Search Results

Search found 10883 results on 436 pages for 'ms expression'.

Page 183/436 | < Previous Page | 179 180 181 182 183 184 185 186 187 188 189 190  | Next Page >

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to specify Multiple Secure Webpages with .htaccess RewriteCond

    - by Patrick Ndille
    I have 3 pages that I want to make secure on my website using .htaccess -login.php -checkout.php -account.php I know how to make just one work page at a time using .htaccess RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] I and trying to figure out how to include the other 2 specific pages to make them also secure and used the expression below but it didn't work RewriteEngine On RewriteCond %{HTTPS} off RewriteCond %{REQUEST_URI} /login.php RewriteCond %{REQUEST_URI} /checkout.php RewriteCond %{REQUEST_URI} /account.php RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] Can someone help me the right expression that will work with multiple pages? The second part of the code is that, if https is already on and a user move to a page that Is not any of the pages i specified about, I want that it should get back to http. how should I write the statement for it to redirect back to http if its not any of the pages above? I have my statement like this but its not working RewriteCond %{HTTPS} on RewriteRule !(checkout|login|account|payment)\.php http://%{HTTP_HOST}%{REQUEST_URI} [L,R] Any thoughts?

    Read the article

  • WCF/REST Get image into picturebox?

    - by Garrith
    So I have wcf rest service which succesfuly runs from a console app, if I navigate to: http://localhost:8000/Service/picture/300/400 my image is displayed note the 300/400 sets the width and height of the image within the body of the html page. The code looks like this: namespace WcfServiceLibrary1 { [ServiceContract] public interface IReceiveData { [OperationContract] [WebInvoke(Method = "GET", BodyStyle = WebMessageBodyStyle.Wrapped, ResponseFormat = WebMessageFormat.Xml, UriTemplate = "picture/{width}/{height}")] Stream GetImage(string width, string height); } public class RawDataService : IReceiveData { public Stream GetImage(string width, string height) { int w, h; if (!Int32.TryParse(width, out w)) { w = 640; } // Handle error if (!Int32.TryParse(height, out h)) { h = 400; } Bitmap bitmap = new Bitmap(w, h); for (int i = 0; i < bitmap.Width; i++) { for (int j = 0; j < bitmap.Height; j++) { bitmap.SetPixel(i, j, (Math.Abs(i - j) < 2) ? Color.Blue : Color.Yellow); } } MemoryStream ms = new MemoryStream(); bitmap.Save(ms, System.Drawing.Imaging.ImageFormat.Jpeg); ms.Position = 0; WebOperationContext.Current.OutgoingResponse.ContentType = "image/jpeg"; return ms; } } } What I want to do now is use a client application "my windows form app" and add that image into a picturebox. Im abit stuck as to how this can be achieved as I would like the width and height of the image from my wcf rest service to be set by the width and height of the picturebox. I have tryed this but on two of the lines have errors and im not even sure if it will work as the code for my wcf rest service seperates width and height with a "/" if you notice in the url. string uri = "http://localhost:8080/Service/picture"; private void button1_Click(object sender, EventArgs e) { StringBuilder sb = new StringBuilder(); sb.AppendLine("<picture>"); sb.AppendLine("<width>" + pictureBox1.Image.Width + "</width>"); // the url looks like this http://localhost:8080/Service/picture/300/400 when accessing the image so I am trying to set this here sb.AppendLine("<height>" + pictureBox1.Image.Height + "</height>"); sb.AppendLine("</picture>"); string picture = sb.ToString(); byte[] getimage = Encoding.UTF8.GetBytes(picture); // not sure this is right HttpWebRequest req = WebRequest.Create(uri); //cant convert webrequest to httpwebrequest req.Method = "GET"; req.ContentType = "image/jpg"; req.ContentLength = getimage.Length; MemoryStream reqStrm = req.GetRequestStream(); //cant convert IO stream to IO Memory stream reqStrm.Write(getimage, 0, getimage.Length); reqStrm.Close(); HttpWebResponse resp = req.GetResponse(); // cant convert web respone to httpwebresponse MessageBox.Show(resp.StatusDescription); pictureBox1.Image = Image.FromStream(reqStrm); reqStrm.Close(); resp.Close(); } So just wondering if some one could help me out with this futile attempt at adding a variable image size from my rest service to a picture box on button click. This is the host app aswell: namespace ConsoleApplication1 { class Program { static void Main(string[] args) { string baseAddress = "http://" + Environment.MachineName + ":8000/Service"; ServiceHost host = new ServiceHost(typeof(RawDataService), new Uri(baseAddress)); host.AddServiceEndpoint(typeof(IReceiveData), new WebHttpBinding(), "").Behaviors.Add(new WebHttpBehavior()); host.Open(); Console.WriteLine("Host opened"); Console.ReadLine();

    Read the article

  • Performance Drop Lingers after Load [closed]

    - by Charles
    Possible Duplicate: How do you do Load Testing and Capacity Planning for Databases I'm noticing a drop in performance after subsequent load tests. Although our cpu and ram numbers look fine, performance seems to degrade over time as sustained load is applied to the system. If we allow more time between the load tests, the performance gets back to about 1,000 ms, but if you apply load every 3 minutes or so, it starts to degrade to a point where it takes 12,000 ms. None of the application servers are showing lingering apache processes and the number of database connections cools down to about 3 (from a sustained 20). Is there anything else I should be looking out for here?

    Read the article

  • sites now not responding on port 80 [closed]

    - by JohnMerlino
    Possible Duplicate: unable to connect site to different port I was trying to resolve an issue with getting a site running on a different port: unable to connect site to different port But somehow it took out all my other sites. Now even the ones that were responding on port 80 are no longe responding, even though I did not touch the virtual hosts for them. I get this message now: Oops! Google Chrome could not connect to mysite.com However, ping responds: ping mysite.com PING mysite.com (64.135.12.134): 56 data bytes 64 bytes from 64.135.12.134: icmp_seq=0 ttl=49 time=20.839 ms 64 bytes from 64.135.12.134: icmp_seq=1 ttl=49 time=20.489 ms The result of telnet: $ telnet guarddoggps.com 80 Trying 64.135.12.134... telnet: connect to address 64.135.12.134: Connection refused telnet: Unable to connect to remote host

    Read the article

  • Uninstalling hard deleted application from Windows7

    - by Gnanasuriyan A
    Unfortunately, I have hard deleted the microsoft sql server folder present in program files folder. So now I need to uninstall the MSSQL server from my machine. I have tried but I got an error something like "The source folder is missing". For resolving this issue, I have manually deleted the MS SQL services using "sc delete" command and I have deleted the MSSQL entry from regedit file also. But still MS SQL server entry available in "Programs and Features" list. Please guide me for solving this issue even I can't able to re install the MSSQL server once again. Thank you guys... Gnanasuriyan A.

    Read the article

  • Can someone help me compare using F# over C# in this specific example (IP Address expressions)?

    - by Phobis
    So, I am writing code to parse and IP Address expression and turn it into a regular expression that could be run against and IP Address string and return a boolean response. I wrote the code in C# (OO) and it was 110 lines of code. I am trying to compare the amount of code and the expressiveness of C# to F# (I am a C# programmer and a noob at F#). I don't want to post both the C# and F#, just because I don't want to clutter the post. If needed, I will do so. Anyway, I will give an example. Here is an expression: 192.168.0.250,244-248,108,51,7;127.0.0.1 I would like to take that and turn it into this regular expression: ((192.168.0.(250|244|245|246|247|248|108|51|7))|(127.0.0.1)) Here are some steps I am following: Operations: Break by ";" 192.168.0.250,244-248,108,51,7 127.0.0.1 Break by "." 192 168 0 250,244-248,108,51,7 Break by "," 250 244-248 108 51 7 Break by "-" 244 248 I came up with F# that produces the output. I am trying to forward-pipe through my operations listed above, as I think that would be more expressive. Can anyone make this code better? Teach me something :) open System let createItemArray (group:bool) (y:char) (items:string[]) = [| let indexes = items.Length - 1 let group = indexes > 0 && group if group then yield "(" for i in 0 .. indexes do yield items.[i].ToString() if i < indexes then yield y.ToString() if group then yield ")" |] let breakBy (group:bool) (x:string) (y:char): string[] = x.Split(y) |> createItemArray group y let breakItem (x:string) (y:char): string[] = breakBy false x y let breakGroup (x:string) (y:char): string[] = breakBy true x y let AddressExpression address:string = let builder = new System.Text.StringBuilder "(" breakGroup address ';' |> Array.collect (fun octet -> breakItem octet '.') |> Array.collect (fun options -> breakGroup options ',') |> Array.collect (fun (ranges : string) -> match (breakGroup ranges '-') with | x when x.Length > 3 -> match (Int32.TryParse(x.[1]), Int32.TryParse(x.[3])) with | ((true, a) ,(true, b)) -> [|a .. b|] |> Array.map (int >> string) |> createItemArray false '-' | _ -> [|ranges|] | _ -> [|ranges|] ) |> Array.iter (fun item -> match item with | ";" -> builder.Append ")|(" | "." -> builder.Append "\." | "," | "-" -> builder.Append "|" | _ -> builder.Append item |> ignore ) builder.Append(")").ToString() let address = "192.168.0.250,244-248,108,51,7;127.0.0.1" AddressExpression address

    Read the article

  • What happened to WinFS?

    - by Console
    The most interesting feature that was ever connected to what eventually became Vista was WinFS, a revolutionary (so it seemed, at least back then) new way of storing and accessing information on a computer. This feature was cut despite actually reaching a closed alpha/technical preview release. There was a smoke and mirrors blog post from MS about the technology living on in an upcoming SQL server release, but to me it just felt like it was axed, hard. Does anyone have any idea what happened to it? Is it killed, or just on the backburner? Was it just impossible to implement, too expensive, or did someone think of a better idea? Are there any projects (From MS or anyone else) that have similar goals?

    Read the article

  • How does Google manage to serve results so fast?

    - by Quintin Par
    I am building an autocomplete functionality for my site and the Google instant results are my benchmark. When I look at Google, the 50-60 ms response time baffle me. They look insane. In comparison here’s how mine looks like. To give you an idea my results are cached on the load balancer and served from a machine that has httpd slowstart and initcwnd fixed. My site is also behind cloudflare From a server side perspective I don’t think I can do anything more. Can someone help me take this 500 ms response time to 60ms? What more should I be doing to achieve Google level performance?

    Read the article

  • Re-install (repair) Server 2012 Roles & Features

    - by NickC
    Is there a way to re-install all Server Roles & Features in Server 2012? As far as I can see from Server Manager all that can be done is to manually remove each and then re-install but I am hoping that MS have provided some way of just repairing / re-installing all installed roles & features. Anyone know if there is a way of doing that? The reason for wanting to do this is that I have a Domain Server which after some recent MS updates has started causing numerous event log warnings & errors and has started behaving erratically. I know that System File Checker will check installed files but that will not fix any registry permissions problems, which is where I think problems have arisen. Guess what I am looking for is some way to recreate the whole registry and it's permissions but without doing a complete re-install. Thanks, Nick

    Read the article

  • How does java.util.Collections.contains() perform faster than a linear search?

    - by The111
    I've been fooling around with a bunch of different ways of searching collections, collections of collections, etc. Doing lots of stupid little tests to verify my understanding. Here is one which boggles me (source code further below). In short, I am generating N random integers and adding them to a list. The list is NOT sorted. I then use Collections.contains() to look for a value in the list. I intentionally look for a value that I know won't be there, because I want to ensure that the entire list space is probed. I time this search. I then do another linear search manually, iterating through each element of the list and checking if it matches my target. I also time this search. On average, the second search takes 33% longer than the first one. By my logic, the first search must also be linear, because the list is unsorted. The only possibility I could think of (which I immediately discard) is that Java is making a sorted copy of my list just for the search, but (1) I did not authorize that usage of memory space and (2) I would think that would result in MUCH more significant time savings with such a large N. So if both searches are linear, they should both take the same amount of time. Somehow the Collections class has optimized this search, but I can't figure out how. So... what am I missing? import java.util.*; public class ListSearch { public static void main(String[] args) { int N = 10000000; // number of ints to add to the list int high = 100; // upper limit for random int generation List<Integer> ints; int target = -1; // target will not be found, forces search of entire list space long start; long end; ints = new ArrayList<Integer>(); start = System.currentTimeMillis(); System.out.print("Generating new list... "); for (int i = 0; i < N; i++) { ints.add(((int) (Math.random() * high)) + 1); } end = System.currentTimeMillis(); System.out.println("took " + (end-start) + "ms."); start = System.currentTimeMillis(); System.out.print("Searching list for target (method 1)... "); if (ints.contains(target)) { // nothing } end = System.currentTimeMillis(); System.out.println(" Took " + (end-start) + "ms."); System.out.println(); ints = new ArrayList<Integer>(); start = System.currentTimeMillis(); System.out.print("Generating new list... "); for (int i = 0; i < N; i++) { ints.add(((int) (Math.random() * high)) + 1); } end = System.currentTimeMillis(); System.out.println("took " + (end-start) + "ms."); start = System.currentTimeMillis(); System.out.print("Searching list for target (method 2)... "); for (Integer i : ints) { // nothing } end = System.currentTimeMillis(); System.out.println(" Took " + (end-start) + "ms."); } }

    Read the article

  • Export data to Excel from Silverlight/WPF DataGrid

    - by outcoldman
    Data export from DataGrid to Excel is very common task, and it can be solved with different ways, and chosen way depend on kind of app which you are design. If you are developing app for enterprise, and it will be installed on several computes, then you can to advance a claim (system requirements) with which your app will be work for client. Or customer will advance system requirements on which your app should work. In this case you can use COM for export (use infrastructure of Excel or OpenOffice). This approach will give you much more flexibility and give you possibility to use all features of Excel app. About this approach I’ll speak below. Other way – your app is for personal use, it can be installed on any home computer, in this case it is not good to ask user to install MS Office or OpenOffice just for using your app. In this way you can use foreign tools for export, or export to xml/html format which MS Office can read (this approach used by JIRA). But in this case will be more difficult to satisfy user tasks, like create document with landscape rotation and with defined fields for printing. At this article I'll show you how to work with Excel object from .NET 4 and Silverlight 4 with dynamic objects and give you an approach which allow you to export data from DataGrid Silverlight and WPF controls. Read more...

    Read the article

  • ASP.NET MVC Paging/Sorting/Filtering a list using ModelMetadata

    - by rajbk
    This post looks at how to control paging, sorting and filtering when displaying a list of data by specifying attributes in your Model using the ASP.NET MVC framework and the excellent MVCContrib library. It also shows how to hide/show columns and control the formatting of data using attributes.  This uses the Northwind database. A sample project is attached at the end of this post. Let’s start by looking at a class called ProductViewModel. The properties in the class are decorated with attributes. The OrderBy attribute tells the system that the Model can be sorted using that property. The SearchFilter attribute tells the system that filtering is allowed on that property. Filtering type is set by the  FilterType enum which currently supports Equals and Contains. The ScaffoldColumn property specifies if a column is hidden or not The DisplayFormat specifies how the data is formatted. public class ProductViewModel { [OrderBy(IsDefault = true)] [ScaffoldColumn(false)] public int? ProductID { get; set; }   [SearchFilter(FilterType.Contains)] [OrderBy] [DisplayName("Product Name")] public string ProductName { get; set; }   [OrderBy] [DisplayName("Unit Price")] [DisplayFormat(DataFormatString = "{0:c}")] public System.Nullable<decimal> UnitPrice { get; set; }   [DisplayName("Category Name")] public string CategoryName { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? CategoryID { get; set; }   [SearchFilter] [ScaffoldColumn(false)] public int? SupplierID { get; set; }   [OrderBy] public bool Discontinued { get; set; } } Before we explore the code further, lets look at the UI.  The UI has a section for filtering the data. The column headers with links are sortable. Paging is also supported with the help of a pager row. The pager is rendered using the MVCContrib Pager component. The data is displayed using a customized version of the MVCContrib Grid component. The customization was done in order for the Grid to be aware of the attributes mentioned above. Now, let’s look at what happens when we perform actions on this page. The diagram below shows the process: The form on the page has its method set to “GET” therefore we see all the parameters in the query string. The query string is shown in blue above. This query gets routed to an action called Index with parameters of type ProductViewModel and PageSortOptions. The parameters in the query string get mapped to the input parameters using model binding. The ProductView object created has the information needed to filter data while the PageAndSorting object is used for paging and sorting the data. The last block in the figure above shows how the filtered and paged list is created. We receive a product list from our product repository (which is of type IQueryable) and first filter it by calliing the AsFiltered extension method passing in the productFilters object and then call the AsPagination extension method passing in the pageSort object. The AsFiltered extension method looks at the type of the filter instance passed in. It skips properties in the instance that do not have the SearchFilter attribute. For properties that have the SearchFilter attribute, it adds filter expression trees to filter against the IQueryable data. The AsPagination extension method looks at the type of the IQueryable and ensures that the column being sorted on has the OrderBy attribute. If it does not find one, it looks for the default sort field [OrderBy(IsDefault = true)]. It is required that at least one attribute in your model has the [OrderBy(IsDefault = true)]. This because a person could be performing paging without specifying an order by column. As you may recall the LINQ Skip method now requires that you call an OrderBy method before it. Therefore we need a default order by column to perform paging. The extension method adds a order expressoin tree to the IQueryable and calls the MVCContrib AsPagination extension method to page the data. Implementation Notes Auto Postback The search filter region auto performs a get request anytime the dropdown selection is changed. This is implemented using the following jQuery snippet $(document).ready(function () { $("#productSearch").change(function () { this.submit(); }); }); Strongly Typed View The code used in the Action method is shown below: public ActionResult Index(ProductViewModel productFilters, PageSortOptions pageSortOptions) { var productPagedList = productRepository.GetProductsProjected().AsFiltered(productFilters).AsPagination(pageSortOptions);   var productViewFilterContainer = new ProductViewFilterContainer(); productViewFilterContainer.Fill(productFilters.CategoryID, productFilters.SupplierID, productFilters.ProductName);   var gridSortOptions = new GridSortOptions { Column = pageSortOptions.Column, Direction = pageSortOptions.Direction };   var productListContainer = new ProductListContainerModel { ProductPagedList = productPagedList, ProductViewFilterContainer = productViewFilterContainer, GridSortOptions = gridSortOptions };   return View(productListContainer); } As you see above, the object that is returned to the view is of type ProductListContainerModel. This contains all the information need for the view to render the Search filter section (including dropdowns),  the Html.Pager (MVCContrib) and the Html.Grid (from MVCContrib). It also stores the state of the search filters so that they can recreate themselves when the page reloads (Viewstate, I miss you! :0)  The class diagram for the container class is shown below.   Custom MVCContrib Grid The MVCContrib grid default behavior was overridden so that it would auto generate the columns and format the columns based on the metadata and also make it aware of our custom attributes (see MetaDataGridModel in the sample code). The Grid ensures that the ShowForDisplay on the column is set to true This can also be set by the ScaffoldColumn attribute ref: http://bradwilson.typepad.com/blog/2009/10/aspnet-mvc-2-templates-part-2-modelmetadata.html) Column headers are set using the DisplayName attribute Column sorting is set using the OrderBy attribute. The data is formatted using the DisplayFormat attribute. Generic Extension methods for Sorting and Filtering The extension method AsFiltered takes in an IQueryable<T> and uses expression trees to query against the IQueryable data. The query is constructed using the Model metadata and the properties of the T filter (productFilters in our case). Properties in the Model that do not have the SearchFilter attribute are skipped when creating the filter expression tree.  It returns an IQueryable<T>. The extension method AsPagination takes in an IQuerable<T> and first ensures that the column being sorted on has the OrderBy attribute. If not, we look for the default OrderBy column ([OrderBy(IsDefault = true)]). We then build an expression tree to sort on this column. We finally hand off the call to the MVCContrib AsPagination which returns an IPagination<T>. This type as you can see in the class diagram above is passed to the view and used by the MVCContrib Grid and Pager components. Custom Provider To get the system to recognize our custom attributes, we create our MetadataProvider as mentioned in this article (http://bradwilson.typepad.com/blog/2010/01/why-you-dont-need-modelmetadataattributes.html) protected override ModelMetadata CreateMetadata(IEnumerable<Attribute> attributes, Type containerType, Func<object> modelAccessor, Type modelType, string propertyName) { ModelMetadata metadata = base.CreateMetadata(attributes, containerType, modelAccessor, modelType, propertyName);   SearchFilterAttribute searchFilterAttribute = attributes.OfType<SearchFilterAttribute>().FirstOrDefault(); if (searchFilterAttribute != null) { metadata.AdditionalValues.Add(Globals.SearchFilterAttributeKey, searchFilterAttribute); }   OrderByAttribute orderByAttribute = attributes.OfType<OrderByAttribute>().FirstOrDefault(); if (orderByAttribute != null) { metadata.AdditionalValues.Add(Globals.OrderByAttributeKey, orderByAttribute); }   return metadata; } We register our MetadataProvider in Global.asax.cs. protected void Application_Start() { AreaRegistration.RegisterAllAreas();   RegisterRoutes(RouteTable.Routes);   ModelMetadataProviders.Current = new MvcFlan.QueryModelMetaDataProvider(); } Bugs, Comments and Suggestions are welcome! You can download the sample code below. This code is purely experimental. Use at your own risk. Download Sample Code (VS 2010 RTM) MVCNorthwindSales.zip

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^d{3}-d{2}-d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^d{3}-d{2}-d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • CodePlex Daily Summary for Saturday, June 05, 2010

    CodePlex Daily Summary for Saturday, June 05, 2010New Projects555 Calculator: A simple calculator to help choosing resistor and capacitor values to get the frequency you're looking for on a 555 timer.BleQua .NET: PL: Program sieciowy BleQua .NET jest multi-komunikatorem. EN: Network program BleQua .NET is multicomunicator.ChatDiplomaWork: ChatSample is the sample project.CSUFVGDC Summer Jam: Repository for VGDC summer game jam.Database Export Wizard: ExportWizard is a Step Wizard for Database Export using ASP.net and SQL Server. It allows easy export in any of the standard formats: CSV, TXT, HTM...Dozer Enterprise Library for .NET: a light .net framework for enterprise applications developmentEmployee Management System: This is an Employee Management System. the goal here is to offer a software that caters to small to mid sized businesses for free. This program a...Fanray: My project on Codeplex.Infragistics Analytics Framework: This project includes wrappers for the Infragistics controls that integrate with the recently launched Microsoft Silverlight Analytics Framework. ...KIME Simio Extensions: This is the official project of KIME Solutions. Here you find any current developments of KIME that are publicly available. KIME develops extension...MindTouch Community Extensions: MindTouch Community Extentions is a Native C# extention library for MindTouch Core that will have Dekiscript functions for full coverage of the API...NginxTray: NginxTray allows you manage easily Nginx Web Server by a Tray icon.NStore: NStore is a virtual store example done with ASP.NET MVC 2.0 tecnologyProjet Campus Numerique + Appli Mobile: Projet de création d'un campus numérique pour l'ISEN et d'un application mobile d'accès.SharePoint 2010 Feature Upgrade Kit: A set of tools for managing upgradable Features in SharePoint 2010. (Upgrading Features is a means of deploying code/artifact updates to existing S...SiteMap Utility for DNN Blog Module: This is a mini-project which allows you to easily add or generate an XML site map to your DotNetNuke® website for the search engines to use to inde...Space Explorer: A small app to help users examine folders to see which files and subfolders are taking up space. Still in development, no releases available curren...SQL Compact Toolbox: SQL Compact Toolbox is a Visual Studio 2010 add-in, that adds scripting, import, export, migrate, rename, run script and other upcoming SQL Server ...Twilverlight: Twliverlight is TweetDeck mixed with Silverlight. Much as I like using TweetDeck, it hogs my memory out, so this is an attempt to write a memory-ef...Visual Studio 2010 FxCop Extension: Visual Studio 2010 FxCop Extension allows to integrate stand-alone FxCop into Visual Studio 2010. You'll be able to analysis your source code with ...VisualStudio 2010 JavaScript Outlining: Visual Studio 2010 editor extension for JavaScript code blocks and custom regions outlining Wiki Shelf: Wiki Shelf is a Wikipedia browser app. The goal is to bring the library experience of browsing books, studying, and researching to the Wikipedia u...X-Arena - Magic: Projeto de PDS2 no Curso de Tecnologia em Desenvolvimento de Software no CEFETRN. O desenvolvimento do jogo Quiz Arena possui como pr...New Releases555 Calculator: 555Calc release v1.0: The initial 1 point uh-oh release of 555Calc.BleQua .NET: BleQua .NET 1.0.0.0: First releaseChatterbot JBot: JBot 1.0.1.155: Change presentation technology from Window Forms to Widndown Presentation Fundation.Community Forums NNTP bridge: Community Forums NNTP Bridge V26: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has ad...Community Forums NNTP bridge: Community Forums NNTP Bridge V27: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has ad...Community Forums NNTP bridge: Community Forums NNTP Bridge V28: Release of the Community Forums NNTP Bridge to access the social and anwsers MS forums with a single, open source NNTP bridge. This release has ad...CSS 360 Planetary Calendar: Final Release: =============================================================================== Final Release Version: 2.0 Tools Used: - Collaboration, Releas...Database Export Wizard: Version 3: As described in CodeProject article: Database Export Wizard for ASP.net and SQL Server. http://www.codeproject.com/KB/aspnet/DatabaseExportWizard.aspxEdu Math: Edu Math 2.0.10.122: Change version .NET Framework.Employee Management System: V1 (beta): This version is still in beta testing. Any issues, comments or suggestions are greatly appreciated. The export to excel function in this release o...ESB.NET: ESBDeploy_7.0.27.0 (x64 and x86) [ESB.NET 7.0 RC1]: Release Details Changes Since Last Release (since 6.3.47.1) - Targets .NET Framework 4, Visual Studio.NET 2010, Workflow 4 - Flowchart workflow ada...Free Silverlight & WPF Chart Control - Visifire: Visifire SL and WPF Charts v3.1.1 beta 2 Released: Hi, This release contains the following enhancements: *ShowIndicator() and HideIndicator() function has been implemented in Chart. So now user wi...Free Silverlight & WPF Chart Control - Visifire: Visifire SL and WPF Charts v3.5.4 beta 2 Released: Hi, This release contains the following enhancements: *ShowIndicator() and HideIndicator() function has been implemented in Chart. So now user wi...FsCheck: A random testing framework: FsCheck 0.7: What to download? If you use F# April 2010 CTP with Visual Studio 2008 or Visual Studio 2010, either Source or Binaries will do. To open source in...Git Source Control Provider: V 0.5: For VS 2010 users, it is recommanded to install it within Visual Studio by selecting Tools | Extension Manager. Run Visual Studio. Go to Tools ...GPdotNET - Genetic Programming Tool: GPdotNETv0.95: 1. Localization support 2. Export functionality for GP Model with training and testing data. 3. Export GPModel with Testing and Training data. 4....JoshDOS: JoshDOS 1.1: 1.1 adds a toutorial of how to create new commands and of course, you need the COMSOS user kit or dev kit. Ver 1.1 also includes a demo called Gue...KIME Simio Extensions: KIME.SimioDebugStep: This simple Simio step allows you to debug any number of expressions from within the simulation run. The debug information is displayed using a mes...NginxTray: NginxTray 0.3 Beta 2: NginxTray 0.3 Beta 2NginxTray: NginxTray 0.5 Beta 3: NginxTray 0.5 Beta 3NginxTray: NginxTray 0.6 RC1: NginxTray 0.6 RC1Open Source PLM Activities: Prodeos_OC beta 1.0: The “Innovator – MS Office Connector” is a product developed by Prodeos (www.prodeos.com). It is a light connector made to facilitate the use of Mi...Paint.NET PSD Plugin: 1.5.1: Changes in this release: Bitmap-mode images can now be loaded. Thanks to dhnc for filing the bug. Plugin no longer crashes on files with user m...SharePoint 2010 Feature Upgrade Kit: 1.0.0.0: This release contains:- - Custom application page to manage the upgrade of Site and Web-scoped Features. To come in the next release: - Companio...SiteMap Utility for DNN Blog Module: Blog SiteMap Utility v01.00.01: This is the first public release of the SiteMap Utility for the core DotNetNuke® Blog Module. Please see the documentation on this site on how to...SqlDiffFramework-A Visual Differencing Engine for Dissimilar Data Sources: SqlDiffFramework 1.0.2.0: Maintenance Release Defect Fixes: Issue # 3: 3 Issue # 4: 4 Enhancements: About Box now displays regional and language settings in effect. SDF...SuperSocket: First release of SuperSocket: !First release of SuperSocketThe Fastcopy Helper: FastcopyHelper: Fastcopy Helper 2.0 This is a final one. You can use it on the way. In order to use it , you should have the .NET3.5 ! 此软件必须下载 .NET3.5平台,方可使用!TV Show Renamer: TV Show Renamer Beta 3: I found the bug the prevented it from closing correctly so I fixed it and had to release it right away. If anyone else finds any problems. contact me.UrzaGatherer: UrzaGatherer v2.0: UrzaGatherer is the first stable version. This release include UrzaBackgroundPictures.VisualStudio 2010 JavaScript Outlining: VisualStudion 2010 Javascript Outlining 1.0: Features Outlines JavaScript codeblock regions for the code placed between { }. Both places on a new line. Outlines custom regions defined by: //...Wouter's SharePoint Demo Land: Navigation Service with Proxy: A SharePoint 2010 Service Application that uses service proxies to relay commands to the actual service. The demo proxy makes use of in-memory comm...盘古分词-开源中文分词组件: V2.0.0.0: 进一步优化性能,分词速度达到将近 500K ,1.2.0.1 版本只有 320K 修改 PanGu.Lucene.Analyzer, 支持 Lucene.net 2.9 版本。 增加对字典中以数字开头的专业非中文词汇的识别 增加英文分词开关,权重由英文小写权重和英文词根权重两个参数来决定...Most Popular ProjectsCommunity Forums NNTP bridgeOutSyncASP.NET MVC Time PlannerNeatUploadMoonyDesk (windows desktop widgets)AgUnit - Silverlight unit testing with ReSharperViperWorks IgnitionASP.NET MVC ExtensionsAviva Solutions C# Coding GuidelinesMute4Most Active ProjectsCommunity Forums NNTP bridgeRawrpatterns & practices – Enterprise LibraryIonics Isapi Rewrite FilterGMap.NET - Great Maps for Windows Forms & PresentationN2 CMSStyleCopFarseer Physics Enginesmark C# LibraryMirror Testing System

    Read the article

  • Looking for good Regex book

    - by Cyberherbalist
    I've been trying to get a good grounding with Regular Expressions, and am looking for a single book to do so. I've been going through Amazon.com's listings on this subject, and I've identified a few possibilities, but am unsure which would be best for a C# developer who can write very simple Regexs, but wants to learn more. On a scale of 0-9 where 0 is knowing how to spell "Regex" but nothing else, and 9 where I could write a book on the subject out of my own head, I would place myself at 2. Which of the following would be your choice: Mastering Regular Expressions by Jeffrey E F Friedl Regular Expressions Cookbook by Jan Goyvaerts and Steven Levithan Sams Teach Yourself Regular Expressions in 10 Minutes by Ben Forta Beginning Regular Expressions (Programmer to Programmer) by Andrew Watt Regular Expression Recipes for Windows Developers: A Problem-Solution Approach by Nathan A. Good Regular Expression Recipes: A Problem-Solution Approach by Nathan A. Good Now, according to Amazon, "Regular Expressions Cookbook" (REC) above is rated the highest according to user ratings, but only based on 20 reviews. The first one, "Mastering Regular Expressions" (MRE) is rated second based on 140 reviews. This alone suggests that MRE might be by far the best one. But is it best for a relative beginner? Would I perhaps be better getting "Beginning Regular Expressions" (BRE) instead, to start with? Please help me resolve my confusion!

