Search Results

Search found 58729 results on 2350 pages for 'github for windows'.

Page 2008/2350 | < Previous Page | 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015  | Next Page >

• How can I organize my video collection and update meta data?

  - by Pieter Breed

  I have a large collection of downloaded video files containing different movies, tv shows and music videos. I have a FreeNAS box set up that uses Fuppes as a UPnP media server. My media player on Windows correctly detects this UPnP collection and can stream from it fine. However, All of my music videos, tv shows and movies are all sorted under the same 'Videos' group. I would like to seperate the different types of video files so that they can correctly go under 'Recorded TV' or whatever the case may be. Any ideas? I guess I am looking for something like an MP3Tagger but for video files?

  Read the article

• How do I get my 192.168.* Linux server accessible via http://hostname/?

  - by rfrankel

  (Sorry if this question isn't worded well and/or is duplicate. I'm not a networking guy and I'm probably not using the right terms...this also makes it hard to see if this has already been answered.) I'm running a CentOS server in VirtualBox, Windows host, and I can see access Apache-hosted pages at http://192.168.1.109/ from machines on my LAN. But what I'd like is for people to be able to type http://hostname/ ...both because it's easier and primarily because I'm not sure that local IP is static. I'm not really sure how to proceed - could someone point me in the right direction? Thanks.

  Read the article

• Security considerations when giving access to SQL Server db for a web application

  - by rem

  I need to expose our SQL Server 2008 database for an access from a asp.net web application. This is a new task for me, so I would like to know what basic security requirements are there for configuring software and hardware components of web server and DB Server. Is it OK to have both Web Server (Windows Server 2008) with IIS holding ASP.NET application and SQL Server 2008 on the same machine? Should I have to install additional firewall, like Forefront TMG? Should it be on separate computer? In case a web application is hosted on an external web hosting privider server and SQL Server DB on a our internal server what are "pro's" and "con's" of such configuration?

  Read the article

• Sharepoint 2010 can't find domain users when granting permissions

  - by quani

  I'm trying to grant permissions to other people to view a SharePoint site but when granting permissions it uses "Check Names" and claims any user or group that is part of a domain does not exist. It does this if I try granting permissions to the team site or in central admin BUT if I try to add someone to Farm Administrators in Central admin then all of the sudden it can find all domain users. Why is it finding domain users in that one context but not others? It is supposed to be using NTLM authentication and has Windows configured as the authentication provider (And IIS is configured to use NTLM). What's even more strange is I enabled Anonymous Access for the team site which I thought would allow anyone to view it but others say they can't access it.

  Read the article

• Problem Writing to Samba Share

  - by Chris

  Hello, I have had a problem writing to a Samba Share I believe you have the answer in this post that you posted in October. Can you tell me how to do this? Thank you very much "On the Samba server, you need to ensure that the nobody user has write permissions to /Windows_Backups/DC. You're forcing everyone to be impersonated by the nobody account, so that account will need file-level permissions on that share directory. Samba will respect local permissions when figuring out who can write where, in this case it is somewhat like Windows."

  Read the article

• Trying to launch old game using wine

  - by rhon

  I'm using wine 1.5.11 on Archlinux, and I try to launch this old game : http://www.cnetfrance.fr/telecharger/waterboy-11006056s.htm?download=1 The problem is that I always get a "Run-time error '13' : Type mismatch" when I try to launch it. I've tried to switch oleaut.dll and ole32.dll to "native", and switch to "Windows 98" mode using winecfg, and then I had this error : err:module:import_dll Library ole32.dll (which is needed by L"Z:\\games\\WaterBoy\\MSVBVM50.DLL") not found err:module:import_dll Library OLEAUT32.dll (which is needed by L"Z:\\games\\WaterBoy\\MSVBVM50.DLL") not found err:module:import_dll Library MSVBVM50.DLL (which is needed by L"Z:\\games\\WaterBoy\\WaterBoy.exe") not found err:module:LdrInitializeThunk Main exe initialization for L"Z:\\games\\WaterBoy\\WaterBoy.exe" failed, status c0000135 I've installed vb5runtime using winetricks, but it didn't help. Am I doing something wrong ?

  Read the article

• All items in my pen drive had been renamed automatically and cannot open it

  - by pabz

  All the items (both files and folders) inside my pen drive had been renamed to some characters like :]h.¡?.A++ and when I try to open any folder Windows gives this message. The filename,directory name, or volume label syntax is incorrect I was told that it is a problem of the pen drive, not a virus. They say if I format the pendrive then I will be able to use it again normally. But I'm not sure. And I need those files. Does anybody knows a solution?

  Read the article

• wifi key masking

  - by Warren Bullock III

  Hello, We currently utilize wifi access in some of our buildings, we are not using RADIUS at this point, but we are using WPA2 with PKI, the issue has recently come up that we want to keep our key private so we generally setup access for our users providing them the wifi key. The problem is that windows seems to give the option to go back into the wireless properties and unmask the PSK. We need to resolve this ASAP is there a way to make certain that the PSK remains masked regardless even if your logged in as a local administrator to the machine? Thanks in advance.

  Read the article

• SQL Server database constantly restarting

  - by Michael Itzoe

  We have SQL Server 2008 Express installed on a Windows 2003 server. Looking at the event log, one of the databases appears to be restarting anywhere from every couple seconds to every 15 to 30 minutes. This server hosts about half a dozen databases; the problem is with only one. This database is also the onle one comprised of multiple schemas (not just dbo). There are thousands of events going back several months. There doesn't seem to be any affect on the website using the database, nor does any data appear to be corrupted or compromised. I'm not a DBA, so I don't even know where to look for causes to this. Any suggestions?

  Read the article

• What would cause a single working website to not work on 1 out of 5 devices on a network?

  - by th3dude

  There is a specific website that loads up without problem on all machines on my network (both wired and wireless) except one laptop. This laptop is a Windows 7 machine that was just recovered using the recovery partition, so it is fresh. The site will not load in Firefox 3.6 or IE 8. The website is http://www.weightwacthers.com The site loads fine on my desktop, iPhone, and Droid, but not the laptop. In all my years in this business I've honestly never seen this happen. Also, 'Is it down for me or everyone' reports that it is indeed only me. What would cause this to happen?

  Read the article

• Mount drive at /Volumes/NAME/ or similar in Cygwin

  - by Adam

  Hi.. I'm using Cygwin on Windows 7. When I plug in an USB stick, the drive automatically gets mounted to /cygdrive/x . This is good and really easy to use. My problem is that the drive letter changes sometimes, and when I've got remotes set up in git - I've got one called usb at /cygdrive/h/ - this sometimes doesn't work and I have to change the remote URL. That's just an example, there are other scenarios where I wouldn't want it to change. I like what the Mac does, and puts mounts a volume at /Volumes/STICK (STICK is the Volume name of my usb stick). Is there any way I can do this, or something similar under Cygwin. Thanks

  Read the article

• Flash drive shows in My Computer but can't be accessed.

  - by Mr_Chimp

  I have a flash drive. When I plug it into my (Dell, Windows XP) computer it appears in My Computer as an empty drive - not a disk with no files on, a drive with no disk in! Double-clicking drive J: gives the message "Please insert a disk into drive J" (I get the same if I type in "J:" to the address bar, too...) Someone suggested going to properties and entering a name but it won't let me type in this box. I've looked in the disk manager and again it appears as an empty drive. I'm thinking that it might be fried...Can anyone give me any advice on how to either fix it or tell for sure that it's gone?

  Read the article

• Linux clients for Exchange (email and) calendar

  - by jplindstrom

  At $work, the official email solution is Outlook on Windows, connected to an Exchange server. That's problematic for people with Linux on their desktop machine. The Exchange server supports IMAP, and e-mail works fairly well using the usual suspects, e.g. Thunderbird. It also provides the web mail interface, which is fairly crap unless you use IE. (Any other favorite e-mail clients?) The biggest problem is the Outlook Calendar. I still have found no viable Linux client that can replace it. Any recommendations?

  Read the article

• Memory works fine separately, but not together

  - by patersonjs

  I've been given four 1GB Corsair DDR2 memory modules, and am trying to fit them into my computer but am getting BSOD on Windows XP and errors in Memtest86+. I've tried to identify if one particular module is faulty by trying them in pairs. They work fine in pairs, but when all four are inserted, Memtest86+ reports errors. The motherboard is an Asus P5N-E with dual channel support and the modules are all the same model (same speed, capacity and timings) but one pair is a different hardware revision. One is v2.1 and the other is v2.2... the voltages are the same too. Would this minor difference be a possible cause of the problem? I've got the BIOS memory timing settings all at AUTO - should I manually set the timings?

  Read the article

• Reverse Proxy Server SSL?

  - by valveLondon

  Context We currently have an Apache web server in the DMZ set up as a reverse proxy and load balancer for two machines running Windows Server 2008 (IIS) inside. The Apache server has a genuine SSL certificate and serves up both http and https, however, the balancer members in the load balancing section are set to: BalancerMember {https://server1} and {https://server2}. The IIS web servers have self-signed certificates in order to respond to the https requests. My question: Do we need to forward any requests from Apache (in the DMZ) to the inside using SSL? e.g can the reverse proxy forward the requests using HTTP? and if so, why would I choose to forward them with SSL? (how secure is the http line between the dmz and the inside); In other words, can I totally disable SSL on my inside web servers?

  Read the article

• Best alternatives to recover lost directories in FAT32 external hard drive?

  - by Sergio

  I have an 320 GB ADATA CH91 external hard drive. I guess it has some problems with the connector of the USB jack. The point is that in certain occasions it fails in write operations generating data losses. Right now I lost a directory with several GB's of very useful information. Since then I have not attempted to write to the disk any more. What tool would you recommend to recover the lost data? The disk is FAT32 formatted (only one partition) and I use both Linux and Windows. What filesystem format would you recommend to avoid future data losses? I currently only use this external hard drive in Linux so there are several available choices (FAT, NTFS, ext3, ext4, reiser, etc.).

  Read the article

• What is the secure way to isolate ftp server users on unix?

  - by djs

  I've read documentation for various ftp daemons and various long threads about the security implications of using a chroot environment for an ftp server when giving users write access. If you read the vsftpd documentation, in particular, it implies that using chroot_local_user is a security hazard, while not using it is not. There seems to be no coverage of the implications of allowing the user access to the entire filesystem (as permitted by their user and group membership), nor to the confusion this can create. So, I'd like to understand what is the correct method to use in practice. Should an ftp server with authenticated write-access users provide a non-chroot environment, a chroot environment, or some other option? Given that Windows ftp daemons don't have the option to use chroot, they need to implement isolation otherwise. Do any unix ftp daemons do something similar?

  Read the article

• How do I bridge connections in Debian?

  - by Josh

  In windows I can select Local Area Connection and Wireless Network Connection, right click and select Bridge Connections How can I achieve the same effect in Linux? (Debian to be exact) Pretty much I want Computer B to connect to Computer A via ethernet cable. Well Computer A is connected wirelessly. Allowing Computer B to get on the internet. == UPDATE == I've enabled IP forwarding and used the following iptables command: iptables -t nat -A POSTROUTING -o wlan0 -j MASQUERADE I'm still unable to access the internet from Computer B though.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• cannot using internet in VMWare

  - by user66247

  I am using VMware Workstation version 7 on Ubuntu 10.10. I installed Windows XP service pack 3 for guest os. Within VMWare, I am using bridge connection that I assigned static IP address to be able to ping host IP address but I cannot ping default router gateway. I also tried to command "/etc/init.d/vmware start" on terminal. All tasks are able to start successfully except "VM communication interface socket family" I am not sure that how to setup network for my VMWare by using wireless. Thanks in advance.

  Read the article

• Unable to open websites that use HTTPS on linux

  - by negai

  I have the following network configuration: My PC 192.168.1.20/24 uses 192.168.1.1/24 as a gateway. Dlink-2760U router with Local address 192.168.1.1/24 has a VPN connection open with the provider using PPTP. Whenever I'm trying to open some web-sites that has some authorization (e.g. gmail.com, coursera.org), I'm getting a request timeout. This problem is observed mostly on linux (Ubuntu 12.04 and Debian 6.0), while most of such websites work correctly on windows XP. Could you please help me diagnose the problem? Could it be related to NAT + HTTPS? Thanks

  Read the article

• Mac Snow Leopard Server DNS

  - by panomedia

  I have a Tomcat-driven application on my Windows server that I am planning to move to a MacMiniServer. Before I do this, I want to fully test the transition for licensing purposes. I have a Fire drive setup with Snow Leopard Server and the base app runs just fine BUT I need to be able to resolve the URL to my domain and not localhost. So, I figured I would setup panomedia.net in the DNS Server and also create an A record to my internal network IP so www.panomedia.net would dish out the same thing as localhost. The problem is: The Tomcat web app starts up going through panomedia.local and not through www.panomedia.net and My main network preference panel is still looking at my Comcast DNS search providers even though I put my local IP address as the only DNS Server and Search provider. I need to test this via an actual domain name before I commit to a 400GB data move. Can anyone help?

  Read the article

• Ubuntu 10.4 No internet

  - by Keeper780

  I have Ubuntu 10.4 dual booted with Windows Vista on a work Lenovo R61 laptop. The home and work wireless connection were working fine. I lost all internet connection at work. The IT guy clearly knew nothing about Linux. Since he 'fixed' it get nothing, no wlan signal the Network manager icon was gone, no internet. I still have the live disc and if I run from the live disc the connections are there and everything works perfectly. How do I restore the internet easily on my laptop. I have been using Linux for 3 Years but I am still a bit of a newbie, this is the first major problem I've had in three years. It's driving me nuts. Thanks

  Read the article

• Outlook 2010 and Exchange 2003

  - by user69644

  We've had some issues with a user who has upgraded to Outlook 2010 and attached to an internal Exchange 2003 SP2 server. They get errors more or less saying cannot send, contact your administrator and then a long error string whenever attempting to send. They receive just fine - but can't get any outbound flow. We recreate the users profile on another Windows 7 machine with Outlook 2010 and it worked fine. Concerned this might be an issue that rears it's ugly head later or at some random time. We noted some KB docs about the issue recommending registry changes - we've reviewed and ensure these changes were made and still have the issue on the one machine. Any thoughts?

  Read the article

• Where does the convention come from to use F9 for refresh?

  - by iconoclast

  Although in Windows F5 is the common (though not at all mnemonically appropriate!) keystroke to refresh the contents of a window, I've seen at least two different applications that use F9. One is the much-maligned Lotus Notes (which is actually quite good if you can overlook the abysmal user interface ;), and the other is muCommander. Since Lotus Notes has other non-standard conventions that apparently are borrowed from other places (such as Esc to close a Window) and because it's unlikely to be a source of influence for many applications, I'm betting both apps borrow from a common source (even if indirectly). What is that source? Where does F9 as the refresh key come from?

  Read the article

< Previous Page | 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015  | Next Page >