Search Results

Search found 483 results on 20 pages for 'appending'.

Page 19/20 | < Previous Page | 15 16 17 18 19 20  | Next Page >

  • qwebview in pyside after packaged with pyinstaller goes wrong

    - by truease.com
    Here's my code import sys from PySide.QtCore import * from PySide.QtGui import * from PySide.QtWebKit import * from encodings import * from codecs import * class BrowserWindow( QWidget ): def __init__( self, parent=None ): QWidget.__init__( self, parent ) self.Setup() self.SetupEvent() def Setup( self ): self.setWindowTitle( u"Truease Speedy Browser" ) self.addr_input = QLineEdit() self.addr_go = QPushButton( "GO" ) self.addr_bar = QHBoxLayout() self.addr_bar.addWidget( self.addr_input ) self.addr_bar.addWidget( self.addr_go ) for attr in [ QWebSettings.AutoLoadImages, QWebSettings.JavascriptEnabled, QWebSettings.JavaEnabled, QWebSettings.PluginsEnabled, QWebSettings.JavascriptCanOpenWindows, QWebSettings.JavascriptCanAccessClipboard, QWebSettings.DeveloperExtrasEnabled, QWebSettings.SpatialNavigationEnabled, QWebSettings.OfflineStorageDatabaseEnabled, QWebSettings.OfflineWebApplicationCacheEnabled, QWebSettings.LocalStorageEnabled, QWebSettings.LocalStorageDatabaseEnabled, QWebSettings.LocalContentCanAccessRemoteUrls, QWebSettings.LocalContentCanAccessFileUrls, ]: QWebSettings.globalSettings().setAttribute( attr, True ) self.web_view = QWebView() self.web_view.load( "http://www.baidu.com" ) layout = QVBoxLayout() layout.addLayout( self.addr_bar ) layout.addWidget( self.web_view ) self.setLayout( layout ) def SetupEvent( self ): self.connect( self.addr_input, SIGNAL("editingFinished()"), self, SLOT("Load()"), ) self.connect( self.addr_go, SIGNAL("pressed()"), self, SLOT("Load()") ) self.connect( self.web_view, SIGNAL("urlChanged(const QUrl&)"), self, SLOT("SetURL()"), ) def Load( self, *args, **kwargs ): url = self.GetCleanedURL() if url != self.CurrentURL(): self.web_view.load( url ) def SetURL( self, *args, **kwargs ): self.addr_input.setText( self.CurrentURL() ) def GetCleanedURL( self ): url = self.addr_input.text().strip() if not url.startswith("http"): url = "http://" + url return url def CurrentURL( self ): url = self.web_view.url().toString() return url def Main(): app = QApplication( sys.argv ) widget = BrowserWindow() widget.show() return app.exec_() if __name__ == '__main__': sys.exit( Main() ) I works well when i using python browser.py. but it goes wrong after packaged with pyinstaller -w browser.py. it doesn't load images can only display correct text in utf-8 And this is the pyinstaller output: E:\true\wuk\app2>pyinstaller -w b.py 16 INFO: wrote E:\true\wuk\app2\b.spec 16 INFO: Testing for ability to set icons, version resources... 32 INFO: ... resource update available 32 INFO: UPX is not available. 46 INFO: Processing hook hook-os 141 INFO: Processing hook hook-time 157 INFO: Processing hook hook-cPickle 218 INFO: Processing hook hook-_sre 312 INFO: Processing hook hook-cStringIO 407 INFO: Processing hook hook-encodings 421 INFO: Processing hook hook-codecs 750 INFO: Processing hook hook-httplib 750 INFO: Processing hook hook-email 843 INFO: Processing hook hook-email.message 1046 WARNING: library python%s%s required via ctypes not found 1171 INFO: Extending PYTHONPATH with E:\true\wuk\app2 1171 INFO: checking Analysis 1171 INFO: building because b.py changed 1171 INFO: running Analysis out00-Analysis.toc 1171 INFO: Adding Microsoft.VC90.CRT to dependent assemblies of final executable 1171 INFO: Searching for assembly x86_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_x-ww ... 1171 INFO: Found manifest C:\WINDOWS\WinSxS\Manifests\x86_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_x-ww_d08d0375.manifest 1187 INFO: Searching for file msvcr90.dll 1187 INFO: Found file C:\WINDOWS\WinSxS\x86_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_x-ww_d08d0375\msvcr90.dll 1187 INFO: Searching for file msvcp90.dll 1187 INFO: Found file C:\WINDOWS\WinSxS\x86_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_x-ww_d08d0375\msvcp90.dll 1187 INFO: Searching for file msvcm90.dll 1187 INFO: Found file C:\WINDOWS\WinSxS\x86_Microsoft.VC90.CRT_1fc8b3b9a1e18e3b_9.0.21022.8_x-ww_d08d0375\msvcm90.dll 1266 INFO: Analyzing D:\Applications\Python\lib\site-packages\pyinstaller-2.1-py2.7.egg\PyInstaller\loader\_pyi_bootstrap.py 1266 INFO: Processing hook hook-os 1282 INFO: Processing hook hook-site 1296 INFO: Processing hook hook-encodings 1391 INFO: Processing hook hook-time 1407 INFO: Processing hook hook-cPickle 1468 INFO: Processing hook hook-_sre 1578 INFO: Processing hook hook-cStringIO 1671 INFO: Processing hook hook-codecs 2016 INFO: Processing hook hook-httplib 2016 INFO: Processing hook hook-email 2109 INFO: Processing hook hook-email.message 2312 WARNING: library python%s%s required via ctypes not found 2468 INFO: Processing hook hook-pydoc 2516 INFO: Analyzing D:\Applications\Python\lib\site-packages\pyinstaller-2.1-py2.7.egg\PyInstaller\loader\pyi_importers.py 2609 INFO: Analyzing D:\Applications\Python\lib\site-packages\pyinstaller-2.1-py2.7.egg\PyInstaller\loader\pyi_archive.py 2687 INFO: Analyzing D:\Applications\Python\lib\site-packages\pyinstaller-2.1-py2.7.egg\PyInstaller\loader\pyi_carchive.py 2782 INFO: Analyzing D:\Applications\Python\lib\site-packages\pyinstaller-2.1-py2.7.egg\PyInstaller\loader\pyi_os_path.py 2782 INFO: Analyzing b.py 2796 INFO: Processing hook hook-PySide 2875 INFO: Hidden import 'codecs' has been found otherwise 2875 INFO: Hidden import 'encodings' has been found otherwise 2875 INFO: Looking for run-time hooks 7766 INFO: Using Python library C:\WINDOWS\system32\python27.dll 7796 INFO: E:\true\wuk\app2\build\b\out00-Analysis.toc no change! 7796 INFO: checking PYZ 7812 INFO: checking PKG 7812 INFO: building because E:\true\wuk\app2\build\b\b.exe.manifest changed 7812 INFO: building PKG (CArchive) out00-PKG.pkg 7828 INFO: checking EXE 7843 INFO: rebuilding out00-EXE.toc because pkg is more recent 7843 INFO: building EXE from out00-EXE.toc 7843 INFO: Appending archive to EXE E:\true\wuk\app2\build\b\b.exe 7843 INFO: checking COLLECT 7843 INFO: building COLLECT out00-COLLECT.toc Use pyinstaller browser.py, and in the console window i got QFont::setPixelSize: Pixel size <= 0 (0) QSslSocket: cannot call unresolved function SSLv23_client_method QSslSocket: cannot call unresolved function SSL_CTX_new QSslSocket: cannot call unresolved function SSL_library_init QSslSocket: cannot call unresolved function ERR_get_error QSslSocket: cannot call unresolved function SSLv23_client_method QSslSocket: cannot call unresolved function SSL_CTX_new QSslSocket: cannot call unresolved function SSL_library_init QSslSocket: cannot call unresolved function ERR_get_error QSslSocket: cannot call unresolved function SSLv23_client_method QSslSocket: cannot call unresolved function SSL_CTX_new QSslSocket: cannot call unresolved function SSL_library_init QSslSocket: cannot call unresolved function ERR_get_error QSslSocket: cannot call unresolved function SSLv23_client_method QSslSocket: cannot call unresolved function SSL_CTX_new QSslSocket: cannot call unresolved function SSL_library_init QSslSocket: cannot call unresolved function ERR_get_error QFont::setPixelSize: Pixel size <= 0 (0)

    Read the article

  • C++ custom exceptions: run time performance and passing exceptions from C++ to C

    - by skyeagle
    I am writing a custom C++ exception class (so I can pass exceptions occuring in C++ to another language via a C API). My initial plan of attack was to proceed as follows: //C++ myClass { public: myClass(); ~myClass(); void foo() // throws myException int foo(const int i, const bool b) // throws myException } * myClassPtr; // C API #ifdef __cplusplus extern "C" { #endif myClassPtr MyClass_New(); void MyClass_Destroy(myClassPtr p); void MyClass_Foo(myClassPtr p); int MyClass_FooBar(myClassPtr p, int i, bool b); #ifdef __cplusplus }; #endif I need a way to be able to pass exceptions thrown in the C++ code to the C side. The information I want to pass to the C side is the following: (a). What (b). Where (c). Simple Stack Trace (just the sequence of error messages in order they occured, no debugging info etc) I want to modify my C API, so that the API functions take a pointer to a struct ExceptionInfo, which will contain any exception info (if an exception occured) before consuming the results of the invocation. This raises two questions: Question 1 1. Implementation of each of the C++ methods exposed in the C API needs to be enclosed in a try/catch statement. The performance implications for this seem quite serious (according to this article): "It is a mistake (with high runtime cost) to use C++ exception handling for events that occur frequently, or for events that are handled near the point of detection." At the same time, I remember reading somewhere in my C++ days, that all though exception handling is expensive, it only becmes expensive when an exception actually occurs. So, which is correct?. what to do?. Is there an alternative way that I can trap errors safely and pass the resulting error info to the C API?. Or is this a minor consideration (the article after all, is quite old, and hardware have improved a bit since then). Question 2 I wuld like to modify the exception class given in that article, so that it contains a simple stack trace, and I need some help doing that. Again, in order to make the exception class 'lightweight', I think its a good idea not to include any STL classes, like string or vector (good idea/bad idea?). Which potentially leaves me with a fixed length C string (char*) which will be stack allocated. So I can maybe just keep appending messages (delimted by a unique separator [up to maximum length of buffer])... Its been a while since I did any serious C++ coding, and I will be grateful for the help. BTW, this is what I have come up with so far (I am intentionally, not deriving from std::exception because of the performance reasons mentioned in the article, and I am instead, throwing an integral exception (based on an exception enumeration): class fast_exception { public: fast_exception(int what, char const* file=0, int line=0) : what_(what), line_(line), file_(file) {/*empty*/} int what() const { return what_; } int line() const { return line_; } char const* file() const { return file_; } private: int what_; int line_; char const[MAX_BUFFER_SIZE] file_; }

    Read the article

  • Audio Recording with Appcelerator on Android

    - by user951793
    I would like to record audio and then send the file to a webserver. I am using Titanium 1.8.2 on Win7. The application I am woring on is both for Android and iphone and I do realise that Titanium.Media.AudioRecorder and Titanium.Media.AudioPlayer are for these purpose. Let's concentrate on android for a while. On that platform you can achieve audio recording by creating an intent and then you handle the file in your application. See more here. This implementation has a couple of drawbacks: You cannot stay in your application (as a native audio recorder will start up) You only get back an uri from the recorder and not the actual file. Another implementation is done by Codeboxed. This module is for recording an audio without using intents. The only problem that I could not get this working (along with other people) and the codeboxed team does not respond to anyone since last year. So my question is: Do you know how to record audio on android without using an intent? Thanks in advance. Edit: My problem with codeboxed's module: I downloaded the module from here. I copied the zip file into my project directory. I edited my manifest file with: <modules> <module platform="android" version="0.1">com.codeboxed.audiorecorder</module> </modules> When I try and compile I receive the following error: [DEBUG] appending module: com.mwaysolutions.barcode.TitaniumBarcodeModule [DEBUG] module_id = com.codeboxed.audiorecorder [ERROR] The 'apiversion' for 'com.codeboxed.audiorecorder' in the module manifest is not a valid value. Please use a version of the module that has an 'apiversion' value of 2 or greater set in it's manifest file [DEBUG] touching tiapp.xml to force rebuild next time: E:\TitaniumProjects\MyProject\tiapp.xml I can manage to recognise the module by editing the module's manifest file to this: ` version: 0.1 description: My module author: Your Name license: Specify your license copyright: Copyright (c) 2011 by Your Company apiversion: 2 name: audiorecorder moduleid: com.codeboxed.audiorecorder guid: 747dce68-7d2d-426a-a527-7c67f4e9dfad platform: android minsdk: 1.7.0` But Then again I receive error on compiling: [DEBUG] "C:\Program Files\Java\jdk1.6.0_21\bin\javac.exe" -encoding utf8 -classpath "C:\Program Files (x86)\Android\android-sdk\platforms\android-8\android.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-media.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-platform.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\titanium.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\thirdparty.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\jaxen-1.1.1.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-locale.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-app.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-gesture.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-analytics.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\kroll-common.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-network.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\ti-commons-codec-1.3.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-ui.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-database.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\kroll-v8.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-xml.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\android-support-v4.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-filesystem.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\modules\titanium-android.jar;E:\TitaniumProjects\MyProject\modules\android\com.mwaysolutions.barcode\0.3\barcode.jar;E:\TitaniumProjects\MyProject\modules\android\com.mwaysolutions.barcode\0.3\lib\zxing.jar;E:\TitaniumProjects\MyProject\modules\android\com.codeboxed.audiorecorder\0.1\audiorecorder.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\kroll-apt.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\lib\titanium-verify.jar;C:\Users\Gabor\AppData\Roaming\Titanium\mobilesdk\win32\1.8.2\android\lib\titanium-debug.jar" -d E:\TitaniumProjects\MyProject\build\android\bin\classes -proc:none -sourcepath E:\TitaniumProjects\MyProject\build\android\src -sourcepath E:\TitaniumProjects\MyProject\build\android\gen @c:\users\gabor\appdata\local\temp\tmpbqmjuy [ERROR] Error(s) compiling generated Java code [ERROR] E:\TitaniumProjects\MyProject\build\android\gen\com\petosoft\myproject\MyProjectApplication.java:44: cannot find symbol symbol : class AudiorecorderBootstrap location: package com.codeboxed.audiorecorder runtime.addExternalModule("com.codeboxed.audiorecorder", com.codeboxed.audiorecorder.AudiorecorderBootstrap.class); ^ 1 error

    Read the article

  • Ivy resolve not working with dynamic artifact

    - by richever
    I've been using Ivy a bit but I seem to still have a lot to learn. I have two projects. One is a web app and the other is a library upon which the web app depends. The set up is that the library project is compiled to a jar file and published using Ivy to a directory within the project. In the web app build file, I have an ant target that calls the Ivy resolve ant task. What I'd like to do is have the web app using the dynamic resolve mode during development (on developer's local machines) and default resolve mode for test and production builds. Previously I was appending a time stamp to the library archive file so that Ivy would notice changes in file when the web app tried to resolve its dependency on it. Within Eclipse this is cumbersome because, in the web app, the project had to be refreshed and the build path tweaked every time a new library jar was published. Publishing a similarly named jar file every time would, I figure, only require developers to refresh the project. The problem is that the web app is unable to retrieve the dynamic jar file. The output I get looks something like this: resolve: [ivy:configure] :: Ivy 2.1.0 - 20090925235825 :: http://ant.apache.org/ivy/ :: [ivy:configure] :: loading settings :: file = /Users/richard/workspace/webapp/web/WEB-INF/config/ivy/ivysettings.xml [ivy:resolve] :: resolving dependencies :: com.webapp#webapp;[email protected] [ivy:resolve] confs: [default] [ivy:resolve] found com.webapp#library;latest.integration in local [ivy:resolve] :: resolution report :: resolve 142ms :: artifacts dl 0ms --------------------------------------------------------------------- | | modules || artifacts | | conf | number| search|dwnlded|evicted|| number|dwnlded| --------------------------------------------------------------------- | default | 1 | 0 | 0 | 0 || 0 | 0 | --------------------------------------------------------------------- [ivy:resolve] [ivy:resolve] :: problems summary :: [ivy:resolve] :::: WARNINGS [ivy:resolve] :::::::::::::::::::::::::::::::::::::::::::::: [ivy:resolve] :: UNRESOLVED DEPENDENCIES :: [ivy:resolve] :::::::::::::::::::::::::::::::::::::::::::::: [ivy:resolve] :: com.webapp#library;latest.integration: impossible to resolve dynamic revision [ivy:resolve] :::::::::::::::::::::::::::::::::::::::::::::: [ivy:resolve] :::: ERRORS [ivy:resolve] impossible to resolve dynamic revision for com.webapp#library;latest.integration: check your configuration and make sure revision is part of your pattern [ivy:resolve] [ivy:resolve] :: USE VERBOSE OR DEBUG MESSAGE LEVEL FOR MORE DETAILS BUILD FAILED /Users/richard/workspace/webapp/build.xml:71: impossible to resolve dependencies: resolve failed - see output for details The web app resolve target looks like this: <target name="resolve" depends="load-ivy"> <ivy:configure file="${ivy.dir}/ivysettings.xml" /> <ivy:resolve file="${ivy.dir}/ivy.xml" resolveMode="${ivy.resolve.mode}"/> <ivy:retrieve pattern="${lib.dir}/[artifact]-[revision].[ext]" type="jar" sync="true" /> </target> In this case, ivy.resolve.mode has a value of 'dynamic' (without quotes). The web app's Ivy file is simple. It looks like this: <ivy-module version="2.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="http://ant.apache.org/ivy/schemas/ivy.xsd"> <info organisation="com.webapp" module="webapp"/> <dependencies> <dependency name="library" rev="${ivy.revision.default}" revConstraint="${ivy.revision.dynamic}" /> </dependencies> </ivy-module> During development, ivy.revision.dynamic has a value of 'latest.integration'. While, during production or test, 'ivy.revision.default' has a value of '1.0'. Any ideas? Please let me know if there's any more information I need to supply. Thanks!

    Read the article

  • How can I install Perl's DBI on Mac OS X so Apache can find it?

    - by Russell C.
    I'm trying to setup a Perl development environment on my Mac laptop and have been having a really hard time getting it working. I thought I had everything configured correctly but when I try to run a sample script it is reporting errors with the DBI module and can't access the DB. Here is what is reported in the Apache error logs: [Fri Apr 30 23:11:33 2010] [error] [client 127.0.0.1] Can't locate DBI.pm in @INC (@INC contains: /Library/Perl/Updates/5.10.0/darwin-thread-multi-2level /Library/Perl/Updates/5.10.0 /System/Library/Perl/5.10.0/darwin-thread-multi-2level /System/Library/Perl/5.10.0 /Library/Perl/5.10.0/darwin-thread-multi-2level /Library/Perl/5.10.0 /Network/Library/Perl/5.10.0/darwin-thread-multi-2level /Network/Library/Perl/5.10.0 /Network/Library/Perl /System/Library/Perl/Extras/5.10.0/darwin-thread-multi-2level /System/Library/Perl/Extras/5.10.0 .) at main.pm line 5. I downloaded and installed both modules manually to work with MAMP using the following commands as specified in this forum post: For DBI 1. cd /Library/Perl/DBI-1.611 2. sudo Perl Makefile.PL 3. sudo make 4. sudo make install For DBD 1. cd /Library/Perl/DBD-mysql-4.014 2. sudo Perl Makefile.PL --mysql_config=/Applications/MAMP/Library/bin/mysql_config 3. sudo make 4. sudo make install What I noticed while running the above commands is that the files seems to be getting installed in the '/opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/' directory which doesn't seem to be one of the search directories that Apache mentions in the error at the beginning of this post. Here is what I'm seeing during the install: $ sudo make install Files found in blib/arch: installing files in blib/lib into architecture dependent library tree Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/DBI.bundle Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/dbipport.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/DBIXS.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/dbixs_rev.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/Driver.xst Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/Driver_xst.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/TASKS.pod Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBD/DBM.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBD/File.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBD/Gofer.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/Changes.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/DBD.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/Profile.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/ProxyServer.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/PurePerl.pm Installing /opt/local/share/man/man3/DBD::DBM.3pm Installing /opt/local/share/man/man3/DBD::File.3pm Installing /opt/local/share/man/man3/DBD::Gofer.3pm Installing /opt/local/share/man/man3/DBI.3pm Installing /opt/local/share/man/man3/DBI::DBD.3pm Installing /opt/local/share/man/man3/DBI::Profile.3pm Installing /opt/local/share/man/man3/DBI::ProxyServer.3pm Installing /opt/local/share/man/man3/DBI::PurePerl.3pm Installing /opt/local/share/man/man3/TASKS.3pm Installing /opt/local/bin/dbiprof Installing /opt/local/bin/dbiproxy Writing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/.packlist Appending installation info to /opt/local/lib/perl5/5.8.9/darwin-2level/perllocal.pod My question is, what am I doing wrong and how can I either 1) Get Apache to look in the right directory where the DBD & DBI modules are installed or 2) Update the way I'm installing the module to install them into one of the search directories. I honestly don't know what option makes more sense and could use guidance on that as well. As you can probably tell I'm pretty lost at the moment. Please help!!! Thanks in advance.

    Read the article

  • Installed Perl DBI Module Can't Be Found

    - by Russell C.
    I'm trying to setup a Perl development environment on my Mac laptop and have been having a really hard time getting it working. I thought I had everything configured correctly but when I try to run a sample script it is reporting errors with the DBI module and can't access the DB. Here is what is reported in the Apache error logs: [Fri Apr 30 23:11:33 2010] [error] [client 127.0.0.1] Can't locate DBI.pm in @INC (@INC contains: /Library/Perl/Updates/5.10.0/darwin-thread-multi-2level /Library/Perl/Updates/5.10.0 /System/Library/Perl/5.10.0/darwin-thread-multi-2level /System/Library/Perl/5.10.0 /Library/Perl/5.10.0/darwin-thread-multi-2level /Library/Perl/5.10.0 /Network/Library/Perl/5.10.0/darwin-thread-multi-2level /Network/Library/Perl/5.10.0 /Network/Library/Perl /System/Library/Perl/Extras/5.10.0/darwin-thread-multi-2level /System/Library/Perl/Extras/5.10.0 .) at main.pm line 5. I downloaded and installed both modules manually to work with MAMP using the following commands as specified in this forum post: For DBI 1. cd /Library/Perl/DBI-1.611 2. sudo Perl Makefile.PL 3. sudo make 4. sudo make install For DBD 1. cd /Library/Perl/DBD-mysql-4.014 2. sudo Perl Makefile.PL --mysql_config=/Applications/MAMP/Library/bin/mysql_config 3. sudo make 4. sudo make install What I noticed while running the above commands is that the files seems to be getting installed in the '/opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/' directory which doesn't seem to be one of the search directories that Apache mentions in the error at the beginning of this post. Here is what I'm seeing during the install: $ sudo make install Files found in blib/arch: installing files in blib/lib into architecture dependent library tree Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/DBI.bundle Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/dbipport.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/DBIXS.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/dbixs_rev.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/Driver.xst Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/Driver_xst.h Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/TASKS.pod Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBD/DBM.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBD/File.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBD/Gofer.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/Changes.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/DBD.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/Profile.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/ProxyServer.pm Installing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/DBI/PurePerl.pm Installing /opt/local/share/man/man3/DBD::DBM.3pm Installing /opt/local/share/man/man3/DBD::File.3pm Installing /opt/local/share/man/man3/DBD::Gofer.3pm Installing /opt/local/share/man/man3/DBI.3pm Installing /opt/local/share/man/man3/DBI::DBD.3pm Installing /opt/local/share/man/man3/DBI::Profile.3pm Installing /opt/local/share/man/man3/DBI::ProxyServer.3pm Installing /opt/local/share/man/man3/DBI::PurePerl.3pm Installing /opt/local/share/man/man3/TASKS.3pm Installing /opt/local/bin/dbiprof Installing /opt/local/bin/dbiproxy Writing /opt/local/lib/perl5/site_perl/5.8.9/darwin-2level/auto/DBI/.packlist Appending installation info to /opt/local/lib/perl5/5.8.9/darwin-2level/perllocal.pod My question is, what am I doing wrong and how can I either 1) Get Apache to look in the right directory where the DBD & DBI modules are installed or 2) Update the way I'm installing the module to install them into one of the search directories. I honestly don't know what option makes more sense and could use guidance on that as well. As you can probably tell I'm pretty lost at the moment. Please help!!!

    Read the article

  • Extending XHTML

    - by Daniel Schaffer
    I'm playing around with writing a jQuery plugin that uses an attribute to define form validation behavior (yes, I'm aware there's already a validation plugin; this is as much a learning exercise as something I'll be using). Ideally, I'd like to have something like this: Example 1 - input: <input id="name" type="text" v:onvalidate="return this.value.length > 0;" /> Example 2 - wrapper: <div v:onvalidate="return $(this).find('[value]').length > 0;"> <input id="field1" type="text" /> <input id="field2" type="text" /> <input id="field3" type="text" /> </div> Example 3 - predefined: <input id="name" type="text" v:validation="not empty" /> The goal here is to allow my jQuery code to figure out which elements need to be validated (this is already done) and still have the markup be valid XHTML, which is what I'm having a problem with. I'm fairly sure this will require a combination of both DTD and XML Schema, but I'm not really quite sure how exactly to execute. Based on this article, I've created the following DTD: <!ENTITY % XHTML1-formvalidation1 PUBLIC "-//W3C//DTD XHTML 1.1 +FormValidation 1.0//EN" "http://new.dandoes.net/DTD/FormValidation1.dtd" > %XHTML1-formvalidation1; <!ENTITY % Inlspecial.extra "%div.qname; " > <!ENTITY % xhmtl-model.mod SYSTEM "formvalidation-model-1.mod" > <!ENTITY % xhtml11.dtd PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd" > %xhtml11.dtd; And here is "formvalidation-model-1": <!ATTLIST %div.qname; %onvalidation CDATA #IMPLIED %XHTML1-formvalidation1.xmlns.extra.attrib; > I've never done DTD before, so I'm not even really exactly sure what I'm doing. When I run my page through the W3 XHTML validator, I get 80+ errors because it's getting duplicate definitions of all the XHTML elements. Am I at least on the right track? Any suggestions? EDIT: I removed this section from my custom DTD, because it turned out that it was actually self-referencing, and the code I got the template from was really for combining two DTDs into one, not appending specific items to one: <!ENTITY % XHTML1-formvalidation1 PUBLIC "-//W3C//DTD XHTML 1.1 +FormValidation 1.0//EN" "http://new.dandoes.net/DTD/FormValidation1.dtd" > %XHTML1-formvalidation1; I also removed this, because it wasn't validating, and didn't seem to be doing anything: <!ENTITY % Inlspecial.extra "%div.qname; " > Additionally, I decided that since I'm only adding a handful of additional items, the separate files model recommended by W3 doesn't really seem that helpful, so I've put everything into the dtd file, the content of which is now this: <!ATTLIST div onvalidate CDATA #IMPLIED> <!ENTITY % xhtml11.dtd PUBLIC "-//W3C//DTD XHTML 1.1//EN" "http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd" > %xhtml11.dtd; So now, I'm not getting any DTD-related validation errors, but the onvalidate attribute still is not valid. Update: I've ditched the DTD and added a schema: http://schema.dandoes.net/FormValidation/1.0.xsd Using v:onvalidate appears to validate in Visual Studio, but the W3C service still doesn't like it. Here's a page where I'm using it so you can look at the source: http://new.dandoes.net/auth And here's the link to the w3c validation result: http://validator.w3.org/check?uri=http://new.dandoes.net/auth&charset=(detect+automatically)&doctype=Inline&group=0 Is this about as close as I'll be able to get with this, or am I still doing something wrong?

    Read the article

  • Increasing speed of python code

    - by Curious2learn
    Hi, I have some python code that has many classes. I used cProfile to find that the total time to run the program is 68 seconds. I found that the following function in a class called Buyers takes about 60 seconds of those 68 seconds. I have to run the program about 100 times, so any increase in speed will help. Can you suggest ways to increase the speed by modifying the code? If you need more information that will help, please let me know. def qtyDemanded(self, timePd, priceVector): '''Returns quantity demanded in period timePd. In addition, also updates the list of customers and non-customers. Inputs: timePd and priceVector Output: count of people for whom priceVector[-1] < utility ''' ## Initialize count of customers to zero ## Set self.customers and self.nonCustomers to empty lists price = priceVector[-1] count = 0 self.customers = [] self.nonCustomers = [] for person in self.people: if person.utility >= price: person.customer = 1 self.customers.append(person) else: person.customer = 0 self.nonCustomers.append(person) return len(self.customers) self.people is a list of person objects. Each person has customer and utility as its attributes. EDIT - responsed added ------------------------------------- Thanks so much for the suggestions. Here is the response to some questions and suggestions people have kindly made. I have not tried them all, but will try others and write back later. (1) @amber - the function is accessed 80,000 times. (2) @gnibbler and others - self.people is a list of Person objects in memory. Not connected to a database. (3) @Hugh Bothwell cumtime taken by the original function - 60.8 s (accessed 80000 times) cumtime taken by the new function with local function aliases as suggested - 56.4 s (accessed 80000 times) (4) @rotoglup and @Martin Thomas I have not tried your solutions yet. I need to check the rest of the code to see the places where I use self.customers before I can make the change of not appending the customers to self.customers list. But I will try this and write back. (5) @TryPyPy - thanks for your kind offer to check the code. Let me first read a little on the suggestions you have made to see if those will be feasible to use. EDIT 2 Some suggested that since I am flagging the customers and noncustomers in the self.people, I should try without creating separate lists of self.customers and self.noncustomers using append. Instead, I should loop over the self.people to find the number of customers. I tried the following code and timed both functions below f_w_append and f_wo_append. I did find that the latter takes less time, but it is still 96% of the time taken by the former. That is, it is a very small increase in the speed. @TryPyPy - The following piece of code is complete enough to check the bottleneck function, in case your offer is still there to check it with other compilers. Thanks again to everyone who replied. import numpy class person(object): def __init__(self, util): self.utility = util self.customer = 0 class population(object): def __init__(self, numpeople): self.people = [] self.cus = [] self.noncus = [] numpy.random.seed(1) utils = numpy.random.uniform(0, 300, numpeople) for u in utils: per = person(u) self.people.append(per) popn = population(300) def f_w_append(): '''Function with append''' P = 75 cus = [] noncus = [] for per in popn.people: if per.utility >= P: per.customer = 1 cus.append(per) else: per.customer = 0 noncus.append(per) return len(cus) def f_wo_append(): '''Function without append''' P = 75 for per in popn.people: if per.utility >= P: per.customer = 1 else: per.customer = 0 numcustomers = 0 for per in popn.people: if per.customer == 1: numcustomers += 1 return numcustomers

    Read the article

  • tastypie posting and full example

    - by Justin M
    Is there a full tastypie django example site and setup available for download? I have been wrestling with wrapping my head around it all day. I have the following code. Basically, I have a POST form that is handled with ajax. When I click "submit" on my form and the ajax request runs, the call returns "POST http://192.168.1.110:8000/api/private/client_basic_info/ 404 (NOT FOUND)" I have the URL configured alright, I think. I can access http://192.168.1.110:8000/api/private/client_basic_info/?format=json just fine. Am I missing some settings or making some fundamental errors in my methods? My intent is that each user can fill out/modify one and only one "client basic information" form/model. a page: {% extends "layout-column-100.html" %} {% load uni_form_tags sekizai_tags %} {% block title %}Basic Information{% endblock %} {% block main_content %} {% addtoblock "js" %} <script language="JavaScript"> $(document).ready( function() { $('#client_basic_info_form').submit(function (e) { form = $(this) form.find('span.error-message, span.success-message').remove() form.find('.invalid').removeClass('invalid') form.find('input[type="submit"]').attr('disabled', 'disabled') e.preventDefault(); var values = {} $.each($(this).serializeArray(), function(i, field) { values[field.name] = field.value; }) $.ajax({ type: 'POST', contentType: 'application/json', data: JSON.stringify(values), dataType: 'json', processData: false, url: '/api/private/client_basic_info/', success: function(data, status, jqXHR) { form.find('input[type="submit"]') .after('<span class="success-message">Saved successfully!</span>') .removeAttr('disabled') }, error: function(jqXHR, textStatus, errorThrown) { console.log(jqXHR) console.log(textStatus) console.log(errorThrown) var errors = JSON.parse(jqXHR.responseText) for (field in errors) { var field_error = errors[field][0] $('#id_' + field).addClass('invalid') .after('<span class="error-message">'+ field_error +'</span>') } form.find('input[type="submit"]').removeAttr('disabled') } }) // end $.ajax() }) // end $('#client_basic_info_form').submit() }) // end $(document).ready() </script> {% endaddtoblock %} {% uni_form form form.helper %} {% endblock %} resources from residence.models import ClientBasicInfo from residence.forms.profiler import ClientBasicInfoForm from tastypie import fields from tastypie.resources import ModelResource from tastypie.authentication import BasicAuthentication from tastypie.authorization import DjangoAuthorization, Authorization from tastypie.validation import FormValidation from tastypie.resources import ModelResource, ALL, ALL_WITH_RELATIONS from django.core.urlresolvers import reverse from django.contrib.auth.models import User class UserResource(ModelResource): class Meta: queryset = User.objects.all() resource_name = 'user' fields = ['username'] filtering = { 'username': ALL, } include_resource_uri = False authentication = BasicAuthentication() authorization = DjangoAuthorization() def dehydrate(self, bundle): forms_incomplete = [] if ClientBasicInfo.objects.filter(user=bundle.request.user).count() < 1: forms_incomplete.append({'name': 'Basic Information', 'url': reverse('client_basic_info')}) bundle.data['forms_incomplete'] = forms_incomplete return bundle class ClientBasicInfoResource(ModelResource): user = fields.ForeignKey(UserResource, 'user') class Meta: authentication = BasicAuthentication() authorization = DjangoAuthorization() include_resource_uri = False queryset = ClientBasicInfo.objects.all() resource_name = 'client_basic_info' validation = FormValidation(form_class=ClientBasicInfoForm) list_allowed_methods = ['get', 'post', ] detail_allowed_methods = ['get', 'post', 'put', 'delete'] Edit: My resources file is now: from residence.models import ClientBasicInfo from residence.forms.profiler import ClientBasicInfoForm from tastypie import fields from tastypie.resources import ModelResource from tastypie.authentication import BasicAuthentication from tastypie.authorization import DjangoAuthorization, Authorization from tastypie.validation import FormValidation from tastypie.resources import ModelResource, ALL, ALL_WITH_RELATIONS from django.core.urlresolvers import reverse from django.contrib.auth.models import User class UserResource(ModelResource): class Meta: queryset = User.objects.all() resource_name = 'user' fields = ['username'] filtering = { 'username': ALL, } include_resource_uri = False authentication = BasicAuthentication() authorization = DjangoAuthorization() #def apply_authorization_limits(self, request, object_list): # return object_list.filter(username=request.user) def dehydrate(self, bundle): forms_incomplete = [] if ClientBasicInfo.objects.filter(user=bundle.request.user).count() < 1: forms_incomplete.append({'name': 'Basic Information', 'url': reverse('client_basic_info')}) bundle.data['forms_incomplete'] = forms_incomplete return bundle class ClientBasicInfoResource(ModelResource): # user = fields.ForeignKey(UserResource, 'user') class Meta: authentication = BasicAuthentication() authorization = DjangoAuthorization() include_resource_uri = False queryset = ClientBasicInfo.objects.all() resource_name = 'client_basic_info' validation = FormValidation(form_class=ClientBasicInfoForm) #list_allowed_methods = ['get', 'post', ] #detail_allowed_methods = ['get', 'post', 'put', 'delete'] def apply_authorization_limits(self, request, object_list): return object_list.filter(user=request.user) I made the user field of the ClientBasicInfo nullable and the POST seems to work. I want to try updating the entry now. Would that just be appending the pk to the ajax url? For example /api/private/client_basic_info/21/? When I submit that form I get a 501 NOT IMPLEMENTED message. What exactly haven't I implemented? I am subclassing ModelResource, which should have all the ORM-related functions implemented according to the docs.

    Read the article

  • What is the best way to solve an Objective-C namespace collision?

    - by Mecki
    Objective-C has no namespaces; it's much like C, everything is within one global namespace. Common practice is to prefix classes with initials, e.g. if you are working at IBM, you could prefix them with "IBM"; if you work for Microsoft, you could use "MS"; and so on. Sometimes the initials refer to the project, e.g. Adium prefixes classes with "AI" (as there is no company behind it of that you could take the initials). Apple prefixes classes with NS and says this prefix is reserved for Apple only. So far so well. But appending 2 to 4 letters to a class name in front is a very, very limited namespace. E.g. MS or AI could have an entirely different meanings (AI could be Artificial Intelligence for example) and some other developer might decide to use them and create an equally named class. Bang, namespace collision. Okay, if this is a collision between one of your own classes and one of an external framework you are using, you can easily change the naming of your class, no big deal. But what if you use two external frameworks, both frameworks that you don't have the source to and that you can't change? Your application links with both of them and you get name conflicts. How would you go about solving these? What is the best way to work around them in such a way that you can still use both classes? In C you can work around these by not linking directly to the library, instead you load the library at runtime, using dlopen(), then find the symbol you are looking for using dlsym() and assign it to a global symbol (that you can name any way you like) and then access it through this global symbol. E.g. if you have a conflict because some C library has a function named open(), you could define a variable named myOpen and have it point to the open() function of the library, thus when you want to use the system open(), you just use open() and when you want to use the other one, you access it via the myOpen identifier. Is something similar possible in Objective-C and if not, is there any other clever, tricky solution you can use resolve namespace conflicts? Any ideas? Update: Just to clarify this: answers that suggest how to avoid namespace collisions in advance or how to create a better namespace are certainly welcome; however, I will not accept them as the answer since they don't solve my problem. I have two libraries and their class names collide. I can't change them; I don't have the source of either one. The collision is already there and tips on how it could have been avoided in advance won't help anymore. I can forward them to the developers of these frameworks and hope they choose a better namespace in the future, but for the time being I'm searching a solution to work with the frameworks right now within a single application. Any solutions to make this possible?

