Search Results

Search found 89638 results on 3586 pages for 'file table'.

Page 189/3586 | < Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >

• mini-dinstall chmod 0600 changes file: Operation not permitted

  - by V. Reileno

  I'm getting "Operation not permitted" in the mini-dinstall.log everytime a new debian package has been uploaded on the custom debian repository using dput. The deb file is installed successfuly but the changes file remains in the incoming folder. I can not use a post-install script when the changes file can not be processed. How can I fix this problem? Traceback (most recent call last): File "/usr/bin/mini-dinstall", line 780, in install retval = self._install_run_scripts(changefilename, changefile) File "/usr/bin/mini-dinstall", line 826, in _install_run_scripts do_chmod(changefilename, 0600) File "/usr/bin/mini-dinstall", line 193, in do_chmod do_and_log('Changing mode of "%s" to %o' % (name, mode), os.chmod, name, mode) File "/usr/bin/mini-dinstall", line 176, in do_and_log function(*args) OSError: [Errno 1] Operation not permitted: '/srv/debian-repository/mini-dinstall/incoming/debian-repository_1.3_amd64.changes' The mini-dinstall permissions: ls -lad incoming/ drwxrws--- 2 mini-dinstall debian-repository-uploader 4096 Jun 6 11:45 incoming/ ls -la incoming/debian-repository_1.3_amd64.changes -rw-rw---- 1 uploader-user debian-repository-uploader 1322 Jun 6 11:43 incoming/debian-repository_1.3_amd64.changes groups uploader-user uploader-user : uploader-user adm users debian-repository debian-repository-uploader puppet-client-updater groups mini-dinstall mini-dinstall : mini-dinstall debian-repository-uploader Cheers and thanks V.

  Read the article

• How can I find the original un-changed configuration file to compare with the *.rpmnew file?

  - by User

  While upgrading from CentOS 5.7 to 5.8 I've received the following warnings: warning: /etc/sysconfig/iptables-config created as /etc/sysconfig/iptables-config.rpmnew warning: /etc/ssh/sshd_config created as /etc/ssh/sshd_config.rpmnew warning: /etc/odbcinst.ini created as /etc/odbcinst.ini.rpmnew (To know the reason for such files, and what one can do with them read - Why do I have .rpmnew file after an update? ) I want to know what exactly has been change in the default config file by comparing the old default file (the original un-changed configuration file) with the new default file (*.rpmnew). Then, I can apply the changes to my modified file (aka diff merge). The problem is I don't know where can I find the original un-changed configuration file...

  Read the article

• mysql error code 13 on windows xampp caused by lower case table names = 0

  - by user127379

  I can import an sql (from test linux server mysql) file if the lower case setting is removed. But then the table names are lower case and the web site doesn't work. Originally it was working (my.ini with the lower case settings), I then exported to a linux server, it was working there. Now importing back to my windows (xampp setup) fails. After wild goose chase looking at disks and permissions, I found that if I remove the lower_case_table_names=0, the import works! But I need the case sensitive command so that I can deploy on the linux server.

  Read the article

• word 2010 Macro to name and Save file when opened

  - by Phillip Clark

  I have a word document template and will be using a hyper link in Excel to access the word file. The issue I need to resolve is making sure once it is opened a message field box is "popped" up asking the user to create a new file name ... (in this case the current date) for each time the file is opened. In the message pop when finished entering in file name they click yes and then the save screen comes up with the path/file type (macro enabled document) and the file name they have already entered in the pop up.. All they should have to do from the save screen is click ok and it saves the file to a certain path/folder on the C drive of the computer. Once they finish typing in their notes they click a active x button to save and close and they are finished. If anyone can help with this it would be fantastic.

  Read the article

• SQL-Server 2008 : Table Insert and Range Check ?

  - by LB .

