Search Results

Search found 6103 results on 245 pages for 'nhibernate expression'.

Page 186/245 | < Previous Page | 182 183 184 185 186 187 188 189 190 191 192 193  | Next Page >

  • vs10 not deploying all required files - then not over-writing updated files

    - by justSteve
    I'm in the habit of deploying to alternating folders (/inetpub/wwwroot/mySite & /inetpub/wwwroot/mySite2) so if something unexpected happens with the deploy i can quickly swap back to a previous version just by changing the path in IIS So i was deploying an MVC2 webapp to a empty folder figuring that VS would send up all the files it needs. Not even close. Initially, it didn't even upload a couple required nHibernate.dlls. Later, after manually copying files referenced in the thrown exceptions, i just copied all the files from the previous compile and then re-published over the top expecting VS to over-write the changed files. Failed that too. No reports of errors by VS....just failed to over-write a number of pre-existing (but changed/updated) files. Hard to believe these kinds of errors (and lack of feedback that errors were encountered) in a state of the art tool like VS. Clearly, I'm doing something wrong. I'm using VisualSVN for source control and connect to my colocated server via a VPN-based mapped network drive (so I can use FileSystem to publish). (both of which can complicate file properties) VS08 had more choices for which files it would send up - i found i needed to use the 'All files in source' on an initial deployment, the 'Replace Matching'. If I choose 'delete all existing...' I'd be back to square 1 and have to deploy with the 'All files in source project folder'. But VS10 doesn't have the 'All files in source project folder. I ended up manually copying the files - which seems not right in the extreme. Are these known issues others have to deal with? What's best practice for deploying a web-app? thx

    Read the article

  • What is lifetime of lambda-derived implicit functors in C++ ?

    - by Fyodor Soikin
    The question is simple: what is lifetime of that functor object that is automatically generated for me by the C++ compiler when I write a lambda-expression? I did a quick search, but couldn't find a satisfactory answer. In particular, if I pass the lambda somewhere, and it gets remembered there, and then I go out of scope, what's going to happen once my lambda is called later and tries to access my stack-allocated, but no longer alive, captured variables? Or does the compiler prevent such situation in some way? Or what?

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • Double-Escaped Unicode Javascript Issue

    - by Jeffrey Winter
    I am having a problem displaying a Javascript string with embedded Unicode character escape sequences (\uXXXX) where the initial "\" character is itself escaped as "&#92;" What do I need to do to transform the string so that it properly evaluates the escape sequences and produces output with the correct Unicode character? For example, I am dealing with input such as: "this is a &#92;u201ctest&#92;u201d"; attempting to decode the "&#92;" using a regex expression, e.g.: var out = text.replace('/&#92;/g','\'); results in the output text: "this is a \u201ctest\u201d"; that is, the Unicode escape sequences are displayed as actual escape sequences, not the double quote characters I would like.

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • ASP.NET application - Error when trying to connect to a SQL Server 2008 instance

    - by Pablo Dami
    Hi everyone! Despite that I’m a regular reader of this great forum, this is my first post on it. I believe that this community can help me with the following problem that I have. I’m trying to publish an ASP.NET website over an IIS 6.0 (Windows 2003 Server), and I have some troubles trying to connect to the database. Curiously, I have installed another ASP.NET website into the same IIS 6.0 with the same properties and security parameters and can connect without problems with the same database. The application that works fine is almost the same that the one that can’t connect with SQL Server (actually is the same but with several modifications). I’ll enumarate some information related to the problem: S.O: Windows 2003 Server SQL Server Engine: SQL Server 2008 SQL Server accept remote connections? Yes. ASP.NET version: 2.0.50727 The connections via TCP/IP are enabled to the SQL Server instance? Yes. The corresponding user that I have in the connection string, actually exists into the database with the “owner” role? Yes. ORM Tool used: nHibernate I get the following error when I try to run the aplication into the browser: Error while establishing a connection to the server. When connecting to SQL Server 2005, this failure may occur because the default settings SQL Server does not allow remote connections. (provider: Shared Memory Provider, error: 40 - Could not open a connection to SQL Server) In order to isolate the problem, I made some test. For example, using the web app that works fine I can connect without any problema with the database that uses the web app that can’t. With this evidence I concluded that the problem is within the web app and not into the SQL Server instance. I also google it my problem but sadly I can't find nothing usefull to solve it. If someone can help me I’ll appreciate that. Thank you so much for your time!

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • problem with null column

    - by Iulian
    One column in my database (of type double) has some null values. I am executing a sored procedure to get the data in my app wipDBTableAdapters.XLSFacturiTableAdapter TAFacturi = new wipDBTableAdapters.XLSFacturiTableAdapter(); var dtfacturi = TAFacturi.GetData(CodProiect); Then i try to do something like this: if (dtfacturi[i].CANTITATE == null) { //do something } this is giving a warning : The result of the expression is always 'false' since a value of type 'double' is never equal to 'null' of type 'double? However when i run my code i get the following exception: StrongTypingException The value for column 'CANTITATE' in table 'XLSFacturi' is DBNull. How am I supposed to resolve this ?

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Return an empty collection when Linq where returns nothing

    - by ahsteele
    I am using the below statement with the intent of getting all of the machine objects from the MachineList collection (type IEnumerable) that have a MachineStatus of i. The MachineList collection will not always contain machines with a status of i. At times when no machines have a MachineStatus of i I'd like to return an empty collection. My call to ActiveMachines (which is used first) works but InactiveMachines does not. public IEnumerable<Machine> ActiveMachines { get { return Customer.MachineList .Where(m => m.MachineStatus == "a"); } } public IEnumerable<Machine> InactiveMachines { get { return Customer.MachineList .Where(m => m.MachineStatus == "i"); } } Edit Upon further examination it appears that any enumeration of MachineList will cause subsequent enumerations of MachineList to throw an exeception: Object reference not set to an instance of an object. Therefore, it doesn't matter if a call is made to ActiveMachines or InactiveMachines as its an issue with the MachineList collection. This is especially troubling because I can break calls to MachineList simply by enumerating it in a Watch before it is called in code. At its lowest level MachineList implements NHibernate.IQuery being returned as an IEnumerable. What's causing MachineList to lose its contents after an initial enumeration?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • How to convert an arbitrary object to String with JSTL? (calling toString())

    - by hstoerr
    Is there any way to call toString() on an object with the JSTL? (I need the String representation of an enum as index in a map in a JSP EL expression.) I hoped something like ${''+object} would work like in java, but JSTL isn't that nice, and there does not seem to be any function that does it. Clarification: I have a variable somemap that maps Strings to Strings, and I have a variable someenum that is an enumeration. I'd like to do something like ${somemap[someenum.toString()]}. (Of course .toString() does not work, but what does?)

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • Get latest sql rows based on latest date and per user

    - by Umair
    I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • Create Sum of calculated rows in Microsoft Reporting Services

    - by kd7iwp
    This seems like it should be simple but I can't find anything yet. In Reporting Services I have a table with up to 6 rows that all have calculated values and dynamic visibility. I would like to sum these rows. Basically I have a number of invoice items and want to make a total. I can't change anything on the DB side since my stored procedures are used elsewhere in the system. Each row pulls data from a different dataset as well, so I can't do a sum of the dataset. Can I sum all the rows with a table footer? Similarly to totaling a number of rows in Excel? It seems very redundant to put my visibility expression from each row into my footer row to calculate the sum.

    Read the article

  • C++ Templates: implicit conversion, no matching function for call to ctor

    - by noname
    template<class T> class test { public: test() { } test(T& e) { } }; int main() { test<double> d(4.3); return 0; } Compiled using g++ 4.4.1 with the following errors: g++ test.cpp -Wall -o test.exe test.cpp: In function 'int main()': test.cpp:18: error: no matching function for call to 'test<double>::test(double) ' test.cpp:9: note: candidates are: test<T>::test(T&) [with T = double] test.cpp:5: note: test<T>::test() [with T = double] test.cpp:3: note: test<double>::test(const test<double>&) make: *** [test.exe] Error 1 However, this works: double a=1.1; test<double> d(a); Why is this happing? Is it possible that g++ cannot implicitly convert literal expression 1.1 to double? Thanks.

    Read the article

  • x86 Assembly Question about outputting

    - by jdea
    My code looks like this _declspec(naked) void f(unsigned int input,unsigned int *output) { __asm{ push dword ptr[esp+4] call factorial pop ecx mov [output], eax //copy result ret } } __declspec(naked) unsigned int factorial(unsigned int n) { __asm{ push esi mov esi, dword ptr [esp+8] cmp esi, 1 jg RECURSE mov eax, 1 jmp END RECURSE: dec esi push esi call factorial pop esi inc esi mul esi END: pop esi ret } } Its a factorial function and I'm trying to output the answer after it recursively calculates the number that was passed in But what I get returned as an output is the same large number I keep getting Not sure about what is wrong with my output, by I also see this error CXX0030: Error: expression cannot be evaluated Thanks!

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

< Previous Page | 182 183 184 185 186 187 188 189 190 191 192 193  | Next Page >