((tblMain.Month) = """ & me.txtMonth & """ )) ORDER BY Count (tblMain.TransactionID) DESC;" set db = currentDB set rs = db.OpenRecordSet(sql) rs.movefirst some kind of cool code in here to make this recordset the data of chart in frmChart ("Chart01") thanks for your help. apologies for the length of the explanation.

  Read the article

• Invoking play on a QTMovie causes screensaver to deactivate on Snow Leopard

  - by ressaw

  I'm trying to port a working Leopard screensaver to Snow Leopard but it's deactivating after about half a second. The screensaver seems to deactivate upon invoking play on a QTMovie. And it deactivates both upon -play on the QTMovie object itself, and -play:self on the QTMovieView. If I don't actually call -play on the object, the screensaver does not deactivate and sits still on the first frame of the movie. Setting up the same code in a regular Cocoa Application works fine, and the screensaver also works fine in preview mode in the System Preferences. Any help is greatly appreciated.

  Read the article

• question about frequency of updating access

  - by I__

  i have a table in an access database this access database is used on a regular basis, basically from 9-5 someone else has a copy of this exact table. sometimes records are added, sometimes deleted, and sometimes data within the records is updated. i need to update the access database table with the offsite table every hour or so. what is the best algorithm of updating the data? there are about 5000 records. would it severely lock up the table for a few seconds every hour? i would like to publicly apologize for my rude comment to david fenton

  Read the article

• Display subclass data in XCode Expression window

  - by Nick VanderPyle

  I'm debugging an iPhone application I've written using XCode 3.2 and I cannot view the relevant public properties of an object I pull from Core Data. When I watch the object in the Expressions window it only displays the data from the base NSManagedObject. I'd like to see the properties that are on the subclass, not the superclass. If it helps, here's some of the code I'm using. Settings is a subclass of NSManagedObject. I created it using XCode's built-in modeler. Declared like: @interface Settings : NSManagedObject { } @property (nonatomic, retain) NSNumber * hasNews; @property (nonatomic, retain) NSString * logoUrl; @property (nonatomic, retain) NSNumber * hasPaymentGateway; @property (nonatomic, retain) NSString * customerCode; ... In the interface of my controller I have: Settings *settings; I populate settings with: settings = (Settings *)[NSEntityDescription insertNewObjectForEntityForName:@"Settings" inManagedObjectContext:UIAppManagedObjectContext()]; I then set the properties like: settings.hasNews = [NSNumber numberWithBool:TRUE]; I've tried casting settings as (Settings *) in the Expression window but that doesn't help. All I see are the properties to NSManagedObject. I'm using NSLog but would rather not.

  Read the article

• Javascript substrings multiline replace by RegExp

  - by Radek Šimko

  Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

  Read the article

• Trying to create text boxes dynammically and remove them

  - by fari

  I am using VB.NET vb 2008 . I am trying to create text boxes dynammically and remove them here is the code i have written so far Private Sub setTextBox() Dim num As Integer Dim pos As Integer num = Len(word) temp = String.Copy(word) Dim intcount As Integer remove() GuessBox.Visible = True letters.Visible = True pos = 0 'To create the dynamic text box and add the controls For intcount = 0 To num - 1 Txtdynamic = New TextBox Txtdynamic.Width = 20 Txtdynamic.Visible = True Txtdynamic.MaxLength = 1 Txtdynamic.Location = New Point(pos + 5, 0) pos = pos + 30 'set the font size Txtdynamic.Font = New System.Drawing.Font("Verdana", 8.25!, System.Drawing.FontStyle.Regular, System.Drawing.GraphicsUnit.Point, CType(0, Byte)) Txtdynamic.Name = "txtdynamic_" & intcount & "_mycntrl" Txtdynamic.Enabled = False Txtdynamic.Text = "" Panel1.Controls.Add(Txtdynamic) Next Panel1.Visible = True Controls.Add(Panel1) Controls.Add(GuessBox) Controls.Add(letters) letter = "" letters.Text = "" hang_lable.Text = "" tries = 0 End Sub`enter code here` Function remove() For Each ctrl In Panel1.Controls Panel1.Controls.Remove(ctrl) Next End Function I am able to create the textboxes but only a few of them are removed. by using For Each ctrl In Panel1.Controls it doesn't retrieve all the controls and some ae duplicated as well.

  Read the article

• Typed Arrays in Gecko 2: Float32Array concatenation and expansion.

  - by janesconference

  Hi all, I'm a bit confused with Javascript Typed Arrays. What I have several *Float32Array*s, that have no concat method. I'd like to concatenate them all inside another Float32Array, but: as I said before, there is no concatenation method if I try to write past the array length, the array is not expanded (aka this won't work - please note that event.frameBuffer and buffer are both Float32Array and that I don't know what the final length of my buffer will be): var length_now = buffer.length; for (var i = 0; i < event.frameBuffer.length; i += 1) { buffer [length_now + i] = event.frameBuffer[i]; } The only solution I found is to copy the Float32Array in a regular array, that's definitely not what I want. How would you do, stackoverflowers?

  Read the article

• How to get a service to listen on port 80 on Windows Server 2003

  - by Miky D

  I've coded a custom windows service that listens on TCP port 80 but when I try to install it on a Windows Server 2003 machine it fails to start because some other service is already listening on that port. So far I've disabled the IIS Admin service and the HTTP SSL service but no luck. When I run netstat -a -n -o | findstr 0.0:80 it gives me the process id 4 as the culprit, but when I look at the running processes that process id points to the "System" process. What can I do to get the System process to stop listening on port 80 and get my service to listen instead? P.S. I should point out that the service runs fine if I install it on my Windows XP or Windows 7 development boxes. Also, I should specify that this has nothing to do with it being a service. I've tried starting a regular application that attempts to bing to port 80 on the Windows Server 2003 with the same outcome - it fails because another application is already bound to that port.

  Read the article

• Getting "on the wire" Size of Messages in WCF

  - by Mystagogue

  While I'm making SOAP or REST invocations to WCF, I'd like to have the channel stack on either end (client and server) record the on-the-wire size of the data received. So I'm guessing I need to add a custom behavior to the channel stack on either side. That is, on the server side I'd record the IP-header advertised size that was received. On the client side I'd record the IP-header advertised size that was returned from the server. But this presupposes that this information is visible to a custom WCF behavior at the channel stack level. Perhaps it is only visible at the level of ASP.NET (at a layer beneath WCF)? In short, does anyone have any further insight on if and how this information is accessible? I must qualify that this "size" data will be collected in a production environment, as part of regular business logic calls. This question is related to my earlier bandwidth question.

  Read the article

• How to use Zend Cache with SimpleXML objects?

  - by Jeremy Hicks

  I'm trying to cache the user timeline of a Twitter feed using Zend_Service_Twitter which returns its results as a SimpleXML object. Unfortunately the regular serialize functions (which Zend Cache uses) don't play nice with SimpleXMl objects. I found this http://www.mail-archive.com/[email protected]/msg18133.html. So it looks like I'll need to create some kind of custom frontend for Zend Cache to be able to change the serialize function used. Anybody ever done this already or can point me where to look to start?

  Read the article

• Does DataType DataAnnotation Check the Expression?

  - by Jason

  I am currently using DataAnnotations within my ASP.NET MVC website to ensure data is properly validated. One question I wanted to verify (I think I know the answer, but I can't find verification online) - does the DataType DataAnnotation perform regular expression checks to ensure that you have received a valid e-mail/phone/currency/etc? [Required(ErrorMessage = "Price required")] [DataType(DataType.Currency, ErrorMessage = "Not a valid price")] [Range(0, double.MaxValue, ErrorMessage = "Price must be greater than 0.")] public decimal Price { get; set; } I believe the answer is no (meaning I have to provide my own, custom, RegularExpressionAttribute), but I wanted to double check before I do that for various field types.

  Read the article

• Intercept web requests from a WebView Flash plugin

  - by starkos

  I've got a desktop browser app which uses a WebView to host a Flash plugin. The Flash plugin makes regular requests to an external website for new data, which it then draws as fancy graphics. I'd like to intercept these web requests and get at the data (so I can display it via Growl, instead of keeping a desktop window around). But best I can tell, requests made by Flash don't get picked up by the normal WebView delegates. Is there another place I can set a hook? I tried installing a custom NSURLCache via [NSURLCache setSharedURLCache] but that never got called. I also tried method swizzling a few of the other classes (like NSCachedURLResponse) but couldn't find a way in. Any ideas? Many thanks!

  Read the article

• Eclipse keyword highlighting in in my own text editor

  - by Torok Balint

  I made a simple text editor in eclipse to which I added some simple WordRule based syntax highlighting to highlight the language keywords. The problem is that when a keyword is part of an identifier (eg. "import" is part of "extra_import"), then "import" is highlighted in "extra_import". How can I stop eclipse to highlight a a keyword if it is only a sub string of another string? Anlther question; is there a regular expression based IRule? What is the purpose of WhitespaceRule? White spaces are usually not highlighted. Thaks

  Read the article

• Lamp with mod_fastcgi

  - by Jonathan

  Hi! I am building a cgi application, and now I would like it to be like an application that stands and parses each connection, with this, I can have all session variables saved in memory instead of saving them to file(or anyother place) and loading them again on a new connection I am using lamp within a linux vmware but I can't seem to find how to install the module for it to work and what to change in the httpd.conf. I tried to compile the module, but I couldn't because my apache isn't a regular instalation, its a lamp already built one, and it seems that the mod needs the apache directory to be compiled. I saw some coding examples out there, so I guess is not that hard once its runing ok with Apache Can you help me with this please? Thanks, Joe

  Read the article

• Is it possible to force ignore the :hover pseudoclass for iPhone/iPad users?

  - by christophercamps

  I have some css menus on my site that expand with :hover (without js) This works in a semi-broken way on iDevices, for example a tap will activate the :hover rule and expand the menu, but then tapping elsewhere doesn't remove the :hover. Also if there is a link inside the element that is :hover'ed, you have to tap twice to activate the link (first tap triggers :hover, second tap triggers link). I've been able to make things work nicely on iphone by binding the touchstart event. The problem is that sometimes mobile safari still chooses to trigger the :hover rule from the css instead of my touchstart events! I know this is the problem because when I disable all the :hover rules manually in the css, mobile safari works great (but regular browsers obviously don't anymore). Is there a way to dynamically "cancel" :hover rules for certain elements when the user is on mobile safari? I'm using jQuery.

  Read the article

• Multi-dimensional array edge/border conditions

  - by kirbuchi

  Hi, I'm iterating over a 3 dimensional array (which is an image with 3 values for each pixel) to apply a 3x3 filter to each pixel as follows: //For each value on the image for (i=0;i<3*width*height;i++){ //For each filter value for (j=0;j<9;j++){ if (notOutsideEdgesCondition){ *(**(outArray)+i)+= *(**(pixelArray)+i-1+(j%3)) * (*(filter+j)); } } } I'm using pointer arithmetic because if I used array notation I'd have 4 loops and I'm trying to have the least possible number of loops. My problem is my notOutsideEdgesCondition is getting quite out of hands because I have to consider 8 border cases. I have the following handled conditions Left Column: ((i%width)==0) && (j%3==0) Right Column: ((i-1)%width ==0) && (i>1) && (j%3==2) Upper Row: (i<width) && (j<2) Lower Row: (i>(width*height-width)) && (j>5) and still have to consider the 4 corner cases which will have longer expressions. At this point I've stopped and asked myself if this is the best way to go because If I have a 5 line long conditional evaluation it'll not only be truly painful to debug but will slow the inner loop. That's why I come to you to ask if there's a known algorithm to handle this cases or if there's a better approach for my problem. Thanks a lot.

  Read the article

< Previous Page | 174 175 176 177 178 179 180 181 182 183 184 185  | Next Page >