  I'm using the Table Value constructor to insert a bunch of rows at a time. However if i'm using sql replication, I run into a range check constraint on the publisher on my id column managed automatically. The reason is the fact that the id range doesn't seem to be increased during an insert of several values, meaning that the max id is reached before the actual range expansion could occur (or the id threshold). It looks like this problem for which the solution is either running the merge agent or run the sp_adjustpublisheridentityrange stored procedure. I'm litteraly doing something like : INSERT INTO dbo.MyProducts (Name, ListPrice) VALUES ('Helmet', 25.50), ('Wheel', 30.00), ((SELECT Name FROM Production.Product WHERE ProductID = 720), (SELECT ListPrice FROM Production.Product WHERE ProductID = 720)); GO What are my options (if I don't want or can't adopt any of the proposed solution) ? Expand the range ? Decrease the threshold ? Can I programmatically modify my request to circumvent this problem ? thanks.

  Read the article

• Filling up bounded form with information from another table while creating new record

  - by amir shadaab

  I have an excel sheet with information about each employee. I keep getting new updated spreadsheet every month. I have to create a database managing cases related to the employees. I have a database and the bounded form already created for the cases which also contain emp info fields. What I am trying to do is to only type in the emp id in the form and want the form to look up in the spreadsheet(which can be a table in the cases db) and populate other fields in the form and that information can go into the cases db. Can this be done?

  Read the article

• Hiding a directory through the FAT table

  - by hennobal

  I've looked into the FAT file system, trying to find a way to make a directory hidden from view of the user. This has been done with malware previously, so it should be possible. The SpyEye trojan hid inside a directory C:\cleansweep.exe\ which was only reachable through the command line. I know deletion is possible by substituting the first character of the directory in the FAT table with 0xE5, but then it will not be accessible. Any ideas on how the scenario from SpyEye can be recreated? Any filesystem is interesting, but ideally FAT or NTFS.

  Read the article

• MS Word showing unwanted table borders on screen (but not on print preview)

  - by Jivlain

  I have a MS Word document with a number of tables. The other day when I created it, the tables all had no borders. Today, I opened it up to find that the tables did have borders. However, when I check the border properties on each table, it says that there are no borders. The tables are displayed with cell borders in all view modes except for the reading layout, and they do not show up on print preview. As this document is going to generally be for on-screen viewing, I need to get rid of the borders. How can I accomplish this? (this is a MS Word 2003 *.doc document, in MS Word 2003, which has been the only editor involved.)

  Read the article

• split a textfile after each n matches to a new file using sed or awk

  - by ozz

  i tried to split a file in parts of n matches each. The file is just one line and the seperator is '<br>' foo<br>bar<br>.....<br> I just want to split the file in parts, where each file has 100 datasets (text plus <br>)( normaly 100 datasets, but at the end maybe less) I already played around with this ... split-file-in-2-with-sed and this split-one-file-into-multiple-files-based-on-pattern sed.exe -e "^.*.<br>{0,100}/g" < original.txt > first_half.txt The split do not work an the result is only 1 file instead of many.

  Read the article

• How to Split a Big Postscript file (3000 pages) into one individual file per page (using Windows 7)?

  - by Pablo

  Hi, I'm having trouble doing the following: I have a big PDF file that I converted to postscript (for commercial printing). The resulting file is too big to be processed by the printer (machine). I've been trying to find a way to either: Convert from the original (many pages) PDF file to many Postscript file (one postcript file per PDF page in original PDF file(. Convert from PDF to PS (or even EPS). - I managed to do this Then split the PS file into a collection of smaller files. I've tried using Ghostscript, but it is all gibberish to me. Thanks. PS. If you have a good GS tutorial (for dummies?), please share the link.

  Read the article

• Some strange things in the db table of mysql database

  - by 0al0

  I noticed some weird things in the db table of mysql database in a client's server, after having the Mysql service stopping for no reason what are the test, and test_% entries? Why are there two entries for the database AQUA? Why is there a entry with a blank name? Should I worry about any of those? What should I do for each specific case? Is it safe to just delete the ones that should not be there, after backing up?

  Read the article

• Stream tar.gz file from FTP server

  - by linker

  Here is the situation: I have a tar.gz file on a FTP server which can contain an arbitrary number of files. Now what I'm trying to accomplish is have this file streamed and uploaded to HDFS through a Hadoop job. The fact that it's Hadoop is not important, in the end what I need to do is write some shell script that would take this file form ftp with wget and write the output to a stream. The reason why I really need to use streams is that there will be a large number of these files, and each file will be huge. It's fairly easy to do if I have a gzipped file and I'm doing something like this: wget -O - "ftp://${user}:${pass}@${host}/$file" | zcat But I'm not even sure if this is possible for a tar.gz file, especially since there are mutliple files in the archive. I'm a bit confused on what direction to take for this, any help would be greatly appreciated.

  Read the article

• Recover partition table after DD command

  - by Shreedhar

  I executed the following command from a Ubuntu live cd terminal (dont ask why). dd if=/dev/zero of=/dev/sdb2 bs=512 count=1 Where sdb2 is a NTFS partition (third partition) on a disk. Suffice to say it is now messed up. When I boot into windows 7, it does show me E drive but when I click on it it asks me to format it. I am not ever sure what I did, did I mess up partition table or only the MFT? Is there any way to get the data back PLEASE HELP! this is very important :(

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Network Table assistance

  - by mitchnufc

  I am designing a small network and have came up with the following table I am just wondering if this seems right, would appreciate some feedback, thanks. Network/Router First IP Last IP Subnet Host Broadcast Router 1 162.10.0.1 162.10.0.7 255.255.255.248 162.10.0.0 162.10.0.8 Network 1 162.10.1.1 162.10.2.253 255.255.254.0 162.10.1.0 162.10.2.254 Network 2 162.10.0.9 162.10.0.14 255.255.255.248 162.10.0.8 162.10.0.15 Router 2 162.10.0.17 162.10.0.18 255.255.255.252 162.10.0.16 162.10.0.19 Network 3 162.10.0.21 162.10.0.146 255.255.255.128 162.10.0.20 162.10.0.147 Router one is the IP assigned by the ISP

  Read the article

• SQL SERVER – Weekly Series – Memory Lane – #032

  - by Pinal Dave

  Here is the list of selected articles of SQLAuthority.com across all these years. Instead of just listing all the articles I have selected a few of my most favorite articles and have listed them here with additional notes below it. Let me know which one of the following is your favorite article from memory lane. 2007 Complete Series of Database Coding Standards and Guidelines SQL SERVER Database Coding Standards and Guidelines – Introduction SQL SERVER – Database Coding Standards and Guidelines – Part 1 SQL SERVER – Database Coding Standards and Guidelines – Part 2 SQL SERVER Database Coding Standards and Guidelines Complete List Download Explanation and Example – SELF JOIN When all of the data you require is contained within a single table, but data needed to extract is related to each other in the table itself. Examples of this type of data relate to Employee information, where the table may have both an Employee’s ID number for each record and also a field that displays the ID number of an Employee’s supervisor or manager. To retrieve the data tables are required to relate/join to itself. Insert Multiple Records Using One Insert Statement – Use of UNION ALL This is very interesting question I have received from new developer. How can I insert multiple values in table using only one insert? Now this is interesting question. When there are multiple records are to be inserted in the table following is the common way using T-SQL. Function to Display Current Week Date and Day – Weekly Calendar Straight blog post with script to find current week date and day based on the parameters passed in the function.  2008 In my beginning years, I have almost same confusion as many of the developer had in their earlier years. Here are two of the interesting question which I have attempted to answer in my early year. Even if you are experienced developer may be you will still like to read following two questions: Order Of Column In Index Order of Conditions in WHERE Clauses Example of DISTINCT in Aggregate Functions Have you ever used DISTINCT with the Aggregation Function? Here is a simple example about how users can do it. Create a Comma Delimited List Using SELECT Clause From Table Column Straight to script example where I explained how to do something easy and quickly. Compound Assignment Operators SQL SERVER 2008 has introduced new concept of Compound Assignment Operators. Compound Assignment Operators are available in many other programming languages for quite some time. Compound Assignment Operators is operator where variables are operated upon and assigned on the same line. PIVOT and UNPIVOT Table Examples Here is a very interesting question – the answer to the question can be YES or NO both. “If we PIVOT any table and UNPIVOT that table do we get our original table?” Read the blog post to get the explanation of the question above. 2009 What is Interim Table – Simple Definition of Interim Table The interim table is a table that is generated by joining two tables and not the final result table. In other words, when two tables are joined they create an interim table as resultset but the resultset is not final yet. It may be possible that more tables are about to join on the interim table, and more operations are still to be applied on that table (e.g. Order By, Having etc). Besides, it may be possible that there is no interim table; sometimes final table is what is generated when the query is run. 2010 Stored Procedure and Transactions If Stored Procedure is transactional then, it should roll back complete transactions when it encounters any errors. Well, that does not happen in this case, which proves that Stored Procedure does not only provide just the transactional feature to a batch of T-SQL. Generate Database Script for SQL Azure When talking about SQL Azure the most common complaint I hear is that the script generated from stand-along SQL Server database is not compatible with SQL Azure. This was true for some time for sure but not any more. If you have SQL Server 2008 R2 installed you can follow the guideline below to generate a script which is compatible with SQL Azure. Convert IN to EXISTS – Performance Talk It is NOT necessary that every time when IN is replaced by EXISTS it gives better performance. However, in our case listed above it does for sure give better performance. You can read about this subject in the associated blog post. Subquery or Join – Various Options – SQL Server Engine Knows the Best Every single time whenever there is a performance tuning exercise, I hear the conversation from developer where some prefer subquery and some prefer join. In this two part blog post, I explain the same in the detail with examples. Part 1 | Part 2 Merge Operations – Insert, Update, Delete in Single Execution MERGE is a new feature that provides an efficient way to do multiple DML operations. In earlier versions of SQL Server, we had to write separate statements to INSERT, UPDATE, or DELETE data based on certain conditions; however, at present, by using the MERGE statement, we can include the logic of such data changes in one statement that even checks when the data is matched and then just update it, and similarly, when the data is unmatched, it is inserted. 2011 Puzzle – Statistics are not updated but are Created Once Here is the quick scenario about my setup. Create Table Insert 1000 Records Check the Statistics Now insert 10 times more 10,000 indexes Check the Statistics – it will be NOT updated – WHY? Question to You – When to use Function and When to use Stored Procedure Personally, I believe that they are both different things - they cannot be compared. I can say, it will be like comparing apples and oranges. Each has its own unique use. However, they can be used interchangeably at many times and in real life (i.e., production environment). I have personally seen both of these being used interchangeably many times. This is the precise reason for asking this question. 2012 In year 2012 I had two interesting series ran on the blog. If there is no fun in learning, the learning becomes a burden. For the same reason, I had decided to build a three part quiz around SEQUENCE. The quiz was to identify the next value of the sequence. I encourage all of you to take part in this fun quiz. Guess the Next Value – Puzzle 1 Guess the Next Value – Puzzle 2 Guess the Next Value – Puzzle 3 Guess the Next Value – Puzzle 4 Simple Example to Configure Resource Governor – Introduction to Resource Governor Resource Governor is a feature which can manage SQL Server Workload and System Resource Consumption. We can limit the amount of CPU and memory consumption by limiting /governing /throttling on the SQL Server. If there are different workloads running on SQL Server and each of the workload needs different resources or when workloads are competing for resources with each other and affecting the performance of the whole server resource governor is a very important task. Tricks to Replace SELECT * with Column Names – SQL in Sixty Seconds #017 – Video  Retrieves unnecessary columns and increases network traffic When a new columns are added views needs to be refreshed manually Leads to usage of sub-optimal execution plan Uses clustered index in most of the cases instead of using optimal index It is difficult to debug SQL SERVER – Load Generator – Free Tool From CodePlex The best part of this SQL Server Load Generator is that users can run multiple simultaneous queries again SQL Server using different login account and different application name. The interface of the tool is extremely easy to use and very intuitive as well. A Puzzle – Swap Value of Column Without Case Statement Let us assume there is a single column in the table called Gender. The challenge is to write a single update statement which will flip or swap the value in the column. For example if the value in the gender column is ‘male’ swap it with ‘female’ and if the value is ‘female’ swap it with ‘male’. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Memory Lane, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