    Read the article

  • Strange behaviour when simply adding strings in Lazarus - FreePascal

    - by linkcharger
    The program has several "encryption" algorithms. This one should blockwise reverse the input. "He|ll|o " becomes "o |ll|He" (block length of 2). I add two strings, in this case appending the result string to the current "block" string and making that the result. When I add the result first and then the block it works fine and gives me back the original string. But when i try to reverse the order it just gives me the the last "block". Several other functions that are used for "rotation" are above. //amount of blocks function amBl(i1:integer;i2:integer):integer; begin if (i1 mod i2) <> 0 then result := (i1 div i2) else result := (i1 div i2) - 1; end; //calculation of block length function calcBl(keyStr:string):integer; var i:integer; begin result := 0; for i := 1 to Length(keyStr) do begin result := (result + ord(keyStr[i])) mod 5; result := result + 2; end; end; //desperate try to add strings function append(s1,s2:string):string; begin insert(s2,s1,Length(s1)+1); result := s1; end; function rotation(inStr,keyStr:string):string; var //array of chars -> string block,temp:string; //position in block variable posB:integer; //block length and block count variable bl, bc:integer; //null character as placeholder n : ansiChar; begin //calculating block length 2..6 bl := calcBl(keyStr); setLength(block,bl); result := ''; temp := ''; {n := #00;} for bc := 0 to amBl(Length(inStr),bl) do begin //filling block with chars starting from back of virtual block (in inStr) for posB := 1 to bl do begin block[posB] := inStr[bc * bl + posB]; {if inStr[bc * bl + posB] = ' ' then block[posB] := n;} end; //adding the block in front of the existing result string temp := result; result := block + temp; //result := append(block,temp); //result := concat(block,temp); end; end; (full code http://pastebin.com/6Uarerhk) After all the loops "result" has the right value, but in the last step (between "result := block + temp" and the "end;" of the function) "block" replaces the content of "result" with itself completely, it doesn't add result at the end anymore. And as you can see I even used a temp variable to try to work around that.. doesnt change anything though.

    Read the article

  • z-index not working in IE8 with the sortable jQuery plugin

    - by Ojtwist
    I'm working with the jQuery Sortable plugin to drag and drop images from one box to another box. This works fine in ff,chrome and safari but it fails in IE8. It seems that when you start dragging that the image is send to the back. I've tried to solve this by adding the z-index option to the sortable plugin, i've tried appending it to a node higher in the hierarchy (body). It appears that setting a z-index on every other item in the page would fix this, haven't tried it yet and i'm not planning on doing this because this would mess up alot. So the user can drag an image from 1 gallery to the next gallery screenshot of how it should work: http://img69.imageshack.us/i/draganddrop.jpg/ Some html: <!--SECOND ARROCRDION ITEM --> <a class="flickr_accordeon_header" id="flickr_second_header" href="javascript:;">__MSG__SEARCH_FOR_PHOTOS__</a> <div> <p class ="flickr_text" > __MSG__SEARCH_FOR_PHOTOS__</p> <form method="GET" action="javascript:;"> <p> <input type="text" value="__MSG__SEARCH__" id="flickr_key_input" class="flickr_changeColorNormal" /> <button class="s3d-button flickr_search" id="flickr_seach_button"> <span class="s3d-button-inner" >__MSG__SEARCH__</span> </button> <img src="/devwidgets/flickr/images/ajax-loader-gray.gif" alt="__MSG__LOADING_IMAGE__" id="flickr_loading_img" /> <a href="javascript:;" id="flickr_refresh_key_button"><img src="/dev/_images/recent_activity_icon.png" alt="refresh" title='refresh' /></a> </p> </form> <div id="flickr_input_error">__MSG__INPUT_ERROR__</div> <div id="flickr_input_same_error">__MSG__INPUT_SAME_ERROR__</div> **<div id="flickr_key_gallery" ><ul class="flickr_key_ul"><li></li></ul></div>** <div id="flickr_key_pagging" ></div> </div> </div> <!--SLIDING SIDEBAR --> <div id="flickr_sidebar" class="jcarousel-skin-tango"> <div id="flickr_side_paging"></div> **<ul> <li><img src="/devwidgets/flickr/images/drop-image.png" alt="__MSG__DROP_HERE__" class="flick_drop_here"></li> </ul>** </div> The images get rendered into the ul, so basically it's just an ul with li's with images javascript for sortable: horizontal: { helper: "clone", // Instead of dragging the real image a copy will be dragged connectWith: ["#flickr_sidebar ul"], // To be able to drag and drop an image to another image gallery they need to be connected cursor: 'pointer', //change the cursor when dragging opacity: 0.50, //Change the opacity while dragging appendTo: 'body', //When dropped the images need to be appended to the image gallery where they are dropped containment: 'body', //Make sure the user can't drag the images outside the widget revert: true, // if the user releases the image ouside the dropbox it'll return to it's original position zIndex: 9999 } I've tried it with setting the dragged image to absolute and the container on relative... doesn't work Anyone know how to solve this in IE8 ?

    Read the article

  • C++ linked list based tree structure. Sanely copy nodes between lists.

    - by krunk
    edit Clafification: The intention is not to remove the node from the original list. But to create an identical node (data and children wise) to the original and insert that into the new list. In other words, a "move" does not imply a "remove" from the original. endedit The requirements: Each Node in the list must contain a reference to its previous sibling Each Node in the list must contain a reference to its next sibling Each Node may have a list of child nodes Each child Node must have a reference to its parent node Basically what we have is a tree structure of arbitrary depth and length. Something like: -root(NULL) --Node1 ----ChildNode1 ------ChildOfChild --------AnotherChild ----ChildNode2 --Node2 ----ChildNode1 ------ChildOfChild ----ChildNode2 ------ChildOfChild --Node3 ----ChildNode1 ----ChildNode2 Given any individual node, you need to be able to either traverse its siblings. the children, or up the tree to the root node. A Node ends up looking something like this: class Node { Node* previoius; Node* next; Node* child; Node* parent; } I have a container class that stores these and provides STL iterators. It performs your typical linked list accessors. So insertAfter looks like: void insertAfter(Node* after, Node* newNode) { Node* next = after->next; after->next = newNode; newNode->previous = after; next->previous = newNode; newNode->next = next; newNode->parent = after->parent; } That's the setup, now for the question. How would one move a node (and its children etc) to another list without leaving the previous list dangling? For example, if Node* myNode exists in ListOne and I want to append it to listTwo. Using pointers, listOne is left with a hole in its list since the next and previous pointers are changed. One solution is pass by value of the appended Node. So our insertAfter method would become: void insertAfter(Node* after, Node newNode); This seems like an awkward syntax. Another option is doing the copying internally, so you'd have: void insertAfter(Node* after, const Node* newNode) { Node *new_node = new Node(*newNode); Node* next = after->next; after->next = new_node; new_node->previous = after; next->previous = new_node; new_node->next = next; new_node->parent = after->parent; } Finally, you might create a moveNode method for moving and prevent raw insertion or appending of a node that already has been assigned siblings and parents. // default pointer value is 0 in constructor and a operator bool(..) // is defined for the Node bool isInList(const Node* node) const { return (node->previous || node->next || node->parent); } // then in insertAfter and friends if(isInList(newNode) // throw some error and bail I thought I'd toss this out there and see what folks came up with.

    Read the article

  • XMLNodes being appended to an XMLNode are "undefined"? Actionscript 2.0 is being unkind

    - by DigitalMercenary
    If anyone can offer an explanation for this one, I'd LOVE to see it! I was required to append a legacy application to display 20 random questions from an XML data source, as opposed to the total of 70 questions that are part of the original XML. No big deal, right? WRONG! I got it to work just fine in the end, but it's a total HACK! For some reason, some of the nodes that I am appending to a dynamically generated XML document are being returned as "undefined". I kept getting between 16 and 20 questions to render until I modified my iteration from a 'for' loop to a 'do while' loop with the appropriate number of XMLNodes as the condition of the 'do while' loop. Can anyone offer an explanation? Below is the code, with some notes for the reader : function editXML(xml:XML):XML { var node:XMLNode = xml.firstChild; var newNode:XMLNode = new XMLNode(); var nodeArray:Array = new Array(); var usedNodes:Array = new Array(); var totalNodes:Number = node.lastChild.childNodes.length - 1; var nextNode:Number; var returnNode:XMLNode = new XMLNode(); var tempNode:XMLNode; var buildNode:XMLNode; var addNode:Boolean = true; var tempXML:XML = new XML(); var pagesNode:XMLNode = tempXML.createElement("pages"); tempXML.appendChild(pagesNode); tempXML.appendChild(node.childNodes[0]); tempXML.appendChild(node.childNodes[1]); tempXML.appendChild(node.childNodes[2]); var questionsNode:XMLNode = tempXML.createElement("pages"); tempXML.firstChild.appendChild(questionsNode); do { nextNode = Math.floor(Math.random()*totalNodes); **//random number to represent random node** //trace(nextNode + " nextNode"); **//check usedNodes Array to look for node.childNodes[nextNode]. If it already exists, skip and reloop.** trace(node.childNodes[1].childNodes[nextNode] + " : pre building Node " + totalNodes); if(usedNodes.length == 0) { buildNode = new XMLNode(); buildNode.nodeName = node.childNodes[1].childNodes[nextNode].nodeName; buildNode.nodeValue = node.childNodes[1].childNodes[nextNode].nodeValue; tempXML.firstChild.lastChild.appendChild(node.childNodes[1].childNodes[nextNode]) usedNodes.push(node.childNodes[1].childNodes[nextNode]); nodeArray.push(node.childNodes[1].childNodes[nextNode]); trace("adding first node : " + nodeArray.length); addNode = false; } else { for(var j:Number = 0; j < usedNodes.length; j++) { if(usedNodes[j] == node.childNodes[1].childNodes[nextNode]) { addNode = false; trace("skipping node : " + nodeArray.length); } } } **//if node not in usedNodes, add node to XML** if(addNode) { trace(node.childNodes[1].childNodes[nextNode] + " : building Node"); **//This trace statement produced a valid node** tempXML.firstChild.lastChild.appendChild(node.childNodes[1].childNodes[nextNode]); **//Before modifying the code from adding nodes to the xml from an Array called 'nodeArray' in a for loop to adding nodes directly to the xml in a do while loop with the length of the xml node used to retrieve data for the questions as the condition, I was not always getting 20 questions. Some of the nodes were being rendered as 'undefined' and not appended to the xml, even though they were traced and proven valid before the attemp to append them to the xml was made** usedNodes.push(node.childNodes[1].childNodes[nextNode]); } addNode = true; } while(tempXML.firstChild.lastChild.childNodes.length <= 19); trace(tempXML.firstChild.lastChild.childNodes.length + " final nodes Length"); courseXML = tempXML; //removes the old question list of 70 and replaces it with the new question list of 20. Question list is the last node. return tempXML; } If I had my choice, I would have rebuilt the whole application in Flex with AS3. I didn't have that choice. If anyone can explain this mystery, PLEASE DO! Thank you in advance!

    Read the article

  • Oracle Linux Tips and Tricks: Using SSH

    - by Robert Chase
    Out of all of the utilities available to systems administrators ssh is probably the most useful of them all. Not only does it allow you to log into systems securely, but it can also be used to copy files, tunnel IP traffic and run remote commands on distant servers. It’s truly the Swiss army knife of systems administration. Secure Shell, also known as ssh, was developed in 1995 by Tau Ylonen after the University of Technology in Finland suffered a password sniffing attack. Back then it was common to use tools like rcp, rsh, ftp and telnet to connect to systems and move files across the network. The main problem with these tools is they provide no security and transmitted data in plain text including sensitive login credentials. SSH provides this security by encrypting all traffic transmitted over the wire to protect from password sniffing attacks. One of the more common use cases involving SSH is found when using scp. Secure Copy (scp) transmits data between hosts using SSH and allows you to easily copy all types of files. The syntax for the scp command is: scp /pathlocal/filenamelocal remoteuser@remotehost:/pathremote/filenameremote In the following simple example, I move a file named myfile from the system test1 to the system test2. I am prompted to provide valid user credentials for the remote host before the transfer will proceed.  If I were only using ftp, this information would be unencrypted as it went across the wire.  However, because scp uses SSH, my user credentials and the file and its contents are confidential and remain secure throughout the transfer.  [user1@test1 ~]# scp /home/user1/myfile user1@test2:/home/user1user1@test2's password: myfile                                    100%    0     0.0KB/s   00:00 You can also use ssh to send network traffic and utilize the encryption built into ssh to protect traffic over the wire. This is known as an ssh tunnel. In order to utilize this feature, the server that you intend to connect to (the remote system) must have TCP forwarding enabled within the sshd configuraton. To enable TCP forwarding on the remote system, make sure AllowTCPForwarding is set to yes and enabled in the /etc/ssh/sshd_conf file: AllowTcpForwarding yes Once you have this configured, you can connect to the server and setup a local port which you can direct traffic to that will go over the secure tunnel. The following command will setup a tunnel on port 8989 on your local system. You can then redirect a web browser to use this local port, allowing the traffic to go through the encrypted tunnel to the remote system. It is important to select a local port that is not being used by a service and is not restricted by firewall rules.  In the following example the -D specifies a local dynamic application level port forwarding and the -N specifies not to execute a remote command.   ssh –D 8989 [email protected] -N You can also forward specific ports on both the local and remote host. The following example will setup a port forward on port 8080 and forward it to port 80 on the remote machine. ssh -L 8080:farwebserver.com:80 [email protected] You can even run remote commands via ssh which is quite useful for scripting or remote system administration tasks. The following example shows how to  log in remotely and execute the command ls –la in the home directory of the machine. Because ssh encrypts the traffic, the login credentials and output of the command are completely protected while they travel over the wire. [rchase@test1 ~]$ ssh rchase@test2 'ls -la'rchase@test2's password: total 24drwx------  2 rchase rchase 4096 Sep  6 15:17 .drwxr-xr-x. 3 root   root   4096 Sep  6 15:16 ..-rw-------  1 rchase rchase   12 Sep  6 15:17 .bash_history-rw-r--r--  1 rchase rchase   18 Dec 20  2012 .bash_logout-rw-r--r--  1 rchase rchase  176 Dec 20  2012 .bash_profile-rw-r--r--  1 rchase rchase  124 Dec 20  2012 .bashrc You can execute any command contained in the quotations marks as long as you have permission with the user account that you are using to log in. This can be very powerful and useful for collecting information for reports, remote controlling systems and performing systems administration tasks using shell scripts. To make your shell scripts even more useful and to automate logins you can use ssh keys for running commands remotely and securely without the need to enter a password. You can accomplish this with key based authentication. The first step in setting up key based authentication is to generate a public key for the system that you wish to log in from. In the following example you are generating a ssh key on a test system. In case you are wondering, this key was generated on a test VM that was destroyed after this article. [rchase@test1 .ssh]$ ssh-keygen -t rsaGenerating public/private rsa key pair.Enter file in which to save the key (/home/rchase/.ssh/id_rsa): Enter passphrase (empty for no passphrase): Enter same passphrase again: Your identification has been saved in /home/rchase/.ssh/id_rsa.Your public key has been saved in /home/rchase/.ssh/id_rsa.pub.The key fingerprint is:7a:8e:86:ef:59:70:ef:43:b7:ee:33:03:6e:6f:69:e8 rchase@test1The key's randomart image is:+--[ RSA 2048]----+|                 ||  . .            ||   o .           ||    . o o        ||   o o oS+       ||  +   o.= =      ||   o ..o.+ =     ||    . .+. =      ||     ...Eo       |+-----------------+ Now that you have the key generated on the local system you should to copy it to the target server into a temporary location. The user’s home directory is fine for this. [rchase@test1 .ssh]$ scp id_rsa.pub rchase@test2:/home/rchaserchase@test2's password: id_rsa.pub                  Now that the file has been copied to the server, you need to append it to the authorized_keys file. This should be appended to the end of the file in the event that there are other authorized keys on the system. [rchase@test2 ~]$ cat id_rsa.pub >> .ssh/authorized_keys Once the process is complete you are ready to login. Since you are using key based authentication you are not prompted for a password when logging into the system.   [rchase@test1 ~]$ ssh test2Last login: Fri Sep  6 17:42:02 2013 from test1 This makes it much easier to run remote commands. Here’s an example of the remote command from earlier. With no password it’s almost as if the command ran locally. [rchase@test1 ~]$ ssh test2 'ls -la'total 32drwx------  3 rchase rchase 4096 Sep  6 17:40 .drwxr-xr-x. 3 root   root   4096 Sep  6 15:16 ..-rw-------  1 rchase rchase   12 Sep  6 15:17 .bash_history-rw-r--r--  1 rchase rchase   18 Dec 20  2012 .bash_logout-rw-r--r--  1 rchase rchase  176 Dec 20  2012 .bash_profile-rw-r--r--  1 rchase rchase  124 Dec 20  2012 .bashrc As a security consideration it's important to note the permissions of .ssh and the authorized_keys file.  .ssh should be 700 and authorized_keys should be set to 600.  This prevents unauthorized access to ssh keys from other users on the system.   An even easier way to move keys back and forth is to use ssh-copy-id. Instead of copying the file and appending it manually to the authorized_keys file, ssh-copy-id does both steps at once for you.  Here’s an example of moving the same key using ssh-copy-id.The –i in the example is so that we can specify the path to the id file, which in this case is /home/rchase/.ssh/id_rsa.pub [rchase@test1]$ ssh-copy-id -i /home/rchase/.ssh/id_rsa.pub rchase@test2 One of the last tips that I will cover is the ssh config file. By using the ssh config file you can setup host aliases to make logins to hosts with odd ports or long hostnames much easier and simpler to remember. Here’s an example entry in our .ssh/config file. Host dev1 Hostname somereallylonghostname.somereallylongdomain.com Port 28372 User somereallylongusername12345678 Let’s compare the login process between the two. Which would you want to type and remember? ssh somereallylongusername12345678@ somereallylonghostname.somereallylongdomain.com –p 28372 ssh dev1 I hope you find these tips useful.  There are a number of tools used by system administrators to streamline processes and simplify workflows and whether you are new to Linux or a longtime user, I'm sure you will agree that SSH offers useful features that can be used every day.  Send me your comments and let us know the ways you  use SSH with Linux.  If you have other tools you would like to see covered in a similar post, send in your suggestions.

    Read the article

  • Auto blocking attacking IP address

    - by dong
    This is to share my PowerShell code online. I original asked this question on MSDN forum (or TechNet?) here: http://social.technet.microsoft.com/Forums/en-US/winserversecurity/thread/f950686e-e3f8-4cf2-b8ec-2685c1ed7a77 In short, this is trying to find attacking IP address then add it into Firewall block rule. So I suppose: 1, You are running a Windows Server 2008 facing the Internet. 2, You need to have some port open for service, e.g. TCP 21 for FTP; TCP 3389 for Remote Desktop. You can see in my code I’m only dealing with these two since that’s what I opened. You can add further port number if you like, but the way to process might be different with these two. 3, I strongly suggest you use STRONG password and follow all security best practices, this ps1 code is NOT for adding security to your server, but reduce the nuisance from brute force attack, and make sys admin’s life easier: i.e. your FTP log won’t hold megabytes of nonsense, your Windows system log will not roll back and only can tell you what happened last month. 4, You are comfortable with setting up Windows Firewall rules, in my code, my rule has a name of “MY BLACKLIST”, you need to setup a similar one, and set it to BLOCK everything. 5, My rule is dangerous because it has the risk to block myself out as well. I do have a backup plan i.e. the DELL DRAC5 so that if that happens, I still can remote console to my server and reset the firewall. 6, By no means the code is perfect, the coding style, the use of PowerShell skills, the hard coded part, all can be improved, it’s just that it’s good enough for me already. It has been running on my server for more than 7 MONTHS. 7, Current code still has problem, I didn’t solve it yet, further on this point after the code. :)    #Dong Xie, March 2012  #my simple code to monitor attack and deal with it  #Windows Server 2008 Logon Type  #8: NetworkCleartext, i.e. FTP  #10: RemoteInteractive, i.e. RDP    $tick = 0;  "Start to run at: " + (get-date);    $regex1 = [regex] "192\.168\.100\.(?:101|102):3389\s+(\d+\.\d+\.\d+\.\d+)";  $regex2 = [regex] "Source Network Address:\t(\d+\.\d+\.\d+\.\d+)";    while($True) {   $blacklist = @();     "Running... (tick:" + $tick + ")"; $tick+=1;    #Port 3389  $a = @()  netstat -no | Select-String ":3389" | ? { $m = $regex1.Match($_); `    $ip = $m.Groups[1].Value; if ($m.Success -and $ip -ne "10.0.0.1") {$a = $a + $ip;} }  if ($a.count -gt 0) {    $ips = get-eventlog Security -Newest 1000 | Where-Object {$_.EventID -eq 4625 -and $_.Message -match "Logon Type:\s+10"} | foreach { `      $m = $regex2.Match($_.Message); $ip = $m.Groups[1].Value; $ip; } | Sort-Object | Tee-Object -Variable list | Get-Unique    foreach ($ip in $a) { if ($ips -contains $ip) {      if (-not ($blacklist -contains $ip)) {        $attack_count = ($list | Select-String $ip -SimpleMatch | Measure-Object).count;        "Found attacking IP on 3389: " + $ip + ", with count: " + $attack_count;        if ($attack_count -ge 20) {$blacklist = $blacklist + $ip;}      }      }    }  }      #FTP  $now = (Get-Date).AddMinutes(-5); #check only last 5 mins.     #Get-EventLog has built-in switch for EventID, Message, Time, etc. but using any of these it will be VERY slow.  $count = (Get-EventLog Security -Newest 1000 | Where-Object {$_.EventID -eq 4625 -and $_.Message -match "Logon Type:\s+8" -and `              $_.TimeGenerated.CompareTo($now) -gt 0} | Measure-Object).count;  if ($count -gt 50) #threshold  {     $ips = @();     $ips1 = dir "C:\inetpub\logs\LogFiles\FPTSVC2" | Sort-Object -Property LastWriteTime -Descending `       | select -First 1 | gc | select -Last 200 | where {$_ -match "An\+error\+occured\+during\+the\+authentication\+process."} `        | Select-String -Pattern "(\d+\.\d+\.\d+\.\d+)" | select -ExpandProperty Matches | select -ExpandProperty value | Group-Object `        | where {$_.Count -ge 10} | select -ExpandProperty Name;       $ips2 = dir "C:\inetpub\logs\LogFiles\FTPSVC3" | Sort-Object -Property LastWriteTime -Descending `       | select -First 1 | gc | select -Last 200 | where {$_ -match "An\+error\+occured\+during\+the\+authentication\+process."} `        | Select-String -Pattern "(\d+\.\d+\.\d+\.\d+)" | select -ExpandProperty Matches | select -ExpandProperty value | Group-Object `        | where {$_.Count -ge 10} | select -ExpandProperty Name;     $ips += $ips1; $ips += $ips2; $ips = $ips | where {$_ -ne "10.0.0.1"} | Sort-Object | Get-Unique;         foreach ($ip in $ips) {       if (-not ($blacklist -contains $ip)) {        "Found attacking IP on FTP: " + $ip;        $blacklist = $blacklist + $ip;       }     }  }        #Firewall change <# $current = (netsh advfirewall firewall show rule name="MY BLACKLIST" | where {$_ -match "RemoteIP"}).replace("RemoteIP:", "").replace(" ","").replace("/255.255.255.255",""); #inside $current there is no \r or \n need remove. foreach ($ip in $blacklist) { if (-not ($current -match $ip) -and -not ($ip -like "10.0.0.*")) {"Adding this IP into firewall blocklist: " + $ip; $c= 'netsh advfirewall firewall set rule name="MY BLACKLIST" new RemoteIP="{0},{1}"' -f $ip, $current; Invoke-Expression $c; } } #>    foreach ($ip in $blacklist) {    $fw=New-object –comObject HNetCfg.FwPolicy2; # http://blogs.technet.com/b/jamesone/archive/2009/02/18/how-to-manage-the-windows-firewall-settings-with-powershell.aspx    $myrule = $fw.Rules | where {$_.Name -eq "MY BLACKLIST"} | select -First 1; # Potential bug here?    if (-not ($myrule.RemoteAddresses -match $ip) -and -not ($ip -like "10.0.0.*"))      {"Adding this IP into firewall blocklist: " + $ip;         $myrule.RemoteAddresses+=(","+$ip);      }  }    Wait-Event -Timeout 30 #pause 30 secs    } # end of top while loop.   Further points: 1, I suppose the server is listening on port 3389 on server IP: 192.168.100.101 and 192.168.100.102, you need to replace that with your real IP. 2, I suppose you are Remote Desktop to this server from a workstation with IP: 10.0.0.1. Please replace as well. 3, The threshold for 3389 attack is 20, you don’t want to block yourself just because you typed your password wrong 3 times, you can change this threshold by your own reasoning. 4, FTP is checking the log for attack only to the last 5 mins, you can change that as well. 5, I suppose the server is serving FTP on both IP address and their LOG path are C:\inetpub\logs\LogFiles\FPTSVC2 and C:\inetpub\logs\LogFiles\FPTSVC3. Change accordingly. 6, FTP checking code is only asking for the last 200 lines of log, and the threshold is 10, change as you wish. 7, the code runs in a loop, you can set the loop time at the last line. To run this code, copy and paste to your editor, finish all the editing, get it to your server, and open an CMD window, then type powershell.exe –file your_powershell_file_name.ps1, it will start running, you can Ctrl-C to break it. This is what you see when it’s running: This is when it detected attack and adding the firewall rule: Regarding the design of the code: 1, There are many ways you can detect the attack, but to add an IP into a block rule is no small thing, you need to think hard before doing it, reason for that may include: You don’t want block yourself; and not blocking your customer/user, i.e. the good guy. 2, Thus for each service/port, I double check. For 3389, first it needs to show in netstat.exe, then the Event log; for FTP, first check the Event log, then the FTP log files. 3, At three places I need to make sure I’m not adding myself into the block rule. –ne with single IP, –like with subnet.   Now the final bit: 1, The code will stop working after a while (depends on how busy you are attacked, could be weeks, months, or days?!) It will throw Red error message in CMD, don’t Panic, it does no harm, but it also no longer blocking new attack. THE REASON is not confirmed with MS people: the COM object to manage firewall, you can only give it a list of IP addresses to the length of around 32KB I think, once it reaches the limit, you get the error message. 2, This is in fact my second solution to use the COM object, the first solution is still in the comment block for your reference, which is using netsh, that fails because being run from CMD, you can only throw it a list of IP to 8KB. 3, I haven’t worked the workaround yet, some ideas include: wrap that RemoteAddresses setting line with error checking and once it reaches the limit, use the newly detected IP to be the list, not appending to it. This basically reset your block rule to ground zero and lose the previous bad IPs. This does no harm as it sounds, because given a certain period has passed, any these bad IPs still not repent and continue the attack to you, it only got 30 seconds or 20 guesses of your password before you block it again. And there is the benefit that the bad IP may turn back to the good hands again, and you are not blocking a potential customer or your CEO’s home pc because once upon a time, it’s a zombie. Thus the ZEN of blocking: never block any IP for too long. 4, But if you insist to block the ugly forever, my other ideas include: You call MS support, ask them how can we set an arbitrary length of IP addresses in a rule; at least from my experiences at the Forum, they don’t know and they don’t care, because they think the dynamic blocking should be done by some expensive hardware. Or, from programming perspective, you can create a new rule once the old is full, then you’ll have MY BLACKLIST1, MY  BLACKLIST2, MY BLACKLIST3, … etc. Once in a while you can compile them together and start a business to sell your blacklist on the market! Enjoy the code! p.s. (PowerShell is REALLY REALLY GREAT!)

    Read the article

  • How to add new filters to CAML queries in SharePoint 2007

    - by uruit
      Normal 0 21 false false false ES-UY X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} One flexibility SharePoint has is CAML (Collaborative Application Markup Language). CAML it’s a markup language like html that allows developers to do queries against SharePoint lists, it’s syntax is very easy to understand and it allows to add logical conditions like Where, Contains, And, Or, etc, just like a SQL Query. For one of our projects we have the need to do a filter on SharePoint views, the problem here is that the view it’s a list containing a CAML Query with the filters the view may have, so in order to filter the view that’s already been filtered before, we need to append our filters to the existing CAML Query. That’s not a trivial task because the where statement in a CAML Query it’s like this: <Where>   <And>     <Filter1 />     <Filter2 />   </And> </Where> If we want to add a new logical operator, like an OR it’s not just as simple as to append the OR expression like the following example: <Where>   <And>     <Filter1 />     <Filter2 />   </And>   <Or>     <Filter3 />   </Or> </Where> But instead the correct query would be: <Where>   <Or>     <And>       <Filter1 />       <Filter2 />     </And>     <Filter3 />   </Or> </Where> Notice that the <Filter# /> tags are for explanation purpose only. In order to solve this problem we created a simple component, it has a method that receives the current query (could be an empty query also) and appends the expression you want to that query. Example: string currentQuery = @“ <Where>    <And>     <Contains><FieldRef Name='Title' /><Value Type='Text'>A</Value></Contains>     <Contains><FieldRef Name='Title' /><Value Type='Text'>B</Value></Contains>   </And> </Where>”; currentQuery = CAMLQueryBuilder.AppendQuery(     currentQuery,     “<Contains><FieldRef Name='Title' /><Value Type='Text'>C</Value></Contains>”,     CAMLQueryBuilder.Operators.Or); The fist parameter this function receives it’s the actual query, the second it’s the filter you want to add, and the third it’s the logical operator, so basically in this query we want all the items that the title contains: the character A and B or the ones that contains the character C. The result query is: <Where>   <Or>      <And>       <Contains><FieldRef Name='Title' /><Value Type='Text'>A</Value></Contains>       <Contains><FieldRef Name='Title' /><Value Type='Text'>B</Value></Contains>     </And>     <Contains><FieldRef Name='Title' /><Value Type='Text'>C</Value></Contains>   </Or> </Where>             The code:   First of all we have an enumerator inside the CAMLQueryBuilder class that has the two possible Options And, Or. public enum Operators { And, Or }   Then we have the main method that’s the one that performs the append of the filters. public static string AppendQuery(string containerQuery, string logicalExpression, Operators logicalOperator){   In this method the first we do is create a new XmlDocument and wrap the current query (that may be empty) with a “<Query></Query>” tag, because the query that comes with the view doesn’t have a root element and the XmlDocument must be a well formatted xml.   XmlDocument queryDoc = new XmlDocument(); queryDoc.LoadXml("<Query>" + containerQuery + "</Query>");   The next step is to create a new XmlDocument containing the logical expression that has the filter needed.   XmlDocument logicalExpressionDoc = new XmlDocument(); logicalExpressionDoc.LoadXml("<root>" + logicalExpression + "</root>"); In these next four lines we extract the expression from the recently created XmlDocument and create an XmlElement.                  XmlElement expressionElTemp = (XmlElement)logicalExpressionDoc.SelectSingleNode("/root/*"); XmlElement expressionEl = queryDoc.CreateElement(expressionElTemp.Name); expressionEl.InnerXml = expressionElTemp.InnerXml;   Below are the main steps in the component logic. The first “if” checks if the actual query doesn’t contains a “Where” clause. In case there’s no “Where” we add it and append the expression.   In case that there’s already a “Where” clause, we get the entire statement that’s inside the “Where” and reorder the query removing and appending elements to form the correct query, that will finally filter the list.   XmlElement whereEl; if (!containerQuery.Contains("Where")) { queryDoc.FirstChild.AppendChild(queryDoc.CreateElement("Where")); queryDoc.SelectSingleNode("/Query/Where").AppendChild(expressionEl); } else { whereEl = (XmlElement)queryDoc.SelectSingleNode("/Query/Where"); if (!containerQuery.Contains("<And>") &&                 !containerQuery.Contains("<Or>"))        {              XmlElement operatorEl = queryDoc.CreateElement(GetName(logicalOperator)); XmlElement existingExpression = (XmlElement)whereEl.SelectSingleNode("/Query/Where/*"); whereEl.RemoveChild(existingExpression);                 operatorEl.AppendChild(existingExpression);               operatorEl.AppendChild(expressionEl);                 whereEl.AppendChild(operatorEl);        }        else        {              XmlElement operatorEl = queryDoc.CreateElement(GetName(logicalOperator)); XmlElement existingOperator = (XmlElement)whereEl.SelectSingleNode("/Query/Where/*");                 whereEl.RemoveChild(existingOperator);               operatorEl.AppendChild(existingOperator);               operatorEl.AppendChild(expressionEl);                 whereEl.AppendChild(operatorEl);         }  }  return queryDoc.FirstChild.InnerXml }     Finally the GetName method converts the Enum option to his string equivalent.   private static string GetName(Operators logicalOperator) {       return Enum.GetName(typeof(Operators), logicalOperator); }        This component helped our team a lot using SharePoint 2007 and modifying the queries, but now in SharePoint 2010; that wouldn’t be needed because of the incorporation of LINQ to SharePoint. This new feature enables the developers to do typed queries against SharePoint lists without the need of writing any CAML code.   Normal 0 21 false false false ES-UY X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-fareast-language:EN-US;} Post written by Sebastian Rodriguez - Portals and Collaboration Solutions @ UruIT  

    Read the article

  • How to add new filters to CAML queries in SharePoint 2007

    - by uruit
    Normal 0 21 false false false ES-UY X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} One flexibility SharePoint has is CAML (Collaborative Application Markup Language). CAML it’s a markup language like html that allows developers to do queries against SharePoint lists, it’s syntax is very easy to understand and it allows to add logical conditions like Where, Contains, And, Or, etc, just like a SQL Query. For one of our projects we have the need to do a filter on SharePoint views, the problem here is that the view it’s a list containing a CAML Query with the filters the view may have, so in order to filter the view that’s already been filtered before, we need to append our filters to the existing CAML Query. That’s not a trivial task because the where statement in a CAML Query it’s like this: <Where>   <And>     <Filter1 />     <Filter2 />   </And> </Where> If we want to add a new logical operator, like an OR it’s not just as simple as to append the OR expression like the following example: <Where>   <And>     <Filter1 />     <Filter2 />   </And>   <Or>     <Filter3 />   </Or> </Where> But instead the correct query would be: <Where>   <Or>     <And>       <Filter1 />       <Filter2 />     </And>     <Filter3 />   </Or> </Where> Notice that the <Filter# /> tags are for explanation purpose only. In order to solve this problem we created a simple component, it has a method that receives the current query (could be an empty query also) and appends the expression you want to that query. Example: string currentQuery = @“ <Where>    <And>     <Contains><FieldRef Name='Title' /><Value Type='Text'>A</Value></Contains>     <Contains><FieldRef Name='Title' /><Value Type='Text'>B</Value></Contains>   </And> </Where>”; currentQuery = CAMLQueryBuilder.AppendQuery(     currentQuery,     “<Contains><FieldRef Name='Title' /><Value Type='Text'>C</Value></Contains>”,     CAMLQueryBuilder.Operators.Or); The fist parameter this function receives it’s the actual query, the second it’s the filter you want to add, and the third it’s the logical operator, so basically in this query we want all the items that the title contains: the character A and B or the ones that contains the character C. The result query is: <Where>   <Or>      <And>       <Contains><FieldRef Name='Title' /><Value Type='Text'>A</Value></Contains>       <Contains><FieldRef Name='Title' /><Value Type='Text'>B</Value></Contains>     </And>     <Contains><FieldRef Name='Title' /><Value Type='Text'>C</Value></Contains>   </Or> </Where>     The code:   First of all we have an enumerator inside the CAMLQueryBuilder class that has the two possible Options And, Or. public enum Operators { And, Or }   Then we have the main method that’s the one that performs the append of the filters. public static string AppendQuery(string containerQuery, string logicalExpression, Operators logicalOperator){   In this method the first we do is create a new XmlDocument and wrap the current query (that may be empty) with a “<Query></Query>” tag, because the query that comes with the view doesn’t have a root element and the XmlDocument must be a well formatted xml.   XmlDocument queryDoc = new XmlDocument(); queryDoc.LoadXml("<Query>" + containerQuery + "</Query>");   The next step is to create a new XmlDocument containing the logical expression that has the filter needed.   XmlDocument logicalExpressionDoc = new XmlDocument(); logicalExpressionDoc.LoadXml("<root>" + logicalExpression + "</root>"); In these next four lines we extract the expression from the recently created XmlDocument and create an XmlElement.                  XmlElement expressionElTemp = (XmlElement)logicalExpressionDoc.SelectSingleNode("/root/*"); XmlElement expressionEl = queryDoc.CreateElement(expressionElTemp.Name); expressionEl.InnerXml = expressionElTemp.InnerXml;   Below are the main steps in the component logic. The first “if” checks if the actual query doesn’t contains a “Where” clause. In case there’s no “Where” we add it and append the expression.   In case that there’s already a “Where” clause, we get the entire statement that’s inside the “Where” and reorder the query removing and appending elements to form the correct query, that will finally filter the list.   XmlElement whereEl; if (!containerQuery.Contains("Where")) { queryDoc.FirstChild.AppendChild(queryDoc.CreateElement("Where")); queryDoc.SelectSingleNode("/Query/Where").AppendChild(expressionEl); } else { whereEl = (XmlElement)queryDoc.SelectSingleNode("/Query/Where"); if (!containerQuery.Contains("<And>") &&                 !containerQuery.Contains("<Or>"))        {              XmlElement operatorEl = queryDoc.CreateElement(GetName(logicalOperator)); XmlElement existingExpression = (XmlElement)whereEl.SelectSingleNode("/Query/Where/*"); whereEl.RemoveChild(existingExpression);                 operatorEl.AppendChild(existingExpression);               operatorEl.AppendChild(expressionEl);                 whereEl.AppendChild(operatorEl);        }        else        {              XmlElement operatorEl = queryDoc.CreateElement(GetName(logicalOperator)); XmlElement existingOperator = (XmlElement)whereEl.SelectSingleNode("/Query/Where/*");                 whereEl.RemoveChild(existingOperator);               operatorEl.AppendChild(existingOperator);               operatorEl.AppendChild(expressionEl);                 whereEl.AppendChild(operatorEl);         }  }  return queryDoc.FirstChild.InnerXml }     Finally the GetName method converts the Enum option to his string equivalent.   private static string GetName(Operators logicalOperator) {       return Enum.GetName(typeof(Operators), logicalOperator); }        Normal 0 21 false false false ES-UY X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Normal 0 21 false false false ES-UY X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} This component helped our team a lot using SharePoint 2007 and modifying the queries, but now in SharePoint 2010; that wouldn’t be needed because of the incorporation of LINQ to SharePoint. This new feature enables the developers to do typed queries against SharePoint lists without the need of writing any CAML code.  But there is still much development to the 2007 version, so I hope this information is useful for other members.  Post Normal 0 21 false false false ES-UY X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi; mso-fareast-language:EN-US;} written by Sebastian Rodriguez - Portals and Collaboration Solutions @ UruIT

