Search Results

Search found 6492 results on 260 pages for 'trigger io'.

Page 182/260 | < Previous Page | 178 179 180 181 182 183 184 185 186 187 188 189  | Next Page >

  • Problem using System.Xml in unit test in MonoDevelop (MonoTouch)

    - by hambonious
    I'm new to the MonoDevelop and MonoTouch environment so hopefully I'm just missing something easy here. When I have a unit test that requires the System.Xml or System.Xml.Linq namespaces, I get the following error when I run the test: System.IO.FileNotFoundException : Could not load file or assembly 'System.Xml.Linq, Version=2.0.5.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. Things I've verified: I have the proper usings in the test. The project builds with no problems. Using these namespaces work fine when I run the app in the emulator. I've written a very simple unit test to prove that unit testing works at all (and it does). I'm a test driven kinda guy so I can't wait to get this working so I can progress with my app. Thanks in advance.

    Read the article

  • Reworking my singly linked list

    - by Stradigos
    Hello everyone, thanks for taking the time to stop by my question. Below you will find my working SLL, but I want to make more use of C# and, instead of having two classes, SLL and Node, I want to use Node's constructors to do all the work (To where if you pass a string through the node, the constructor will chop it up into char nodes). The problem is, after an a few hours of tinkering, I'm not really getting anywhere... using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { SLL mySLL = new SLL(); mySLL.add('a'); mySLL.add('b'); mySLL.add('c'); mySLL.add('d'); mySLL.add('e'); mySLL.add('f'); Console.Out.WriteLine("Node count = " + mySLL.count); mySLL.reverse(); mySLL.traverse(); Console.Out.WriteLine("\n The header is: " + mySLL.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; public Node() { next = null; } public Node(char c) { this.data = c; } public Node(string s) { } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } } class SLL { private Node head; private int totalNode; public SLL() { head = null; totalNode = 0; } public void add(char s) { if (head == null) { head = new Node(); head.data = s; } else { Node temp; temp = new Node(); temp.data = s; temp.nextNode = head; head = temp; } totalNode++; } public int count { get { return totalNode; } } public char gethead { get { return head.data; } } public void traverse() { Node temp = head; while(temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public void reverse() { Node q = null; Node p = this.head; while(p!=null) { Node r=p; p=p.nextNode; r.nextNode=q; q=r; } this.head = q; } } } } Here's what I have so far in trying to work it into Node's constructors: using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { //Node myList = new Node(); //TextReader tr = new StreamReader("data.txt"); //string line; //while ((line = tr.ReadLine()) != null) //{ // Console.WriteLine(line); //} //tr.Close(); Node myNode = new Node("hello"); Console.Out.WriteLine(myNode.count); myNode.reverse(); myNode.traverse(); // Console.Out.WriteLine(myNode.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; private Node head; private int totalNode; public Node() { head = null; totalNode = 0; } public Node(char c) { if (head == null) { head = new Node(); head.data = c; } else { Node temp; temp = new Node(); temp.data = c; temp.nextNode = head; head = temp; } totalNode++; } public Node(string s) { foreach (char x in s) { new Node(x); } } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } public void reverse() { Node q = null; Node p = this.head; while (p != null) { Node r = p; p = p.nextNode; r.nextNode = q; q = r; } this.head = q; } public void traverse() { Node temp = head; while (temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public int count { get { return totalNode; } } } } } Ideally, the only constructors and methods I would be left with are Node(), Node(char c), Node(string s), Node reserve() and I'll be reworking traverse into a ToString overload. Any suggestions?

    Read the article

  • how to feed a file to telnet

    - by knittl
    hello community, understanding http and headers i played around with telnet to send requests. to not type everything again and again and again i thought i'd write a small textfile with all the commands i need. my file is as simple as follows: GET /somefile.php HTTP/1.1 Host: localhost i then try to feed it to telnet with io-redirection: $ telnet localhost 80 < telnet.txt but all output i get is Trying ::1... Connected to localhost. Escape character is '^]'. Connection closed by foreign host. what am i doing wrong?

    Read the article

  • Android RandomAccessFile usage from resource

    - by lacas
    my code is String fileIn = resources.getResourceName(resourceID); Log.e("fileIn", fileIn); //BufferedReader buffer = new BufferedReader(new InputStreamReader(fileIn)); RandomAccessFile buffer = null; try { buffer = new RandomAccessFile(fileIn, "r"); } catch (FileNotFoundException e) { Log.e("err", ""+e); } /fileIn(6062): ls3d.gold.paper:raw/wwe_obj i get 11-26 15:06:35.027: ERROR/err(6062): java.io.FileNotFoundException: /ls3d.gold.paper:raw/wwe_obj (No such file or directory) How can I access a file using randomaccessfile in java? How can I load from a resource? (R.raw.wwe_obj)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Redis version on Cloudbees is out of date?

    - by Alan Krueger
    I'm setting up an OSS build in Cloudbees with /usr/sbin/redis-server being started as one of the build tasks: + /usr/sbin/redis-server [204] 04 Nov 03:52:58 # Warning: no config file specified, using the default config. In order to specify a config file use 'redis-server /path/to/redis.conf' [204] 04 Nov 03:52:58 * Server started, Redis version 2.0.3 The (Redis site)[http://redis.io/download] shows 2.6.2 to be the current version and 2.4.17 as "legacy". On the extended downloads page, version 2.0.3 is deprecated. Am I launching it the wrong server executable, or are there plans to support a more recent version of Redis?

    Read the article

  • Seam cache provider with ehcache null

    - by Cateno Viglio
    Hi every one, I'm trying to configure seam/ehcache following the tutorial from jboss page: http://docs.jboss.org/seam/2.1.2/reference/en-US/html/cache.html I put the ehcache.1.2.3.jar in project.ear/lib and injected CacheProvider as especified, but the CacheProvider always return null. The documentation doesn't show any aditional configuration for ehcache, just for jboss cache. I am probably doing something wrong, it's impossible be so easy :). besides put the jar in /lib, i created the following seam component to test: @Scope(ScopeType.SESSION) @Name("cacheBean") public class CacheSeamBean implements java.io.Serializable { @In(required=false, create=true) private EntityManager em; @Logger private Log log; @In private Events events; @In CacheProvider cacheProvider; Boolean blLoaded = Boolean.FALSE; @Create public void buscar() { if (!blLoaded){ List<Parametro> lstParametro = em.createQuery("select p from Parametro p").getResultList(); for (Parametro parametro : lstParametro){ cacheProvider.put(parametro.getCodigo(), parametro.getValor()); } blLoaded= Boolean.TRUE; } } } Thanks

    Read the article

  • Compact Framework : Read a SQL CE database on a PDA from a PC

    - by CF_Maintainer
    Hello, I have tasked with upgrading a CF Framework 1.1 suite of apps. Currently, the PC starts a server [after confirming via RAPI that the device exists and is connected] and spawns a app on the PDA as the client. The client process on the PDA talks with the db on the PDA and returns records to the PC app [using SQL CE 2.0. OpenNETCF 1.4 for communication/io]. I have a chance to upgrade the PC and PDA suite of apps to Framework 3.5 & CF 3.5 respectively. Due to a business requirement, I cannot get rid of workflow requiring the PC app to show a preview of the work done on the PDA. Question : Are there better ways to achieve the above in general with the constraints I have? I would really appreciate any Ideas/advice.

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • How can you tell the source of the data when using the Stream.BeginRead Method?

    - by xarzu
    When using the Stream.BeginRead Method, and you are reading from a stream into a memory, how is it determined where you are reading the data from? See: http://msdn.microsoft.com/en-us/library/system.io.stream.beginread.aspx In the list of parameters, I do not see one that tells where the data is being read from: Parameters buffer Type: System.Byte[] The buffer to read the data into. offset Type: System.Int32 The byte offset in buffer at which to begin writing data read from the stream. count Type: System.Int32 The maximum number of bytes to read. callback Type: System.AsyncCallback An optional asynchronous callback, to be called when the read is complete. state Type: System.Object A user-provided object that distinguishes this particular asynchronous read request from other requests.

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • Java based Atom/RSS Library that works in Google App Engine

    - by Littlejon
    I am trying to publish an Atom/RSS feed in my Java based Google App Engine code. I have tried using Rome and keep getting the following error (tried googling without success), also the code I am running that generates the error is the demo code (so I get the feeling Rome won't work with GAE) java.lang.NoClassDefFoundError: org/jdom/JDOMException at com.sun.syndication.io.SyndFeedOutput.<init>(SyndFeedOutput.java:44) What I am looking for is recommendations for a simple Java library to create and publish an Atom feed from within Google App Engine. Thanks.

    Read the article

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

  • When opening a file in perl, how can I automatically use STDIN/OUT if the file name is "-"?

    - by Ryan Thompson
    I have a perl program that takes input and output file arguments, and I'd like to support the convention of using "-" to specify standard input/output. The problem is that I can't just open the file name, because open(my $input, '<', '-') opens a file called -, not standard input. So I have to do something like this: my $input_fh; if ($input_filename eq '-') { # Special case: get the stdin handle $input_fh = *STDIN{IO}; } else { # Standard case: open the file open($input_fh, '<', $input_filename); } And similarly for the output file. Is there any way to do this without testing for the special case myself? I know I could hack the ARGV filehandle to do this for input, but that won't work for output.

    Read the article

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • Newbie Question: Read and Process a List of Text Files

    - by johnv
    I'm completely new to .NET and am trying as a first step to write a text processing program. The task is simple: I have a list of 10,000 text files stored in one folder, and I'm trying to read each one, store it as a string variable, then run it through a series of functions, then save the final output to another folder. So far I can only manage to manually input the file path like this (in VB.NET): Dim tRead As System.IO.StreamReader Public Function ReadFile() As String Dim EntireFile As String tRead = File.OpenText("c:\textexample\00001.txt") EntireFile = tRead.ReadToEnd Return EntireFile End Function Public Function Step1() ..... End Function Public Function Step2() ..... End Function .............. I'm wondering, therefore, if there's a way to automate this process. Perhaps for example store all input file path into a text file then read each entry at a time, then save the final output into the save path, again listed in a text file. Any help is greatly appreciated. ReplyQuote

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • Use DLL and have it be as trusted as my own application is

    - by Binary255
    Hi, I am using a port of GNU GetOpts, to be specific I am using the one at: http://getopt.codeplex.com I have added the DLL as a reference. But when I run my application I receive an exception: System.IO.FileLoadException was unhandled Message="Could not load file or assembly 'Gnu.Getopt, Version=0.9.1.24287, Culture=neutral, PublicKeyToken=d014b4ccdc53511a' or one of its dependencies. Failed to grant permission to execute. (Exception from HRESULT: 0x80131418)" If it is possible I would like my application to say, "trust this DLL as much as you trust me". Is there a way to do that so I won't have to fiddle with security settings? And if there is not. What is the cleanest way to get the DLL working?

    Read the article

  • Spring: Inject static member (System.in) via constructor

    - by Julian Lettner
    I wrote some sort of console client for a simple application. To be more flexible, I thought it would be nice to only depend on java.io.Input-/OutputStream, instead of accessing System.in/out directly. I renamed the class ConsoleClient to StreamClient, added setters and made sure that the instance fields are used instead of System.in/out. At the moment my client code looks like this: ApplicationContext appCtx = new ClassPathXmlApplicationContext("..."); StreamClient cc = (StreamClient) appCtx.getBean("streamClient"); cc.setInputStream(System.in); cc.setOutputStream(System.out); cc.run(); // start client Question: Is there a way to move lines 3 and 4 into the Spring configuration (preferably constructor injection)? Thanks for your time.

    Read the article

  • how do I get the IP of incoming ICMP due to UDP-send to dead client in Ruby?

    - by banister
    so.. I'm doing a small multiplayer game with blocking UDP and IO.select. To my problem.. (In the server) reading from a UDP socket (packet, sender = @socket.recvfrom(1000)) which have just sent a packet to a dead client results in a ICMP unreachable (and exception Errno::ECONNRESET in ruby). The problem is that I can't find any way whatsoever to extract the IP of that ICMP.. so I can clean out that dead client. Anyone know how to achieve this? thanks

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • java checked exception in a catch clause compilation error

    - by srandpersonia
    Hi, I was expecting an compilation error in the following program because of the throw statement in the catch block as IOException is a checked exception and it is not caught by another try block within the catch block. But I am getting "Hurray!" printed. Any explanation would be much appreciated. According to JLS 11.2.3, http://java.sun.com/docs/books/jls/third_edition/html/exceptions.html It is a compile-time error if a method or constructor body can throw some exception type E when both of the following hold: * E is a checked exception type * E is not a subtype of some type declared in the throws clause of the method or constructor. import java.io.*; public class Test{ public static void main(String args[]) { System.out.println(method()); } public static int method() { try{ throw new Exception(); } catch(Exception e){ throw new IOException(); //No compile time error } finally{ System.out.println("Hurray!"); } } } Thanks in advance.

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

< Previous Page | 178 179 180 181 182 183 184 185 186 187 188 189  | Next Page >