    Read the article

  • Optimize SUMMARIZE with ADDCOLUMNS in Dax #ssas #tabular #dax #powerpivot

    - by Marco Russo (SQLBI)
    If you started using DAX as a query language, you might have encountered some performance issues by using SUMMARIZE. The problem is related to the calculation you put in the SUMMARIZE, by adding what are called extension columns, which compute their value within a filter context defined by the rows considered in the group that the SUMMARIZE uses to produce each row in the output. Most of the time, for simple table expressions used in the first parameter of SUMMARIZE, you can optimize performance by removing the extended columns from the SUMMARIZE and adding them by using an ADDCOLUMNS function. In practice, instead of writing SUMMARIZE( <table>, <group_by_column>, <column_name>, <expression> ) you can write: ADDCOLUMNS(     SUMMARIZE( <table>, <group by column> ),     <column_name>, CALCULATE( <expression> ) ) The performance difference might be huge (orders of magnitude) but this optimization might produce a different semantic and in these cases it should not be used. A longer discussion of this topic is included in my Best Practices Using SUMMARIZE and ADDCOLUMNS article on SQLBI, which also include several details about the DAX syntax with extended columns. For example, did you know that you can create an extended column in SUMMARIZE and ADDCOLUMNS with the same name of existing measures? It is *not* a good thing to do, and by reading the article you will discover why. Enjoy DAX!

    Read the article

  • Unable to uninstall maas completely

    - by user210844
    I'm not able to uninstall MAAS sudo apt-get purge maas ; sudo apt-get autoremove Reading package lists... Done Building dependency tree Reading state information... Done Package 'maas' is not installed, so not removed 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1) Reading package lists... Done Building dependency tree Reading state information... Done 0 upgraded, 0 newly installed, 0 to remove and 2 not upgraded. 2 not fully installed or removed. After this operation, 0 B of additional disk space will be used. Setting up maas-region-controller (1.2+bzr1373+dfsg-0ubuntu1) ... Considering dependency proxy for proxy_http: Module proxy already enabled Module proxy_http already enabled Module expires already enabled Module wsgi already enabled sed: -e expression #1, char 91: unterminated `s' command dpkg: error processing maas-region-controller (--configure): subprocess installed post-installation script returned error exit status 1 No apport report written because MaxReports is reached already dpkg: dependency problems prevent configuration of maas-dns: maas-dns depends on maas-region-controller (= 1.2+bzr1373+dfsg-0ubuntu1); however: Package maas-region-controller is not configured yet. dpkg: error processing maas-dns (--configure): dependency problems - leaving unconfigured No apport report written because MaxReports is reached already Errors were encountered while processing: maas-region-controller maas-dns E: Sub-process /usr/bin/dpkg returned an error code (1)

    Read the article

  • How can I create a 4TB partition on my software RAID5 device?

    - by Kris Harper
    I have set up a RAID5 device with three 2TB hard drives using mdadm. The device was successfully created, but I cannot seem to create a partition on the device. When I try to make an ext3 or ext4 partition via Disk Utility, I get the following error Error creating partition: helper exited with exit code 1: In part_add_partition: device_file=/dev/md0, start=0, size=4000526106624, type= Entering MS-DOS parser (offset=0, size=4000526106624) MSDOS_MAGIC found found partition type 0xee => protective MBR for GPT Exiting MS-DOS parser Entering EFI GPT parser GPT magic found partition_entry_lba=2 num_entries=128 size_of_entry=128 Leaving EFI GPT parser EFI GPT partition table detected containing partition table scheme = 3 got it got disk new partition guid '' is not valid type '' for GPT appear to be malformed I have seen this question, but that seems to suggest using gparted to do the partitioning. I'm fine with doing that, but my RAID device doesn't show up in the list of gparted devices. I suspect because this is a RAID and not a regular disk. I have already created a GPT partition table on the device. How can I add a partition to my device?

    Read the article

  • What do you think of this generator syntax?

    - by ChaosPandion
    I've been working on an ECMAScript dialect for quite some time now and have reached a point where I am comfortable adding new language features. I would love to hear some thoughts and suggestions on the syntax. Example generator { yield 1; yield 2; yield 3; if (true) { yield break; } yield continue generator { yield 4; yield 5; yield 6; }; } Syntax GeneratorExpression:     generator  {  GeneratorBody  } GeneratorBody:     GeneratorStatementsopt GeneratorStatements:     StatementListopt GeneratorStatement GeneratorStatementsopt GeneratorStatement:     YieldStatement     YieldBreakStatement     YieldContinueStatement YieldStatement:     yield  Expression  ; YieldBreakStatement:     yield  break  ; YieldContinueStatement:     yield  continue  Expression  ; Semantics The YieldBreakStatement allows you to end iteration early. This helps avoid deeply indented code. You'll be able to write something like this: generator { yield something1(); if (condition1 && condition2) yield break; yield something2(); if (condition3 && condition4) yield break; yield something3(); } instead of: generator { yield something1(); if (!condition1 && !condition2) { yield something2(); if (!condition3 && !condition4) { yield something3(); } } } The YieldContinueStatement allows you to combine generators: function generateNumbers(start) { return generator { yield 1 + start; yield 2 + start; yield 3 + start; if (start < 100) { yield continue generateNumbers(start + 1); } }; }

    Read the article

  • HTML5 Form Validation

    - by Stephen.Walther
    The latest versions of Google Chrome (16+), Mozilla Firefox (8+), and Internet Explorer (10+) all support HTML5 client-side validation. It is time to take HTML5 validation seriously. The purpose of the blog post is to describe how you can take advantage of HTML5 client-side validation regardless of the type of application that you are building. You learn how to use the HTML5 validation attributes, how to perform custom validation using the JavaScript validation constraint API, and how to simulate HTML5 validation on older browsers by taking advantage of a jQuery plugin. Finally, we discuss the security issues related to using client-side validation. Using Client-Side Validation Attributes The HTML5 specification discusses several attributes which you can use with INPUT elements to perform client-side validation including the required, pattern, min, max, step, and maxlength attributes. For example, you use the required attribute to require a user to enter a value for an INPUT element. The following form demonstrates how you can make the firstName and lastName form fields required: <!DOCTYPE html> <html > <head> <title>Required Demo</title> </head> <body> <form> <label> First Name: <input required title="First Name is Required!" /> </label> <label> Last Name: <input required title="Last Name is Required!" /> </label> <button>Register</button> </form> </body> </html> If you attempt to submit this form without entering a value for firstName or lastName then you get the validation error message: Notice that the value of the title attribute is used to display the validation error message “First Name is Required!”. The title attribute does not work this way with the current version of Firefox. If you want to display a custom validation error message with Firefox then you need to include an x-moz-errormessage attribute like this: <input required title="First Name is Required!" x-moz-errormessage="First Name is Required!" /> The pattern attribute enables you to validate the value of an INPUT element against a regular expression. For example, the following form includes a social security number field which includes a pattern attribute: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Pattern</title> </head> <body> <form> <label> Social Security Number: <input required pattern="^\d{3}-\d{2}-\d{4}$" title="###-##-####" /> </label> <button>Register</button> </form> </body> </html> The regular expression in the form above requires the social security number to match the pattern ###-##-####: Notice that the input field includes both a pattern and a required validation attribute. If you don’t enter a value then the regular expression is never triggered. You need to include the required attribute to force a user to enter a value and cause the value to be validated against the regular expression. Custom Validation You can take advantage of the HTML5 constraint validation API to perform custom validation. You can perform any custom validation that you need. The only requirement is that you write a JavaScript function. For example, when booking a hotel room, you might want to validate that the Arrival Date is in the future instead of the past: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>Constraint Validation API</title> </head> <body> <form> <label> Arrival Date: <input id="arrivalDate" type="date" required /> </label> <button>Submit Reservation</button> </form> <script type="text/javascript"> var arrivalDate = document.getElementById("arrivalDate"); arrivalDate.addEventListener("input", function() { var value = new Date(arrivalDate.value); if (value < new Date()) { arrivalDate.setCustomValidity("Arrival date must be after now!"); } else { arrivalDate.setCustomValidity(""); } }); </script> </body> </html> The form above contains an input field named arrivalDate. Entering a value into the arrivalDate field triggers the input event. The JavaScript code adds an event listener for the input event and checks whether the date entered is greater than the current date. If validation fails then the validation error message “Arrival date must be after now!” is assigned to the arrivalDate input field by calling the setCustomValidity() method of the validation constraint API. Otherwise, the validation error message is cleared by calling setCustomValidity() with an empty string. HTML5 Validation and Older Browsers But what about older browsers? For example, what about Apple Safari and versions of Microsoft Internet Explorer older than Internet Explorer 10? What the world really needs is a jQuery plugin which provides backwards compatibility for the HTML5 validation attributes. If a browser supports the HTML5 validation attributes then the plugin would do nothing. Otherwise, the plugin would add support for the attributes. Unfortunately, as far as I know, this plugin does not exist. I have not been able to find any plugin which supports both the required and pattern attributes for older browsers, but does not get in the way of these attributes in the case of newer browsers. There are several jQuery plugins which provide partial support for the HTML5 validation attributes including: · jQuery Validation — http://docs.jquery.com/Plugins/Validation · html5Form — http://www.matiasmancini.com.ar/jquery-plugin-ajax-form-validation-html5.html · h5Validate — http://ericleads.com/h5validate/ The jQuery Validation plugin – the most popular JavaScript validation library – supports the HTML5 required attribute, but it does not support the HTML5 pattern attribute. Likewise, the html5Form plugin does not support the pattern attribute. The h5Validate plugin provides the best support for the HTML5 validation attributes. The following page illustrates how this plugin supports both the required and pattern attributes: <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <title>h5Validate</title> <style type="text/css"> .validationError { border: solid 2px red; } .validationValid { border: solid 2px green; } </style> </head> <body> <form id="customerForm"> <label> First Name: <input id="firstName" required /> </label> <label> Social Security Number: <input id="ssn" required pattern="^\d{3}-\d{2}-\d{4}$" title="Expected pattern is ###-##-####" /> </label> <input type="submit" /> </form> <script type="text/javascript" src="Scripts/jquery-1.4.4.min.js"></script> <script type="text/javascript" src="Scripts/jquery.h5validate.js"></script> <script type="text/javascript"> // Enable h5Validate plugin $("#customerForm").h5Validate({ errorClass: "validationError", validClass: "validationValid" }); // Prevent form submission when errors $("#customerForm").submit(function (evt) { if ($("#customerForm").h5Validate("allValid") === false) { evt.preventDefault(); } }); </script> </body> </html> When an input field fails validation, the validationError CSS class is applied to the field and the field appears with a red border. When an input field passes validation, the validationValid CSS class is applied to the field and the field appears with a green border. From the perspective of HTML5 validation, the h5Validate plugin is the best of the plugins. It adds support for the required and pattern attributes to browsers which do not natively support these attributes such as IE9. However, this plugin does not include everything in my wish list for a perfect HTML5 validation plugin. Here’s my wish list for the perfect back compat HTML5 validation plugin: 1. The plugin would disable itself when used with a browser which natively supports HTML5 validation attributes. The plugin should not be too greedy – it should not handle validation when a browser could do the work itself. 2. The plugin should simulate the same user interface for displaying validation error messages as the user interface displayed by browsers which natively support HTML5 validation. Chrome, Firefox, and Internet Explorer all display validation errors in a popup. The perfect plugin would also display a popup. 3. Finally, the plugin would add support for the setCustomValidity() method and the other methods of the HTML5 validation constraint API. That way, you could implement custom validation in a standards compatible way and you would know that it worked across all browsers both old and new. Security It would be irresponsible of me to end this blog post without mentioning the issue of security. It is important to remember that any client-side validation — including HTML5 validation — can be bypassed. You should use client-side validation with the intention to create a better user experience. Client validation is great for providing a user with immediate feedback when the user is in the process of completing a form. However, client-side validation cannot prevent an evil hacker from submitting unexpected form data to your web server. You should always enforce your validation rules on the server. The only way to ensure that a required field has a value is to verify that the required field has a value on the server. The HTML5 required attribute does not guarantee anything. Summary The goal of this blog post was to describe the support for validation contained in the HTML5 standard. You learned how to use both the required and the pattern attributes in an HTML5 form. We also discussed how you can implement custom validation by taking advantage of the setCustomValidity() method. Finally, I discussed the available jQuery plugins for adding support for the HTM5 validation attributes to older browsers. Unfortunately, I am unaware of any jQuery plugin which provides a perfect solution to the problem of backwards compatibility.

    Read the article

  • MVVM Light V3 released at #MIX10

    - by Laurent Bugnion
    During my session “Understanding the MVVM pattern” at MIX10 in Vegas, I showed some components of the MVVM Light toolkit V3, which gave me the occasion to announce the release of version 3. This version has been in alpha stage for a while, and has been tested by many users. it is very stable, and ready for a release. So here we go! What’s new What’s new in MVVM Light Toolkit V3 is the topic of the next post. Cleaning up I would recommend cleaning up older versions before installing V3. I prepared a page explaining how to do that manually. Unfortunately I didn’t have time to create an automatic cleaner/installer, this is very high on my list but with the book and the conferences going on, it will take a little more time. Cleaning up is recommended because I changed the name of some DLLs to avoid some confusion (between the WPF3.5 and WPF4 version, as well as between the SL3 and SL4 versions). More details in the section titled “Compatibility”. Installation Installing MVVM Light toolkit is the manual process of unzipping a few files. The installation page has been updated to reflect the newest information. Compatibility MVVM Light toolkit V3 has components for the following environments and frameworks: Visual Studio 2008: Silverlight 3 Windows Presentation Foundation 3.5 SP1 Expression Blend 3 Silverlight 3 Windows Presentation Foundation 3.5 SP1 Visual Studio 2010 RC Silverlight 3 Silverlight 4 Windows Presentation Foundation 3.5 SP1 Windows Presentation Foundation 4 Silverlight for Windows Phone 7 series Expression Blend 4 beta Silverlight 3 Silverlight 4 Windows Presentation Foundation 3.5 SP1 Windows Presentation Foundation 4 Feedback As usual I welcome your constructive feedback. If you want the issue to be discussed in public, the best way is through the discussion page on the Codeplex site. if you wish to keep the conversation private, please check my Contact page for ways to talk to me. Video, tutorials There are a few new videos and tutorials available for the MVVM Light toolkit. The material is listed on the Get Started page, under “tutorials”.   Laurent Bugnion (GalaSoft) Subscribe | Twitter | Facebook | Flickr | LinkedIn

    Read the article

  • HUGE EF4 Inheritance Bug

    - by djsolid
    Well maybe not for everyone but for me is definitely really important. That is why I get straight into the point. We have the following model: Which maps to the following database: We are using EF4.0 and we want to load all Burgers including BurgerDetails. So we write the following query: But it fails. The error is : “The ResultType of the specified expression is not compatible with the required type. The expression ResultType is 'Transient.reference[SampleEFDBModel.Food]' but the required type is 'Transient.reference[SampleEFDBModel.Burger]'.Parameter name: arguments[0]”   So in the new version of EF there is no way to eager load data through Navigation Properties with 1-1 relationships defined in subclasses. Here is the relevant Microsoft Connect Issue. It is described through an other example but the result is the same.  Please if you think this is important vote up on Microsoft Connect.   EF 4.0 has many improvements. I am using it since v1 in large-scale projects and this version is faster,produces cleaner sql, more reliable and can be used for complicated business scenarios. That is why I believe this issue should be solved as soon as possible. I understand that release cycles are slow but I am hoping atleast for a hotfix. I also have uploaded the example project so you can test it. Download it from here. If anyone has found any workarounds please post it in the comments section. Thanks!

    Read the article

  • TFS Build 2010: BuildNumber and DropLocation

    - by javarg
    Automatic Builds for Application Release is a current practice in every major development factory nowadays. Using Team Foundation Server Build 2010 to accomplish this offers many opportunities to improve quality of your releases. The following approach allow us to generate build drop folders including the BuildNumber and the Changeset or Label provided. Using this procedure we can quickly identify the generated binaries in the Drop Server with the corresponding Version. Branch the DefaultTemplate.xaml and renamed it with CustomDefaultTemplate.xaml Open it for edit (check out) Go to the Set Drop Location Activity and edit the DropLocation property. Write the following expression: BuildDetail.DropLocationRoot + "\" + BuildDetail.BuildDefinition.Name + "\" + If(String.IsNullOrWhiteSpace(GetVersion), BuildDetail.SourceGetVersion, GetVersion) + "_" + BuildDetail.BuildNumber Check in the branched template. Now create a build definition named TestBuildForDev using the new template. The previous expression sets the DropLocation with the following format: (ChangesetNumber|LabelName)_BuildName_BuildNumber The first part of the folder name will be the changeset number or the label name (if triggered using labels). Folder names will be generated as following: C1850_TestBuildForDev_20111117.1 (changesets start with letter C) LLabelname_TestBuildForDev_20111117.1 (labels start with letter L) Try launching a build from a Changeset and from a Label. You can specify a Label in the GetVersion parameter in the Queue new Build Wizard, going to the Parameters tab (for labels add the “L” prefix):

    Read the article

  • SyncToBlog #10 Lots of Azure and Cloud Links including MIX10 videos

    - by Eric Nelson
    Just getting a few interesting cloud links “down on paper”. I last did one of these on Azure in Feb 20010. Cloud Links: Article on Debugging in the Cloud http://code.msdn.microsoft.com/azurescale  A sample app that demonstrates monitoring and automatically scaling an Azure application in response to dropping performance etc. Basically a console app that checks perf stats and then uses the Service Management API to spin up new instances when needed. Azure In Action book is imminent :) Running Memcached in Windows Azure from the MS UK team Using Microsoft Codename Dallas as a data source for Drupal also from the MS UK team I often mention them – but this post is the biz! Metodi on fault and upgrade domains Detailed blog post on comparing Azure AppFabric Service Bus REST support to the free Faye Ruby+JavaScript gem that implements the JSON publish/subscribe protocol Bayeux. AppFabric LABS allow you to test out and play with experimental AppFabric technologies. Details of the upcoming VM support in Windows Azure Nice series of posts from J D Meier in the Patterns and Practice team How To Use ASP.NET Forms Auth with Azure Tables  How To Use ASP.NET Forms Auth with Roles in Azure Tables How To Use ASP.NET Forms Auth with SQL Server on Windows Azure And sessions from MIX10 held March 15th to 17th: Lap around the Windows Azure Platform – Steve Marx Building and Deploying Windows Azure Based Applications with Microsoft Visual Studio 2010 – Jim Nakashima Building PHP Applications using the Windows Azure Platform – Craig Kitterman, Sumit Chawla Using Ruby on Rails to Build Windows Azure Applications – Sriram Krishnan Microsoft Project Code Name “Dallas": Data for your apps – Moe Khosravy Using Storage in the Windows Azure Platform – Chris Auld Building Web Applications with Windows Azure Storage – Brad Calder Building Web Application with Microsoft SQL Azure – David Robinson Connecting Your Applications in the Cloud with Windows Azure AppFabric – Clemens Vasters Microsoft Silverlight and Windows Azure: A Match Made for the Web – Matt Kerner Something for everyone :)

    Read the article

< Previous Page | 179 180 181 182 183 184 185 186 187 188 189 190  | Next Page >