    Read the article

  • How do I run gtk demos?

    - by Runner
    They are located under: share\gtk-2.0\demo But none of them contains a main function, how can I make the following textscroll.c actually work: /* Text Widget/Automatic scrolling * * This example demonstrates how to use the gravity of * GtkTextMarks to keep a text view scrolled to the bottom * while appending text. */ #include <gtk/gtk.h> #include "demo-common.h" /* Scroll to the end of the buffer. */ static gboolean scroll_to_end (GtkTextView *textview) { GtkTextBuffer *buffer; GtkTextIter iter; GtkTextMark *mark; char *spaces; static int count; buffer = gtk_text_view_get_buffer (textview); /* Get "end" mark. It's located at the end of buffer because * of right gravity */ mark = gtk_text_buffer_get_mark (buffer, "end"); gtk_text_buffer_get_iter_at_mark (buffer, &iter, mark); /* and insert some text at its position, the iter will be * revalidated after insertion to point to the end of inserted text */ spaces = g_strnfill (count++, ' '); gtk_text_buffer_insert (buffer, &iter, "\n", -1); gtk_text_buffer_insert (buffer, &iter, spaces, -1); gtk_text_buffer_insert (buffer, &iter, "Scroll to end scroll to end scroll " "to end scroll to end ", -1); g_free (spaces); /* Now scroll the end mark onscreen. */ gtk_text_view_scroll_mark_onscreen (textview, mark); /* Emulate typewriter behavior, shift to the left if we * are far enough to the right. */ if (count > 150) count = 0; return TRUE; } /* Scroll to the bottom of the buffer. */ static gboolean scroll_to_bottom (GtkTextView *textview) { GtkTextBuffer *buffer; GtkTextIter iter; GtkTextMark *mark; char *spaces; static int count; buffer = gtk_text_view_get_buffer (textview); /* Get end iterator */ gtk_text_buffer_get_end_iter (buffer, &iter); /* and insert some text at it, the iter will be revalidated * after insertion to point to the end of inserted text */ spaces = g_strnfill (count++, ' '); gtk_text_buffer_insert (buffer, &iter, "\n", -1); gtk_text_buffer_insert (buffer, &iter, spaces, -1); gtk_text_buffer_insert (buffer, &iter, "Scroll to bottom scroll to bottom scroll " "to bottom scroll to bottom", -1); g_free (spaces); /* Move the iterator to the beginning of line, so we don't scroll * in horizontal direction */ gtk_text_iter_set_line_offset (&iter, 0); /* and place the mark at iter. the mark will stay there after we * insert some text at the end because it has right gravity. */ mark = gtk_text_buffer_get_mark (buffer, "scroll"); gtk_text_buffer_move_mark (buffer, mark, &iter); /* Scroll the mark onscreen. */ gtk_text_view_scroll_mark_onscreen (textview, mark); /* Shift text back if we got enough to the right. */ if (count > 40) count = 0; return TRUE; } static guint setup_scroll (GtkTextView *textview, gboolean to_end) { GtkTextBuffer *buffer; GtkTextIter iter; buffer = gtk_text_view_get_buffer (textview); gtk_text_buffer_get_end_iter (buffer, &iter); if (to_end) { /* If we want to scroll to the end, including horizontal scrolling, * then we just create a mark with right gravity at the end of the * buffer. It will stay at the end unless explicitely moved with * gtk_text_buffer_move_mark. */ gtk_text_buffer_create_mark (buffer, "end", &iter, FALSE); /* Add scrolling timeout. */ return g_timeout_add (50, (GSourceFunc) scroll_to_end, textview); } else { /* If we want to scroll to the bottom, but not scroll horizontally, * then an end mark won't do the job. Just create a mark so we can * use it with gtk_text_view_scroll_mark_onscreen, we'll position it * explicitely when needed. Use left gravity so the mark stays where * we put it after inserting new text. */ gtk_text_buffer_create_mark (buffer, "scroll", &iter, TRUE); /* Add scrolling timeout. */ return g_timeout_add (100, (GSourceFunc) scroll_to_bottom, textview); } } static void remove_timeout (GtkWidget *window, gpointer timeout) { g_source_remove (GPOINTER_TO_UINT (timeout)); } static void create_text_view (GtkWidget *hbox, gboolean to_end) { GtkWidget *swindow; GtkWidget *textview; guint timeout; swindow = gtk_scrolled_window_new (NULL, NULL); gtk_box_pack_start (GTK_BOX (hbox), swindow, TRUE, TRUE, 0); textview = gtk_text_view_new (); gtk_container_add (GTK_CONTAINER (swindow), textview); timeout = setup_scroll (GTK_TEXT_VIEW (textview), to_end); /* Remove the timeout in destroy handler, so we don't try to * scroll destroyed widget. */ g_signal_connect (textview, "destroy", G_CALLBACK (remove_timeout), GUINT_TO_POINTER (timeout)); } GtkWidget * do_textscroll (GtkWidget *do_widget) { static GtkWidget *window = NULL; if (!window) { GtkWidget *hbox; window = gtk_window_new (GTK_WINDOW_TOPLEVEL); g_signal_connect (window, "destroy", G_CALLBACK (gtk_widget_destroyed), &window); gtk_window_set_default_size (GTK_WINDOW (window), 600, 400); hbox = gtk_hbox_new (TRUE, 6); gtk_container_add (GTK_CONTAINER (window), hbox); create_text_view (hbox, TRUE); create_text_view (hbox, FALSE); } if (!gtk_widget_get_visible (window)) gtk_widget_show_all (window); else gtk_widget_destroy (window); return window; }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • php - upload script mkdir saying file already exists when same directory even though different filename

    - by neeko
    my upload script says my file already exists when i try upload even though different filename <?php // Start a session for error reporting session_start(); ?> <?php // Check, if username session is NOT set then this page will jump to login page if (!isset($_SESSION['username'])) { header('Location: index.html'); } // Call our connection file include('config.php'); // Check to see if the type of file uploaded is a valid image type function is_valid_type($file) { // This is an array that holds all the valid image MIME types $valid_types = array("image/jpg", "image/JPG", "image/jpeg", "image/bmp", "image/gif", "image/png"); if (in_array($file['type'], $valid_types)) return 1; return 0; } // Just a short function that prints out the contents of an array in a manner that's easy to read // I used this function during debugging but it serves no purpose at run time for this example function showContents($array) { echo "<pre>"; print_r($array); echo "</pre>"; } // Set some constants // Grab the User ID we sent from our form $user_id = $_SESSION['username']; $category = $_POST['category']; // This variable is the path to the image folder where all the images are going to be stored // Note that there is a trailing forward slash $TARGET_PATH = "img/users/$category/$user_id/"; mkdir($TARGET_PATH, 0755, true); // Get our POSTed variables $fname = $_POST['fname']; $lname = $_POST['lname']; $contact = $_POST['contact']; $price = $_POST['price']; $image = $_FILES['image']; // Build our target path full string. This is where the file will be moved do // i.e. images/picture.jpg $TARGET_PATH .= $image['name']; // Make sure all the fields from the form have inputs if ( $fname == "" || $lname == "" || $image['name'] == "" ) { $_SESSION['error'] = "All fields are required"; header("Location: error.php"); exit; } // Check to make sure that our file is actually an image // You check the file type instead of the extension because the extension can easily be faked if (!is_valid_type($image)) { $_SESSION['error'] = "You must upload a jpeg, gif, or bmp"; header("Location: error.php"); exit; } // Here we check to see if a file with that name already exists // You could get past filename problems by appending a timestamp to the filename and then continuing if (file_exists($TARGET_PATH)) { $_SESSION['error'] = "A file with that name already exists"; header("Location: error.php"); exit; } // Lets attempt to move the file from its temporary directory to its new home if (move_uploaded_file($image['tmp_name'], $TARGET_PATH)) { // NOTE: This is where a lot of people make mistakes. // We are *not* putting the image into the database; we are putting a reference to the file's location on the server $imagename = $image['name']; $sql = "insert into people (price, contact, category, username, fname, lname, expire, filename) values (:price, :contact, :category, :user_id, :fname, :lname, now() + INTERVAL 1 MONTH, :imagename)"; $q = $conn->prepare($sql) or die("failed!"); $q->bindParam(':price', $price, PDO::PARAM_STR); $q->bindParam(':contact', $contact, PDO::PARAM_STR); $q->bindParam(':category', $category, PDO::PARAM_STR); $q->bindParam(':user_id', $user_id, PDO::PARAM_STR); $q->bindParam(':fname', $fname, PDO::PARAM_STR); $q->bindParam(':lname', $lname, PDO::PARAM_STR); $q->bindParam(':imagename', $imagename, PDO::PARAM_STR); $q->execute(); $sql1 = "UPDATE people SET firstname = (SELECT firstname FROM user WHERE username=:user_id1) WHERE username=:user_id2"; $q = $conn->prepare($sql1) or die("failed!"); $q->bindParam(':user_id1', $user_id, PDO::PARAM_STR); $q->bindParam(':user_id2', $user_id, PDO::PARAM_STR); $q->execute(); $sql2 = "UPDATE people SET surname = (SELECT surname FROM user WHERE username=:user_id1) WHERE username=:user_id2"; $q = $conn->prepare($sql2) or die("failed!"); $q->bindParam(':user_id1', $user_id, PDO::PARAM_STR); $q->bindParam(':user_id2', $user_id, PDO::PARAM_STR); $q->execute(); header("Location: search.php"); exit; } else { // A common cause of file moving failures is because of bad permissions on the directory attempting to be written to // Make sure you chmod the directory to be writeable $_SESSION['error'] = "Could not upload file. Check read/write persmissions on the directory"; header("Location: error.php"); exit; } ?>

    Read the article

  • android listview loadmore button with xml parsing

    - by user1780331
    Hi i have to developed listview with load more button using xml parsing in android application. Here i have faced some problem. my xml feed is empty means how can hide the load more button on last page. i have used below code here. public class CustomizedListView extends Activity { // All static variables private String URL = "http://dev.mmm.com/xctesting/xcart444pro/retrieve.php?page=1"; // XML node keys static final String KEY_SONG = "Order"; static final String KEY_TITLE = "orderid"; static final String KEY_DATE = "date"; static final String KEY_ARTIST = "payment_method"; int current_page = 1; ListView lv; LazyAdapter adapter; ProgressDialog pDialog; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); lv = (ListView) findViewById(R.id.list); ArrayList<HashMap<String, String>> songsList = new ArrayList<HashMap<String, String>>(); XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element NodeList nl = doc.getElementsByTagName(KEY_SONG); // looping through all song nodes <song> for (int i = 0; i < nl.getLength(); i++) { // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); Element e = (Element) nl.item(i); // adding each child node to HashMap key => value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_ARTIST, parser.getValue(e, KEY_ARTIST)); songsList.add(map); } Button btnLoadMore = new Button(this); btnLoadMore.setText("Load More"); btnLoadMore.setBackgroundResource(R.drawable.lgnbttn); // Adding Load More button to lisview at bottom lv.addFooterView(btnLoadMore); // Getting adapter adapter = new LazyAdapter(this, songsList); lv.setAdapter(adapter); btnLoadMore.setOnClickListener(new View.OnClickListener() { @Override public void onClick(View arg0) { // Starting a new async task new loadMoreListView().execute(); } }); } private class loadMoreListView extends AsyncTask<Void, Void, Void> { @Override protected void onPreExecute() { // Showing progress dialog before sending http request pDialog = new ProgressDialog( CustomizedListView.this); pDialog.setMessage("Please wait.."); //pDialog.setIndeterminateDrawable(getResources().getDrawable(R.drawable.my_progress_indeterminate)); pDialog.setIndeterminate(true); pDialog.setCancelable(false); pDialog.show(); pDialog.setContentView(R.layout.custom_dialog); } protected Void doInBackground(Void... unused) { current_page += 1; // Next page request URL = "http://dev.mmm.com/xctesting/xcart444pro/retrieve.php?page=" + current_page; ArrayList<HashMap<String, String>> songsList = new ArrayList<HashMap<String, String>>(); XMLParser parser = new XMLParser(); String xml = parser.getXmlFromUrl(URL); // getting XML from URL Document doc = parser.getDomElement(xml); // getting DOM element NodeList nl = doc.getElementsByTagName(KEY_SONG); NodeList nl = doc.getElementsByTagName(KEY_SONG); if (nl.getLength() == 0) { btnLoadMore.setVisibility(View.GONE); pDialog.dismiss(); } else // looping through all item nodes <item> for (int i = 0; i < nl.getLength(); i++) { // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); Element e = (Element) nl.item(i); // adding each child node to HashMap key => value map.put(KEY_ID, parser.getValue(e, KEY_ID)); map.put(KEY_TITLE, parser.getValue(e, KEY_TITLE)); map.put(KEY_ARTIST, parser.getValue(e, KEY_ARTIST)); songsList.add(map); } // get listview current position - used to maintain scroll position int currentPosition = lv.getFirstVisiblePosition(); // Appending new data to menuItems ArrayList adapter = new LazyAdapter( CustomizedListView.this, songsList); lv.setAdapter(adapter); lv.setSelectionFromTop(currentPosition + 1, 0); } }); return (null); } protected void onPostExecute(Void unused) { // closing progress dialog pDialog.dismiss(); } } } EDIT: Here i have to run the app means the listview is displayed on perpage 4 items.my last page having 1 item.please refer this screenshot:http://screencast.com/t/fTl4FETd In last page i have to click the load more button means have to go next activity and successfully hide the button on empty page..please refer this screenshot:http://screencast.com/t/wyG5zdp3r i have to check the condition for empty page: if (nl.getLength() == 0) { btnLoadMore.setVisibility(View.GONE); pDialog.dismiss(); } How can i write the conditon fot last page?????pleas ehelp me Here i wish to need the o/p is hide the button on last page. Please help me.how can i check the condition.give me some code programmatically.

    Read the article

  • How does Ocaml decide precedence for user-defined operators?

    - by forefinger
    I want nice operators for complex arithmetic to make my code more readable. Ocaml has a Complex module, so I just want to add operators that call those functions. The most intuitive way for me is to make a new complex operator from all of the usual operators by appending '&' to the operator symbol. Thus +& and *& will be complex addition and multiplication. I would also like ~& to be complex conjugation. If I'm going to use these operators, I want them to associate the same way that normal arithmetic associates. Based on the following sessions, they are automatically behaving the way I want, but I would like to understand why, so that I don't get horrible bugs when I introduce more operators. My current guess is that their precedence is done by lexically sorting the operator symbols according to an ordering that is consistent with normal arithmetic precedence. But I cannot confirm this. Session one: # open Complex;; # let (+&) a b = add a b;; val ( +& ) : Complex.t -> Complex.t -> Complex.t = <fun> # let ( *&) a b = mul a b;; val ( *& ) : Complex.t -> Complex.t -> Complex.t = <fun> # one +& zero *& one +& zero *& one;; - : Complex.t = {re = 1.; im = 0.} # zero +& one *& zero +& one *& zero;; - : Complex.t = {re = 0.; im = 0.} # i +& i *& i +& i *& i *& i;; - : Complex.t = {re = -1.; im = 0.} Session two: # open Complex;; # let ( *&) a b = mul a b;; val ( *& ) : Complex.t -> Complex.t -> Complex.t = <fun> # let (+&) a b = add a b;; val ( +& ) : Complex.t -> Complex.t -> Complex.t = <fun> # one +& zero *& one +& zero *& one;; - : Complex.t = {re = 1.; im = 0.} # zero +& one *& zero +& one *& zero;; - : Complex.t = {re = 0.; im = 0.} # i +& i *& i +& i *& i *& i;; - : Complex.t = {re = -1.; im = 0.} # let (~&) a = conj a;; val ( ~& ) : Complex.t -> Complex.t = <fun> # (one +& i) *& ~& (one +& i);; - : Complex.t = {re = 2.; im = 0.}

    Read the article

  • how do i install PHP with JSON and OAuth on Mac Snow Leopard?

    - by meilas
    i want to use the dropbox api via this library http://code.google.com/p/dropbox-php/ i installed MAMP then I tried "sudo pecl install oauth" but I got downloading oauth-1.0.0.tgz ... Starting to download oauth-1.0.0.tgz (42,834 bytes) ............done: 42,834 bytes 6 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 building in /var/tmp/pear-build-root/oauth-1.0.0 running: /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/configure checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for a sed that does not truncate output... /opt/local/bin/gsed checking for cc... cc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether cc accepts -g... yes checking for cc option to accept ISO C89... none needed checking how to run the C preprocessor... cc -E checking for icc... no checking for suncc... no checking whether cc understands -c and -o together... yes checking for system library directory... lib checking if compiler supports -R... no checking if compiler supports -Wl,-rpath,... yes checking build system type... i686-apple-darwin10.4.0 checking host system type... i686-apple-darwin10.4.0 checking target system type... i686-apple-darwin10.4.0 checking for PHP prefix... /usr checking for PHP includes... -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib checking for PHP extension directory... /usr/lib/php/extensions/no-debug-non-zts-20090626 checking for PHP installed headers prefix... /usr/include/php checking if debug is enabled... no checking if zts is enabled... no checking for re2c... no configure: WARNING: You will need re2c 0.13.4 or later if you want to regenerate PHP parsers. checking for gawk... gawk checking for oauth support... yes, shared checking for cURL in default path... found in /usr checking for ld used by cc... /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld checking if the linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) is GNU ld... no checking for /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm checking whether ln -s works... yes checking how to recognise dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm output from cc object... rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory checking if cc static flag works... rm: conftest.dSYM: is a directory yes checking if cc supports -fno-rtti -fno-exceptions... rm: conftest.dSYM: is a directory no checking for cc option to produce PIC... -fno-common checking if cc PIC flag -fno-common works... rm: conftest.dSYM: is a directory yes checking if cc supports -c -o file.o... rm: conftest.dSYM: is a directory yes checking whether the cc linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) supports shared libraries... yes checking dynamic linker characteristics... darwin10.4.0 dyld checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... no creating libtool appending configuration tag "CXX" to libtool configure: creating ./config.status config.status: creating config.h running: make /bin/sh /private/var/tmp/pear-build-root/oauth-1.0.0/libtool --mode=compile cc -I. -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c -o oauth.lo mkdir .libs cc -I. "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c "/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c" -fno-common -DPIC -o .libs/oauth.o In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:29:18: error: pcre.h: No such file or directory In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:37: error: expected '=', ',', ';', 'asm' or 'attribute' before '*' token /usr/include/php/ext/pcre/php_pcre.h:38: error: expected '=', ',', ';', 'asm' or 'attribute' before '*' token /usr/include/php/ext/pcre/php_pcre.h:44: error: expected specifier-qualifier-list before 'pcre' make: * [oauth.lo] Error 1 ERROR: `make' failed

    Read the article

  • How do I install PHP with JSON and OAuth on Mac Snow Leopard?

    - by meilas
    I want to use the Dropbox API via this library, http://code.google.com/p/dropbox-php/. I installed MAMP, and then I tried sudo pecl install oauth but I got the following. >>>> downloading oauth-1.0.0.tgz ... Starting to download oauth-1.0.0.tgz (42,834 bytes) ............done: 42,834 bytes 6 source files, building running: phpize Configuring for: PHP Api Version: 20090626 Zend Module Api No: 20090626 Zend Extension Api No: 220090626 building in /var/tmp/pear-build-root/oauth-1.0.0 running: /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/configure checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for a sed that does not truncate output... /opt/local/bin/gsed checking for cc... cc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether cc accepts -g... yes checking for cc option to accept ISO C89... none needed checking how to run the C preprocessor... cc -E checking for icc... no checking for suncc... no checking whether cc understands -c and -o together... yes checking for system library directory... lib checking if compiler supports -R... no checking if compiler supports -Wl,-rpath,... yes checking build system type... i686-apple-darwin10.4.0 checking host system type... i686-apple-darwin10.4.0 checking target system type... i686-apple-darwin10.4.0 checking for PHP prefix... /usr checking for PHP includes... -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib checking for PHP extension directory... /usr/lib/php/extensions/no-debug-non-zts-20090626 checking for PHP installed headers prefix... /usr/include/php checking if debug is enabled... no checking if zts is enabled... no checking for re2c... no configure: WARNING: You will need re2c 0.13.4 or later if you want to regenerate PHP parsers. checking for gawk... gawk checking for oauth support... yes, shared checking for cURL in default path... found in /usr checking for ld used by cc... /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld checking if the linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) is GNU ld... no checking for /usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm checking whether ln -s works... yes checking how to recognise dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm output from cc object... rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip rm: conftest.dSYM: is a directory rm: conftest.dSYM: is a directory checking if cc static flag works... rm: conftest.dSYM: is a directory yes checking if cc supports -fno-rtti -fno-exceptions... rm: conftest.dSYM: is a directory no checking for cc option to produce PIC... -fno-common checking if cc PIC flag -fno-common works... rm: conftest.dSYM: is a directory yes checking if cc supports -c -o file.o... rm: conftest.dSYM: is a directory yes checking whether the cc linker (/usr/libexec/gcc/i686-apple-darwin10/4.2.1/ld) supports shared libraries... yes checking dynamic linker characteristics... darwin10.4.0 dyld checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... no >>>> creating libtool appending configuration tag "CXX" to libtool configure: creating ./config.status config.status: creating config.h running: make /bin/sh /private/var/tmp/pear-build-root/oauth-1.0.0/libtool --mode=compile cc -I. -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main -I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c -o oauth.lo mkdir .libs cc -I. "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -DPHP_ATOM_INC -I/private/var/tmp/pear-build-root/oauth-1.0.0/include -I/private/var/tmp/pear-build-root/oauth-1.0.0/main "-I/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth" -I/usr/include/php -I/usr/include/php/main -I/usr/include/php/TSRM -I/usr/include/php/Zend -I/usr/include/php/ext -I/usr/include/php/ext/date/lib -DHAVE_CONFIG_H -g -O2 -Wall -g -c "/private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c" -fno-common -DPIC -o .libs/oauth.o In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:29:18: error: pcre.h: No such file or directory In file included from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/php_oauth.h:47, from /private/var/tmp/apache_mod_php/apache_mod_php-53~1/Build/tmp/pear/temp/oauth/oauth.c:14: /usr/include/php/ext/pcre/php_pcre.h:37: error: expected '=', ',', ';', 'asm' or '__attribute__' before '*' token /usr/include/php/ext/pcre/php_pcre.h:38: error: expected '=', ',', ';', 'asm' or '__attribute__' before '*' token /usr/include/php/ext/pcre/php_pcre.h:44: error: expected specifier-qualifier-list before 'pcre' make: *** [oauth.lo] Error 1 ERROR: `make' failed </block>

    Read the article

< Previous Page | 15 16 17 18 19 20  | Next Page >