  Read the article

• SQL SERVER – SHRINKFILE and TRUNCATE Log File in SQL Server 2008

  - by pinaldave

  Note: Please read the complete post before taking any actions. This blog post would discuss SHRINKFILE and TRUNCATE Log File. The script mentioned in the email received from reader contains the following questionable code: “Hi Pinal, If you could remember, I and my manager met you at TechEd in Bangalore. We just upgraded to SQL Server 2008. One of our jobs failed as it was using the following code. The error was: Msg 155, Level 15, State 1, Line 1 ‘TRUNCATE_ONLY’ is not a recognized BACKUP option. The code was: DBCC SHRINKFILE(TestDBLog, 1) BACKUP LOG TestDB WITH TRUNCATE_ONLY DBCC SHRINKFILE(TestDBLog, 1) GO I have modified that code to subsequent code and it works fine. But, are there other suggestions you have at the moment? USE [master] GO ALTER DATABASE [TestDb] SET RECOVERY SIMPLE WITH NO_WAIT DBCC SHRINKFILE(TestDbLog, 1) ALTER DATABASE [TestDb] SET RECOVERY FULL WITH NO_WAIT GO Configuration of our server and system is as follows: [Removed not relevant data]“ An email like this that suddenly pops out in early morning is alarming email. Because I am a dead, busy mind, so I had only one min to reply. I wrote down quickly the following note. (As I said, it was a single-minute email so it is not completely accurate). Here is that quick email shared with all of you. “Hi Mr. DBA [removed the name] Thanks for your email. I suggest you stop this practice. There are many issues included here, but I would list two major issues: 1) From the setting database to simple recovery, shrinking the file and once again setting in full recovery, you are in fact losing your valuable log data and will be not able to restore point in time. Not only that, you will also not able to use subsequent log files. 2) Shrinking file or database adds fragmentation. There are a lot of things you can do. First, start taking proper log backup using following command instead of truncating them and losing them frequently. BACKUP LOG [TestDb] TO  DISK = N'C:\Backup\TestDb.bak' GO Remove the code of SHRINKING the file. If you are taking proper log backups, your log file usually (again usually, special cases are excluded) do not grow very big. There are so many things to add here, but you can call me on my [phone number]. Before you call me, I suggest for accuracy you read Paul Randel‘s two posts here and here and Brent Ozar‘s Post here. Kind Regards, Pinal Dave” I guess this post is very much clear to you. Please leave your comments here. As mentioned, this is a very huge subject; I have just touched a tip of the ice-berg and have tried to point to authentic knowledge. Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, SQL, SQL Authority, SQL Backup and Restore, SQL Data Storage, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, T SQL, Technology

  Read the article

• SQL SERVER – master Database Log File Grew Too Big

  - by pinaldave

  Couple of the days ago, I received following email and I find this email very interesting and I feel like sharing with all of you. Note: Please read the whole email before providing your suggestions. “Hi Pinal, If you can share these details on your blog, it will help many. We understand the value of the master database and we take its regular back up (everyday midnight). Yesterday we noticed that our master database log file has grown very large. This is very first time that we have encountered such an issue. The master database is in simple recovery mode; so we assumed that it will never grow big; however, we now have a big log file. We ran the following command USE [master] GO DBCC SHRINKFILE (N'mastlog' , 0, TRUNCATEONLY) GO We know this command will break the chains of LSN but as per our understanding; it should not matter as we are in simple recovery model.     After running this, the log file becomes very small. Just to be cautious, we took full backup of the master database right away. We totally understand that this is not the normal practice; so if you are going to tell us the same, we are aware of it. However, here is the question for you? What operation in master database would have caused our log file to grow too large? Thanks, [name and company name removed as per request]“ Here was my response to them: “Hi [name removed], It is great that you are aware of all the right steps and method. Taking full backup when you are not sure is always a good practice. Regarding your question what could have caused your master database log to grow larger, let me try to guess what could have happened. Do you have any user table in the master database? If yes, this is not recommended and also NOT a good practice. If have user tables in master database and you are doing any long operation (may be lots of insert, update, delete or rebuilding them), then it can cause this situation. You have made me curious about your scenario; do revert back. Kind Regards, Pinal” Within few minutes I received reply: “That was it Pinal. We had one of the maintenance task log tables created in the master table, which had many long transactions during the night. We moved it to newly created database named ‘maintenance’, and we will keep you updated.” I was very glad to receive the email. I do not suggest that any user table should be created in the master database. It should be left alone from user objects. Now here is the question for you – can you think of any other reason for master log file growth? Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, PostADay, SQL, SQL Authority, SQL Backup and Restore, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, T SQL, Technology

  Read the article

• Extract Audio from a Video File with Pazera Free Audio Extractor

  - by DigitalGeekery

  Have you ever wanted to extract some or all of the audio from a video file?  Today we’ll take a look at Pazera Free Audio Extractor. A simple audio converter that specializes in that very task. Download the Pazera Free Audio Extractor. (See download link below) You’ll need to unzip the download folder, but there is no need to install the application. Simply double-click the AudioExtractor.exe file to run the application. To add your video files to the queue to be converted, click on the Add files  button at the top left. You can add multiple files to the queue and convert them all at one time. Browse for your video file, and click Open.   Your video will be added to the Queue for processing.   Under Output directory you can choose to output to a folder of your choice. Outputting to the same folder as the input folder is the default.   Pazera Free Audio Extractor includes pre-configured profiles that will simplify the process of choosing conversion settings. To load a profile, choose one from the Profile drop down list and then click the Load button. You can choose to output to MP3, AAC, AC3, WMA, FLAC, OGG or WAV file format.   You will see the profile update the Audio settings in the panels at the lower left of the application. If you wish, you may also select your own custom settings. Advanced Settings The Advanced settings can be used if you want to extract only a portion of the the audio, such as a clip of dialog or a song from a movie. To extract only a portion of the audio, set the start time by selecting the Start time offset check box, then entering the time in the video clip where the audio begins. To set the end time, begin by selecting the Duration check box. Now, you can either select the Duration radio button and enter the amount of time for which you would like to extract the audio, or you can select the End time offset radio button and enter the time in the video clip where the audio ends. When you are ready to convert, click the CONVERT button on the menu at the top of the screen.   An output box will open and display the conversion progress. When finished, click Close.   Now you are ready to enjoy your audio clip. Pazera Free Audio Extractor is a basic audio tool that is easy enough for everyone to use. It runs on Windows only and supports most common video formats including AVI, FLV, MP4, MPG, MOV, 3GP, and WMV. Download Free Audio Extractor 1.3 Similar Articles Productive Geek Tips Eufony Free Audio Player – Resource Gentle Audio PlayerConvert .3GP and .3G2 Files to AVI / MPEG for FreeTurn Off Auto-Play of Audio and Video CDs and DVDs in UbuntuHow to Make/Edit a movie with Windows Movie Maker in Windows VistaEasily Change Audio File Formats with XRECODE TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 Use Printflush to Solve Printing Problems Icelandic Volcano Webcams Open Multiple Links At One Go NachoFoto Searches Images in Real-time Office 2010 Product Guides Google Maps Place marks – Pizza, Guns or Strip Clubs

  Read the article

• perl comparing 2 data file as array 2D for finding match one to one [migrated]

  - by roman serpa

  I'm doing a program that uses combinations of variables ( combiData.txt 63 rows x different number of columns) for analysing a data table ( j1j2_1.csv, 1000filas x 19 columns ) , to choose how many times each combination is repeated in data table and which rows come from (for instance, tableData[row][4]). I have tried to compile it , however I get the following message : Use of uninitialized value $val in numeric eq (==) at rowInData.pl line 34. Use of reference "ARRAY(0x1a2eae4)" as array index at rowInData.pl line 56. Use of reference "ARRAY(0x1a1334c)" as array index at rowInData.pl line 56. Use of uninitialized value in subtraction (-) at rowInData.pl line 56. Modification of non-creatable array value attempted, subscript -1 at rowInData.pl line 56. nothing This is my code: #!/usr/bin/perl use strict; use warnings; my $line_match; my $countTrue; open (FILE1, "<combiData.txt") or die "can't open file text1.txt\n"; my @tableCombi; while(<FILE1>) { my @row = split(' ', $_); push(@tableCombi, \@row); } close FILE1 || die $!; open (FILE2, "<j1j2_1.csv") or die "can't open file text1.txt\n"; my @tableData; while(<FILE2>) { my @row2 = split(/\s*,\s*/, $_); push(@tableData, \@row2); } close FILE2 || die $!; #function transform combiData.txt variable (position ) to the real value that i have to find in the data table. sub trueVal($){ my ($val) = $_[0]; if($val == 7){ return ('nonsynonymous_SNV'); } elsif( $val == 14) { return '1'; } elsif( $val == 15) { return '1';} elsif( $val == 16) { return '1'; } elsif( $val == 17) { return '1'; } elsif( $val == 18) { return '1';} elsif( $val == 19) { return '1';} else { print 'nothing'; } } #function IntToStr ( ) , i'm not sure if it is necessary) that transforms $ to strings , to use the function <eq> in the third loop for the array of combinations compared with the data array . sub IntToStr { return "$_[0]"; } for my $combi (@tableCombi) { $line_match = 0; for my $sheetData (@tableData) { $countTrue=0; for my $cell ( @$combi) { #my $temp =\$tableCombi[$combi][$cell] ; #if ( trueVal($tableCombi[$combi][$cell] ) eq $tableData[$sheetData][ $tableCombi[$combi][$cell] - 1 ] ){ #if ( IntToStr(trueVal($$temp )) eq IntToStr( $tableData[$sheetData][ $$temp-1] ) ){ if ( IntToStr(trueVal($tableCombi[$combi][$cell]) ) eq IntToStr($tableData[$sheetData][ $tableCombi[$combi][$cell] -1]) ){ $countTrue++;} if ($countTrue==@$combi){ $line_match++; #if ($line_match < 50){ print $tableData[$sheetData][4]." "; #} } } } print $line_match." \n"; }

  Read the article

• Open a File Browser From Your Current Command Prompt/Terminal Directory

  - by The Geek

  Ever been doing some work at the command line when you realized… it would be a lot easier if I could just use the mouse for this task? One command later, you’ll have a window open to the same place that you’re at. This same tip works in more than one operating system, so we’ll detail how to do it in every way we know how. Open a File Browser in Windows We’ve actually covered this before when we told you how to open an Explorer window from the command prompt’s current directory, but we’ll briefly review: Just type the follow command into your command prompt: explorer . Note: You could actually just type “start .” instead. And you’ll then see a file browsing window set to the same directory you were previous at. And yes, this screenshot is from Vista, but it works the same in every version of Windows. If that wasn’t good enough, you should really read how you can navigate in the File Open/Save dialogs with just the keyboard—now that’s a Stupid Geek Trick! Open a File Browser in Linux For this exercise, we’re going to assume that you’re using Gnome under a Linux flavor like Ubuntu, because that’s the most common. From your terminal window, just type in the following command: nautilus . And the next thing you know, you’ll have a file browser window open at the current location. You’ll see some type of error message at the prompt, but you can pretty much ignore that. You can also use “gnome-open .” if you want. Open Finder in Mac OS X All the Mac computers in this office are running Linux, so we haven’t had a chance to verify, but you should be able to use the following command on OS X to open Finder in the current terminal location: open . Open Dolphin on Linux KDE4 dolphin . Got any extra tips to help out your fellow readers? How do you do the same thing in KDE3? What about OS X? Leave your savvy advice in the comments, and maybe we’ll update the article. Or not. Either way, it’ll help somebody! Similar Articles Productive Geek Tips Keyboard Ninja: Concatenate Multiple Text Files in WindowsStupid Geek Tricks: Open an Explorer Window from the Command Prompt’s Current DirectoryHow to automate FTP uploads from the Windows Command LineShell Geek: Rename Multiple Files At OnceAdd "Open with gedit" to the right click menu in Ubuntu TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips DVDFab 6 Revo Uninstaller Pro Registry Mechanic 9 for Windows PC Tools Internet Security Suite 2010 Home Networks – How do they look like & the problems they cause Check Your IMAP Mail Offline In Thunderbird Follow Finder Finds You Twitter Users To Follow Combine MP3 Files Easily QuicklyCode Provides Cheatsheets & Other Programming Stuff Download Free MP3s from Amazon

  Read the article

• Solving File Upload Cancel Issue

  - by Frank Nimphius

  In Oracle JDeveloper 11g R1 (I did not test 11g R2) the file upload component is submitted even if users click a cancel button with immediate="true" set. Usually, immediate="true" on a command button by-passes all modle updates, which would make you think that the file upload isn't processed either. However, using a form like shown below, pressing the cancel button has no effect in that the file upload is not suppressed. <af:form id="f1" usesUpload="true">        <af:inputFile label="Choose file" id="fileup" clientComponent="true"                 value="#{FileUploadBean.file}"  valueChangeListener="#{FileUploadBean.onFileUpload}">   </af:inputFile>   <af:commandButton text="Submit" id="cb1" partialSubmit="true"                     action="#{FileUploadBean.onInputFormSubmit}"/>   <af:commandButton text="cancel" id="cb2" immediate="true"/> </af:form> The solution to this problem is a change of the event root, which you can achieve either by setting i) partialSubmit="true" on the command button, or by surrounding the form parts that should not be submitted when the cancel button is pressed with an ii) af:subform tag. i) partialSubmit solution <af:form id="f1" usesUpload="true">      <af:inputFile .../>   <af:commandButton text="Submit" .../>   <af:commandButton text="cancel" immediate="true" partialSubmit="true" .../> </af:form> ii) subform solution <af:form id="f1" usesUpload="true">   <af:subform id="sf1">     <af:inputFile ... />     <af:commandButton text="Submit" ..."/>   </af:subform>   <af:commandButton text="cancel" immediate="true" .../> </af:form> Note that the af:subform surrounds the input form parts that you want to submit when the submit button is pressed. By default, the af:subform only submits its contained content if the submit issued from within.

  Read the article

• Bind DropDownList with Hierarchy from MSSQL Table with ASP.NET C#

  - by Gal V

  Hello all, I have the following sql table which contains menu (website menu) data. Table Name: MenuItems Columns: Id, MenuId, ParentMenuItemId, Text. My goal is to bind a DDL according to the following hierarchy (example): Id: 1, MenuId: 1, ParentMenuItemId: -1, Text: 'One' Id: 2, MenuId: 1, ParentMenuItemId: 1, Text: 'Two' Id: 3, MenuId: 1, ParentMenuItemId: 1, Text: 'Three' Id: 4, MenuId: 1, ParentMenuItemId: 2, Text: 'Four' Id: 5, MenuId: 1, ParentMenuItemId: 4, Text: 'Five' Requested result in DDL: One -- Two ---- Four ------ Five -- Three I think it should contain 'WITH' SQL command. Thanks all!

  Read the article

• Silverlight: After adding table no datacontext classes are available for the new DomainService class

  - by Gabriel

  I'm using a Silverlight 4 WCF RIA Services demo application that uses LinqToSql, that works well. I add a new database table, move the new table to the LinqToSql designer and build the project I add a new DomainService class I get a dialog with the only option to create an empty DomainService and no DataContext classes are available. What am I missed? Thanks in advance Gabriel

  Read the article

• Fluent Nhibernate - Mapping two entities to same table

  - by Andy

  Hi, I'm trying to map two domain entities to the same table. We're doing a smart entity for our domain model, so we have the concept of an Editable Address and a readonly Address. I have both mapped using Classmaps, and everything seems to go fine until we try to export the schema using the SchemaExport class from NHibernate. It errors out saying the table already exists. I assume it's something simple that I'm just not seeing. Any ideas? Thanks

  Read the article

< Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >