Search Results

Search found 20142 results on 806 pages for 'expected exception'.

Page 189/806 | < Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >

  • Request header is too large

    - by stck777
    I found serveral IllegalStateException Exception in the logs: [#|2009-01-28T14:10:16.050+0100|SEVERE|sun-appserver2.1|javax.enterprise.system.container.web|_ThreadID=26;_ThreadName=httpSSLWorkerThread-80-53;_RequestID=871b8812-7bc5-4ed7-85f1-ea48f760b51e;|WEB0777: Unblocking keep-alive exception java.lang.IllegalStateException: PWC4662: Request header is too large at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:740) at org.apache.coyote.http11.InternalInputBuffer.parseHeader(InternalInputBuffer.java:657) at org.apache.coyote.http11.InternalInputBuffer.parseHeaders(InternalInputBuffer.java:543) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.parseRequest(DefaultProcessorTask.java:712) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.doProcess(DefaultProcessorTask.java:577) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.process(DefaultProcessorTask.java:831) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.executeProcessorTask(DefaultReadTask.java:341) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:263) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:214) at com.sun.enterprise.web.portunif.PortUnificationPipeline$PUTask.doTask(PortUnificationPipeline.java:380) at com.sun.enterprise.web.connector.grizzly.TaskBase.run(TaskBase.java:265) at com.sun.enterprise.web.connector.grizzly.ssl.SSLWorkerThread.run(SSLWorkerThread.java:106) |#] Does anybody know configuration changes to fix this?

    Read the article

  • jQuery: Use of undefined constant data assumed 'data'

    - by morpheous
    I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

    Read the article

  • If XmlException.SourceUri is read-only, what good is it?

    - by East of Nowhere
    I have a couple places in my code where it throwing a new System.Xml.XmlException seems appropriate. I could just do throw new XmlException("Your XML sucks go fix it then try again."); But I think it's better to take advantage whenever possible of members particular to the exception class (otherwise ya might as well throw a plain ol' Exception every time). SourceUri and LineNumber would be helpful, but they only have get methods, there's no way I can assign a value to them! There's only 3 constructor overloads and none of them have parameters for those members either; I can only initialize Message, nothing else. There has got to be some way to populate those data members with values, otherwise why does XmlException bother with them? I suppose I could make a new class that inherits XmlException and write a new constructor that initializes SourceUri etc. but still, there must be a way to just use XmlException. Right?

    Read the article

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

  • How to use third party themes in swing application?

    - by swift
    I want to use some third party themes (like synthetica http://www.javasoft.de/synthetica/themes/) in my swing appliaction. i am using eclipse ide, got the jar file of theme and did the following modification(according to the readme file from the theme) in my code try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); } but after this modification its showing the following error The type de.javasoft.plaf.synthetica.SyntheticaLookAndFeel cannot be resolved. It is indirectly referenced from required .class files what does this mean? i tried searching on net but cant really find any useful answers Contents of Readme file: System Requirements =================== Java SE 5 (JRE 1.5.0) or above Synthetica V2.2.0 or above Integration =========== 1. Ensure that your classpath contains all Synthetica libraries (including Synthetica's core library 'synthetica.jar'). 2. Enable the Synthetica Look and Feel at startup time in your application: import de.javasoft.plaf.synthetica.SyntheticaBlackMoonLookAndFeel; try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); }

    Read the article

  • NHibernate ManyToMany Relationship Cascading AllDeleteOrphan StackOverflowException

    - by Chris
    I have two objects that have a ManyToMany relationship with one another through a mapping table. Though, when I try to save it, I get a stack overflow exception. The following is the code for the mappings: //EventMapping.cs HasManyToMany(x => x.Performers).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("EventId").ChildKeyColumn("PerformerId"); //PerformerMapping.cs HasManyToMany<Event>(x => x.Events).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("PerformerId").ChildKeyColumn("EventId"); When I change the performermapping.cs to Cascade.None() I get rid of the exception but then my Event Object doesn't have the performer I associate with it. //In a unit test, paraphrased event.Performers.Add(performer); //Event eventRepository.Save<Event>(event); eventResult = eventRepository.GetById<Event>(event.id); //Event eventResult.Performers[0]; //is null, should have performer in it How should I be writing this properly? Thanks

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Techniques to avoid DeadlineExceededException in GAE/J?

    - by Tahir Akram
    I am developing an Twitter4J web application in Google App Engine/Java. I need to show two lists. One is Twitter friends and other is followers. With photo and screen name. It is working fine for people who have 20-30 followers and friends. But it gave me DeadlineExceededException when I try a user who has 150+ followers and friends. GAE throws this exception if web request take time more than 30 seconds. So what techniques I can adopt to avoid this exception. Should I generate two AJAX calls for each of my list. After page loads. So that every call will have its own 30 secs limit? Or what else you think? I am gone make it. Please help.

    Read the article

  • What are the essential COM componenets required for burning DVD in c#.net in Windows XP?

    - by shruti
    im trying to burn DVD/CD through frontend C#.net code... i have used IMAPI2 for buring CD/DVD in windows XP..but it is giving me unhandeled exception... as:- System.InvalidCastException: Unable to cast COM object of type 'IMAPI2.Interop.MsftFileSystemImageClass' to interface type 'IMAPI2.Interop.MsftFileSystemImage'. This operation failed because the QueryInterface call on the COM component for the interface with IID '{7CFF842C-7E97-4807-8304-910DD8F7C051}' failed due to the following error: No such interface supported (Exception from HRESULT: 0x80004002 (E_NOINTERFACE)) can anyone plz help me out to solve this pbm...im not able to solve this error.. this project is working fine in Windows7 but unable to work with XP...???

    Read the article

  • Update MySQL table from jsp

    - by vishnu
    I have these in a jsp file. But these values are not updated in the mysql table. May be it is not commiting. How can i solve this ? String passc1 = request.getParameter("passc1"); String accid = request.getParameter("accid"); int i = 0; String sql = " update customertb " + " set passwd = ?" + " where acc_no = ?;"; try { PreparedStatement ps = con.prepareStatement(sql); ps.setString(1, passc1); ps.setString(2, accid); i = ps.executeUpdate(); } catch (Exception e) { // do something with Exception here. Maybe just throw it up again } finally { con.close(); }

    Read the article

  • C# MDX RenderToSurface, where to reset after device is lost?

    - by Moritz Schöfl
    Hi, I got a problem with the RenderToSurface class. When I resize the Form of my Device, the Draw method is still called, but doesnt throw an Exception, it looks like this: device.Clear(ClearFlags.Target, Color.Red, 0, 0); device.BeginScene(); // here is out commented code device.EndScene(); device.Present(); In another method, I wrote this: renderToSurface.BeginScene(surfaces[currentIndex]); // here is out commented code renderToSurface.EndScene(Filter.None); and this method seems to throw a nullpointer exception when I resize the window; So my question is: - where to reset / restore / handle the renderToSurface class? (i tried it with the DeviceReset event like following - void OnDeviceReset(object sender, EventArgs e) { renderToSurface = new RenderToSurface(Game.Device, Game.ClientSize.Width, Game.ClientSize.Height, Format.A8R8G8B8, true, DepthFormat.D16); } )

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Updating to Spring 2.5.5 causes a javax.servlet.UnavailableException: org.springframework.web.struts

    - by Averroes
    I have been told to update some application from Spring 2.0.8 to Spring 2.5.5. This application is using Struts 1.2.7. Once I change the Spring.jar I get the following exception while loading in JBoss 4.0.5: 10:14:57,579 ERROR [[/PortalRRHH]] Servlet /PortalRRHH threw load() exception javax.servlet.UnavailableException: org.springframework.web.struts.DelegatingTilesRequestProcessor This is defined in the struts-config.xml this way: <controller locale="true"> <set-property property="processorClass" value="org.springframework.web.struts.DelegatingTilesRequestProcessor"/> </controller> I have no clue of what is happening since it works with the old version of Spring and the DelegatingTilesRequestProcessor is still available in Spring 2.5.5. I have no previous experience with Struts so if you need anything else to figure what the problem is please ask and I will update the question. Thanks.

    Read the article

  • Java multiple connections downloading file

    - by weulerjunior
    Hello friends, I was wanting to add multiple connections in the code below to be able to download files faster. Could someone help me? Thanks in advance. public void run() { RandomAccessFile file = null; InputStream stream = null; try { // Open connection to URL. HttpURLConnection connection = (HttpURLConnection) url.openConnection(); // Specify what portion of file to download. connection.setRequestProperty("Range", "bytes=" + downloaded + "-"); // Connect to server. connection.connect(); // Make sure response code is in the 200 range. if (connection.getResponseCode() / 100 != 2) { error(); } // Check for valid content length. int contentLength = connection.getContentLength(); if (contentLength < 1) { error(); } /* Set the size for this download if it hasn't been already set. */ if (size == -1) { size = contentLength; stateChanged(); } // Open file and seek to the end of it. file = new RandomAccessFile("C:\\"+getFileName(url), "rw"); file.seek(downloaded); stream = connection.getInputStream(); while (status == DOWNLOADING) { /* Size buffer according to how much of the file is left to download. */ byte buffer[]; if (size - downloaded > MAX_BUFFER_SIZE) { buffer = new byte[MAX_BUFFER_SIZE]; } else { buffer = new byte[size - downloaded]; } // Read from server into buffer. int read = stream.read(buffer); if (read == -1) { break; } // Write buffer to file. file.write(buffer, 0, read); downloaded += read; stateChanged(); } /* Change status to complete if this point was reached because downloading has finished. */ if (status == DOWNLOADING) { status = COMPLETE; stateChanged(); } } catch (Exception e) { error(); } finally { // Close file. if (file != null) { try { file.close(); } catch (Exception e) { } } // Close connection to server. if (stream != null) { try { stream.close(); } catch (Exception e) { } } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Array Searching code challenge

    - by RCIX
    Here's my (code golf) challenge: Take two arrays of bytes and determine if the second array is a substring of the first. If it is, output the index at which the contents of the second array appear in the first. If you do not find the second array in the first, then output -1. Example Input: { 63, 101, 245, 215, 0 } { 245, 215 } Expected Output: 2 Example Input 2: { 24, 55, 74, 3, 1 } { 24, 56, 74 } Expected Output 2: -1 Edit: Someone has pointed out that the bool is redundant, so all your function has to do is return an int representing the index of the value or -1 if not found.

    Read the article

  • Stack trace in website project, when debug = false

    - by chandmk
    We have a website project. We are logging unhanded exceptions via a appdomain level exception handler. When we set debug= true in web.config, the exception log is showing the offending line numbers in the stack trace. But when we set debug = false, in web.config, log is not displaying the line numbers. We are not in a position to convert the website project in to webapplication project type at this time. Its legacy application and almost all the code is in aspx pages. We also need to leave the project in 'updatable' mode. i.e. We can't user pre-compile option. We are generating pdb files. Is there anyway to tell this kind of website projects to generate the pdb files, and show the line numbers in the stack trace?

    Read the article

  • jQuery/Ajax/javascript in FireFox Error when using $.post/$.get

    - by IsenGrim
    uncaught exception: [Exception... "Component returned failure code: 0x80004005 (NS_ERROR_FAILURE)" nsresult: "0x80004005 (NS_ERROR_FAILURE)" location: "JS frame :: http://localhost/scripts/jQuery.js :: anonymous :: line 808" data: no] Line 0 is the error i get when i bring up firebug. This only happens in firefox (and maybe other browsers) but the code works fine in IE8. I have codes like this in jquery: $("#Logout").live("click", function (e) { e.preventDefault(e); $.post("/logout.php", {}, function () { //--a bunch of animations--// window.location = "/login.php"; } }); I have no idea whats wrong as even the error message is not helpful at all.. inside logout.php: <?php session_start(); session_destroy(); ?> Also dont work if I used GET or inserted phantom data. Or is there a more elegant way to do this?

    Read the article

  • Django - I got TemplateSyntaxError when I try open the admin page. (http://DOMAIN_NAME/admin)

    - by user140827
    I use grappelly plugin. When I try open the admin page (/admin) I got TemplateSyntaxError. It says 'get_generic_relation_list' is invalid block tag. TemplateSyntaxError at /admin/ Invalid block tag: 'get_generic_relation_list', expected 'endblock' Request Method: GET Request URL: http://DOMAIN_NAME/admin/ Django Version: 1.4 Exception Type: TemplateSyntaxError Exception Value: Invalid block tag: 'get_generic_relation_list', expected 'endblock' Exception Location: /opt/python27/django/1.4/lib/python2.7/site-packages/django/template/base.py in invalid_block_tag, line 320 Python Executable: /opt/python27/django/1.4/bin/python Python Version: 2.7.0 Python Path: ['/home/vhosts/DOMAIN_NAME/httpdocs/media', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov/lib', '/home/vhosts/DOMAIN_NAME/httpdocs/', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private', '/opt/python27/django/1.4', '/home/vhosts/DOMAIN_NAME/httpdocs', '/opt/python27/django/1.4/lib/python2.7/site-packages/setuptools-0.6c12dev_r88846-py2.7.egg', '/opt/python27/django/1.4/lib/python2.7/site-packages/pip-0.8.1-py2.7.egg', '/opt/python27/django/1.4/lib/python27.zip', '/opt/python27/django/1.4/lib/python2.7', '/opt/python27/django/1.4/lib/python2.7/plat-linux2', '/opt/python27/django/1.4/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/lib-old', '/opt/python27/django/1.4/lib/python2.7/lib-dynload', '/opt/python27/lib/python2.7', '/opt/python27/lib/python2.7/plat-linux2', '/opt/python27/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/setuptools-0.6c11-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/flup-1.0.3.dev_20100525-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/virtualenv-1.5.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLAlchemy-0.6.4-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLObject-0.14.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/FormEncode-1.2.3dev-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/MySQL_python-1.2.3-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/psycopg2-2.2.2-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/pysqlite-2.6.0-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/PIL'] Server time: ???, 7 ??? 2012 04:19:42 +0700 Error during template rendering In template /home/vhosts/DOMAIN_NAME/httpdocs/templates/grappelli/admin/base.html, error at line 28 Invalid block tag: 'get_generic_relation_list', expected 'endblock' 18 <!--[if lt IE 8]> 19 <script src="http://ie7-js.googlecode.com/svn/version/2.0(beta3)/IE8.js" type="text/javascript"></script> 20 <![endif]--> 21 {% block javascripts %} 22 <script type="text/javascript" src="{% admin_media_prefix %}jquery/jquery-1.3.2.min.js"></script> 23 <script type="text/javascript" src="{% admin_media_prefix %}js/admin/Bookmarks.js"></script> 24 <script type="text/javascript"> 25 // Admin URL 26 var ADMIN_URL = "{% get_admin_url %}"; 27 // Generic Relations 28 {% get_generic_relation_list %} 29 // Get Bookmarks 30 $(document).ready(function(){ 31 $.ajax({ 32 type: "GET", 33 url: '{% url grp_bookmark_get %}', 34 data: "path=" + escape(window.location.pathname + window.location.search), 35 dataType: "html", 36 success: function(data){ 37 $('ul#bookmarks').replaceWith(data); 38 }

    Read the article

  • A SelfHosted WCF Service over Basic HTTP Binding doesn't support more than 1000 concurrent requests

    - by Krishnan
    I have self hosted a WCF Service over BasicHttpBinding consumed by an ASMX Client. I'm simulating a concurrent user load of 1200 users. The service method takes a string parameter and returns a string. The data exchanged is less than 10KB. The processing time for a request is fixed at 2 seconds by having a Thread.Sleep(2000) statement. Nothing additional. I have removed all the DB Hits / business logic. The same piece of code runs fine for 1000 concurrent users. I get the following error when I bump up the number to 1200 users. System.Net.WebException: The underlying connection was closed: An unexpected error occurred on a receive. ---> System.IO.IOException: Unable to read data from the transport connection: An existing connection was forcibly closed by the remote host. ---> System.Net.Sockets.SocketException: An existing connection was forcibly closed by the remote host at System.Net.Sockets.Socket.Receive(Byte[] buffer, Int32 offset, Int32 size, SocketFlags socketFlags) at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) --- End of inner exception stack trace --- at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.PooledStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.Connection.SyncRead(HttpWebRequest request, Boolean userRetrievedStream, Boolean probeRead) --- End of inner exception stack trace --- at System.Web.Services.Protocols.WebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.HttpWebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at WCF.Throttling.Client.Service.Function2(String param) This exception is often reported on DataContract mismatch and large data exchange. But never when doing a load test. I have browsed enough and have tried most of the options which include, Enabled Trace & Message log on server side. But no errors logged. To overcome Port Exhaustion MaxUserPort is set to 65535, and TcpTimedWaitDelay 30 secs. MaxConcurrent Calls is set to 600, and MaxConcurrentInstances is set to 1200. The Open, Close, Send and Receive Timeouts are set to 10 Minutes. The HTTPWebRequest KeepAlive set to false. I have not been able to nail down the issue for the past two days. Any help would be appreciated. Thank you.

    Read the article

  • Fluent NHibernate MappingException : could not instantiate id generator

    - by Mark Simpson
    I'm pottering around with Fluent NHibernate to try and get a simple app up and running. I'm running through this Fluent NHibernate Tutorial. Everything seems to be going fine and I've created the required classes etc. and it all builds, but when I run the test, I get an exception. Someone in the comments section of the tutorial has the same problem, but I can't find any good information on what's causing it. Any help appreciated. It's probably something trivial. Exception details: FluentNHTest.Tests.Mappings.CustomerMappingTests.ValidateMappings: FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- NHibernate.MappingException : could not instantiate id generator ---- System.FormatException : Input string was not in a correct format.

    Read the article

  • Java getInputStreat SocketTimeoutException instead of NoRouteToHostException

    - by Jon
    I have an odd issue happening when trying to open multiple Input Streams (in separate threads) on Linux (RHEL). The behaviour works as expected on windows. I am kicking off 3 threads to open https connections to 3 different servers. All three are invalid IP addresses (in this test case), so I expect an NoRouteToHostException for each of them. The first two return these as expected, and quite quickly. (see stack trace below) However the third (and 4th when I tested it that way) do NOT give a no route exception. They wait for ages, and then give a SocketTimeoutException (see other stack trace below). This takes ages to come back, and does not accurately express the connection issue. The offending line of code is: reader = new BufferedReader(new InputStreamReader(conn.getInputStream())); Has anyone seen something like this before? Are there multi-threading issues with sockets on REHL or some limit somewhere to how many can connect at once...or...something? Expected stack trace, as received for first two: java.net.NoRouteToHostException: No route to host at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(PlainSocketImpl.java:333) at java.net.PlainSocketImpl.connectToAddress(PlainSocketImpl.java:195) at java.net.PlainSocketImpl.connect(PlainSocketImpl.java:182) at java.net.SocksSocketImpl.connect(SocksSocketImpl.java:366) at java.net.Socket.connect(Socket.java:529) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.connect(SSLSocketImpl.java:559) at sun.net.NetworkClient.doConnect(NetworkClient.java:158) at sun.net.www.http.HttpClient.openServer(HttpClient.java:394) at sun.net.www.http.HttpClient.openServer(HttpClient.java:529) at sun.net.www.protocol.https.HttpsClient.(HttpsClient.java:272) at sun.net.www.protocol.https.HttpsClient.New(HttpsClient.java:329) at sun.net.www.protocol.https.AbstractDelegateHttpsURLConnection.getNewHttpClient(AbstractDelegateHttpsURLConnection.java:172) at sun.net.www.protocol.http.HttpURLConnection.plainConnect(HttpURLConnection.java:916) at sun.net.www.protocol.https.AbstractDelegateHttpsURLConnection.connect(AbstractDelegateHttpsURLConnection.java:158) at sun.net.www.protocol.http.HttpURLConnection.getInputStream(HttpURLConnection.java:1177) at sun.net.www.protocol.https.HttpsURLConnectionImpl.getInputStream(HttpsURLConnectionImpl.java:234) Unexpected stack trace, as received on 3rd: java.net.SocketTimeoutException: connect timed out at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(PlainSocketImpl.java:333) at java.net.PlainSocketImpl.connectToAddress(PlainSocketImpl.java:195) at java.net.PlainSocketImpl.connect(PlainSocketImpl.java:182) at java.net.SocksSocketImpl.connect(SocksSocketImpl.java:366) at java.net.Socket.connect(Socket.java:529) at com.sun.net.ssl.internal.ssl.SSLSocketImpl.connect(SSLSocketImpl.java:559) at sun.net.NetworkClient.doConnect(NetworkClient.java:158) at sun.net.www.http.HttpClient.openServer(HttpClient.java:394) at sun.net.www.http.HttpClient.openServer(HttpClient.java:529) at sun.net.www.protocol.https.HttpsClient.(HttpsClient.java:272) at sun.net.www.protocol.https.HttpsClient.New(HttpsClient.java:329) at sun.net.www.protocol.https.AbstractDelegateHttpsURLConnection.getNewHttpClient(AbstractDelegateHttpsURLConnection.java:172) at sun.net.www.protocol.http.HttpURLConnection.plainConnect(HttpURLConnection.java:916) at sun.net.www.protocol.https.AbstractDelegateHttpsURLConnection.connect(AbstractDelegateHttpsURLConnection.java:158) at sun.net.www.protocol.http.HttpURLConnection.getInputStream(HttpURLConnection.java:1177) at sun.net.www.protocol.https.HttpsURLConnectionImpl.getInputStream(HttpsURLConnectionImpl.java:234)

    Read the article

  • java.io.IOException: Invalid argument

    - by Luixv
    Hi I have a web application running in cluster mode with a load balancer. It consists in two tomcats (T1, and T2) addressing only one DB. T2 is nfs mounted to T1. This is the only dofference between both nodes. I have a java method generating some files. If the request runs on T1 there is no problem but if the request is running on node 2 I get an exception as follows: java.io.IOException: Invalid argument at java.io.FileOutputStream.close0(Native Method) at java.io.FileOutputStream.close(FileOutputStream.java:279) The corresponding code is as follows: for (int i = 0; i < dataFileList.size(); i++) { outputFileName = outputFolder + fileNameList.get(i); FileOutputStream fileOut = new FileOutputStream(outputFileName); fileOut.write(dataFileList.get(i), 0, dataFileList.get(i).length); fileOut.flush(); fileOut.close(); } The exception appears at the fileOut.close() Any hint? Luis

    Read the article

  • How to compare the output of serializeArray using qunit

    - by dorelal
    I am using qunit and jquery. Latest version of both. In my code when I submit the form I have the event as e. I call e.serializeArray() Here is my test. equals(args.data, [ { "name": "user_name", "value": "john" } ], 'input data'); And this is the error message from qunit. expected: [ { "name": "user_name", "value": "david" } ] result: [ { "name": "user_name", "value": "david" } ] As you can see to the naked eye the expected and result value is same but qunit is not liking it. I guess I am missing something.

    Read the article

< Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >