Search Results

Search found 26581 results on 1064 pages for 'multiple tables'.

Page 208/1064 | < Previous Page | 204 205 206 207 208 209 210 211 212 213 214 215  | Next Page >

  • backbone.js - Having multiple instances of the same view

    - by TrueWheel
    I am having problems having multiple instances in of the same view in different div elements. When I try to initialize them only the second of the two elements appear no matter what order I put them in. Here is the code for my view. var BodyShapeView = Backbone.View.extend({ thingiview: null, scene: null, renderer: null, model: null, mouseX: 0, mouseY: 0, events:{ 'click button#front' : 'front', 'click button#diag' : 'diag', 'click button#in' : 'zoomIn', 'click button#out' : 'zoomOut', 'click button#on' : 'rotateOn', 'click button#off' : 'rotateOff', 'click button#wireframeOn' : 'wireOn', 'click button#wireframeOff' : 'wireOff', 'click button#distance' : 'dijkstra' }, initialize: function(name){ _.bindAll(this, 'render', 'animate'); scene = new THREE.Scene(); camera = new THREE.PerspectiveCamera( 15, 400 / 700, 1, 4000 ); camera.position.z = 3; scene.add( camera ); camera.position.y = -5; var ambient = new THREE.AmbientLight( 0x202020 ); scene.add( ambient ); var directionalLight = new THREE.DirectionalLight( 0xffffff, 0.75 ); directionalLight.position.set( 0, 0, 1 ); scene.add( directionalLight ); var pointLight = new THREE.PointLight( 0xffffff, 5, 29 ); pointLight.position.set( 0, -25, 10 ); scene.add( pointLight ); var loader = new THREE.OBJLoader(); loader.load( "img/originalMeanModel.obj", function ( object ) { object.children[0].geometry.computeFaceNormals(); var geometry = object.children[0].geometry; console.log(geometry); THREE.GeometryUtils.center(geometry); geometry.dynamic = true; var material = new THREE.MeshLambertMaterial({color: 0xffffff, shading: THREE.FlatShading, vertexColors: THREE.VertexColors }); mesh = new THREE.Mesh(geometry, material); model = mesh; // model = object; scene.add( model ); } ); // RENDERER renderer = new THREE.WebGLRenderer(); renderer.setSize( 400, 700 ); $(this.el).find('.obj').append( renderer.domElement ); this.animate(); }, Here is how I create the instances var morphableBody = new BodyShapeView({ el: $("#morphable-body") }); var bodyShapeView = new BodyShapeView({ el: $("#mean-body") }); Any help would be really appreciated. Thanks in advance.

    Read the article

  • Regular expression Not working properly n case of multiple trailing ]]]]

    - by ronan
    I have the requirement that in a textbox a user can jump to the next word enclosed in [] on a tab out for example Hi [this] is [an] example. Testing [this] So when my cursor is at Hi and I do a tab out , the characters enclosed in the [this] are highlighted and when I again do a tabl out th next characters enclosed in following [an] are highlighted. This works fine Now the requirement is whatever the text including the special chars between [] needs to be highlighted case 1: when I have trailing ]]], it only highlights leading [[[ and ignores ]]]] e.g case 2: In case of multiple trailing ] e.e [this]]]] is [test], ideally one a single tabl out from this , it should go to next text enclosed in [] but a user has to tab out 4 times one tab per training ] to go to next [text] strong text The code is $(document).ready(function() { $('textarea').highlightTextarea({ color : '#0475D1', words : [ "/(\[.*?\])/g" ], textColor : '#000000' }); $('textarea').live('keydown', function(e) { var keyCode = e.keyCode || e.which; if (keyCode == 9) { var currentIndex = getCaret($(this).get(0)) selectText($(this), currentIndex); return false; } }); }); function selectText(element, currentIndex) { var rSearchTerm = new RegExp(/(\[.*?\])/); var ind = element.val().substr(currentIndex).search(rSearchTerm) currentIndex = (ind == -1 ? 0 : currentIndex); ind = (ind == -1 ? element.val().search(rSearchTerm) : ind); currentIndex = (ind == -1 ? 0 : currentIndex); var lasInd = (element.val().substr(currentIndex).search(rSearchTerm) == -1 ? 0 : element.val().substr(currentIndex).indexOf(']')); var input = element.get(0); if (input.setSelectionRange) { input.focus(); input.setSelectionRange(ind + currentIndex, lasInd + 1 + currentIndex); } else if (input.createTextRange) { var range = input.createTextRange(); range.collapse(true); range.moveEnd('character', lasInd + 1 + currentIndex); range.moveStart('character', ind + currentIndex); range.select(); } } function getCaret(el) { if (el.selectionEnd) { return el.selectionEnd; } else if (document.selection) { el.focus(); var r = document.selection.createRange(); if (r == null) { return 0; } var re = el.createTextRange(), rc = re.duplicate(); re.moveToBookmark(r.getBookmark()); rc.setEndPoint('EndToStart', re); return rc.text.length; } return 0; } Please let me know to handle two above cases

    Read the article

  • Can <Setter.Value> have multiple grids inside it

    - by Subhen
    Hi, I want to define the background for my application in App.XAML. The background was previously defined in another xaml page,which have multiple Grids inside it like following: <Grid x:Key="GridGeneric" d:LayoutOverrides="Width, Height"> <Grid.Background> <LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"> <GradientStop Color="#FF00172E" Offset="1"/> <GradientStop Color="#FF004074" Offset="0.433"/> <GradientStop Color="#FF081316"/> <GradientStop Color="#FF001D3F" Offset="0.215"/> <GradientStop Color="#FF002043" Offset="0.818"/> <GradientStop Color="#FF003B6C" Offset="0.642"/> </LinearGradientBrush> </Grid.Background> <Grid> <Grid.Background> <RadialGradientBrush RadiusY="0.973" GradientOrigin="0.497,-0.276" RadiusX="1.003"> <GradientStop Color="#FFB350EE" Offset="0"/> <GradientStop Color="#001D3037" Offset="0.847"/> </RadialGradientBrush> </Grid.Background> </Grid> ------ ----- </Grid> Now I want to place the same in my App.xaml like following: <Style x:Key="backgroundStyle" TargetType="Grid"> <Setter Property="Background"> <Setter.Value> <Grid> <Grid.Background> <LinearGradientBrush EndPoint="0.5,1" StartPoint="0.5,0"> <GradientStop Color="#FF00172E" Offset="1"/> <GradientStop Color="#FF004074" Offset="0.433"/> <GradientStop Color="#FF081316"/> <GradientStop Color="#FF001D3F" Offset="0.215"/> <GradientStop Color="#FF002043" Offset="0.818"/> <GradientStop Color="#FF003B6C" Offset="0.642"/> </LinearGradientBrush> </Grid.Background> <Grid> <Grid.Background> <RadialGradientBrush RadiusY="0.973" GradientOrigin="0.497,-0.276" RadiusX="1.003"> <GradientStop Color="#FFB350EE" Offset="0"/> <GradientStop Color="#001D3037" Offset="0.847"/> </RadialGradientBrush> </Grid.Background> </Grid> --------- --------- </Grid> </Setter.Value> </Setter> </Style> But While doing this I am getting the following Exception.

    Read the article

  • What is the most efficient way to study multiple languages, frameworks, and APIs as a developer?

    - by Akromyk
    I know there are those out there who have read a slurry of books on a specific technology and only code in that one particular language, but this question is aimed at those who need bounce around between using multiple technologies and yet still manage to be productive. What is the most efficient way to study multiple languages, frameworks, and APIs as a developer without becoming a cheap swiss army knife? And how much time should one dedicate to a particular subject before moving to another?

    Read the article

  • How to configure multiple WCF binding configurations for the same scheme

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • Configuring multiple WCF binding configurations for the same scheme doesn't work

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" bindingConfiguration="public" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" bindingConfiguration="public" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • How to configurie multiple distinct WCF binding configurations for the same scheme

    - by Sandor Drieënhuizen
    I have a set of IIS7-hosted net.tcp WCF services that serve my ASP.NET MVC web application. The web application is accessed over the internet. WCF Services (IIS7) <--> ASP.NET MVC Application <--> Client Browser The services are username authenticated, the account that a client (of my web application) uses to logon ends up as the current principal on the host. I want one of the services to be authenticated differently, because it serves the view model for my logon view. When it's called, the client is obviously not logged on yet. I figure Windows authentication serves best or perhaps just certificate based security (which in fact I should use for the authenticated services as well) if the services are hosted on a machine that is not in the same domain as the web application. That's not the point here though. Using multiple TCP bindings is what's giving me trouble. I tried setting it up like this in my client configuration: <bindings> <netTcpBinding> <binding> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <client> <endpoint contract="Server.IService1" binding="netTcpBinding" address="net.tcp://localhost:8081/Service1.svc"/> <endpoint contract="Server.IService2" binding="netTcpBinding" address="net.tcp://localhost:8081/Service2.svc"/> </client> The server configuration is this: <bindings> <netTcpBinding> <binding portSharingEnabled="true"> <security mode="TransportWithMessageCredential"> <message clientCredentialType="UserName"/> </security> </binding> <binding name="public"> <security mode="Transport"> <message clientCredentialType="Windows"/> </security> </binding> </netTcpBinding> </bindings> <services> <service name="Service1"> <endpoint contract="Server.IService1, Library" binding="netTcpBinding" address=""/> </service> <service name="Service2"> <endpoint contract="Server.IService2, Library" binding="netTcpBinding" address=""/> </service> </services> <serviceHostingEnvironment> <serviceActivations> <add relativeAddress="Service1.svc" service="Server.Service1"/> <add relativeAddress="Service2.svc" service="Server.Service2"/> </serviceActivations> </serviceHostingEnvironment> The thing is that both bindings don't seem to want live together in my host. When I remove either of them, all's fine but together they produce the following exception on the client: The requested upgrade is not supported by 'net.tcp://localhost:8081/Service2.svc'. This could be due to mismatched bindings (for example security enabled on the client and not on the server). In the server trace log, I find the following exception: Protocol Type application/negotiate was sent to a service that does not support that type of upgrade. Am I looking into the right direction or is there a better way to solve this?

    Read the article

  • Linker errors between multiple projects in Visual C++

    - by rlbond
    Hi, I have a solution with multiple projects. I have a "main" project, which acts as a menu and from there, the user can access any of the other projects. On this main project, I get linker errors for every function called. How do I avoid these linker errors? I set the project dependencies already in the "Project Dependencies..." dialog. Thanks EDIT -- I did as suggested and added the output folder to the linker's additional directories. Now, however, I get a million errors as follows: 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_ios ::setstate(int,bool)" (?setstate@?$basic_ios@DU?$char_traits@D@std@@@std@@QAEXH_N@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::width(int)" (?width@ios_base@std@@QAEHH@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::basic_streambuf ::sputn(char const *,int)" (?sputn@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEHPBDH@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static bool __cdecl std::char_traits::eq_int_type(int const &,int const &)" (?eq_int_type@?$char_traits@D@std@@SA_NABH0@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static int __cdecl std::char_traits::eof(void)" (?eof@?$char_traits@D@std@@SAHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::basic_streambuf ::sputc(char)" (?sputc@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEHD@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_streambuf * __thiscall std::basic_ios ::rdbuf(void)const " (?rdbuf@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEPAV?$basic_streambuf@DU?$char_traits@D@std@@@2@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: char __thiscall std::basic_ios ::fill(void)const " (?fill@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEDXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::flags(void)const " (?flags@ios_base@std@@QBEHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: int __thiscall std::ios_base::width(void)const " (?width@ios_base@std@@QBEHXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: static unsigned int __cdecl std::char_traits::length(char const *)" (?length@?$char_traits@D@std@@SAIPBD@Z) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_ostream & __thiscall std::basic_ostream ::flush(void)" (?flush@?$basic_ostream@DU?$char_traits@D@std@@@std@@QAEAAV12@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::basic_ostream * __thiscall std::basic_ios ::tie(void)const " (?tie@?$basic_ios@DU?$char_traits@D@std@@@std@@QBEPAV?$basic_ostream@DU?$char_traits@D@std@@@2@XZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: bool __thiscall std::ios_base::good(void)const " (?good@ios_base@std@@QBE_NXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_ostream ::_Osfx(void)" (?_Osfx@?$basic_ostream@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_streambuf ::_Lock(void)" (?_Lock@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: void __thiscall std::basic_streambuf ::_Unlock(void)" (?_Unlock@?$basic_streambuf@DU?$char_traits@D@std@@@std@@QAEXXZ) already defined in panels.lib(panel_main.obj) 3msvcprtd.lib(MSVCP90D.dll) : error LNK2005: "public: class std::locale::facet * __thiscall std::locale::facet::_Decref(void)" (?_Decref@facet@locale@std@@QAEPAV123@XZ) already defined in panels.lib(panel_main.obj) 3libcpmtd.lib(ios.obj) : error LNK2005: "private: static void __cdecl std::ios_base::_Ios_base_dtor(class std::ios_base *)" (?_Ios_base_dtor@ios_base@std@@CAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(ios.obj) : error LNK2005: "public: static void __cdecl std::ios_base::_Addstd(class std::ios_base *)" (?_Addstd@ios_base@std@@SAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "void __cdecl _AtModuleExit(void (__cdecl*)(void))" (?_AtModuleExit@@YAXP6AXXZ@Z) already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: __Fac_tidy already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static void __cdecl std::locale::facet::facet_Register(class std::locale::facet *)" (?facet_Register@facet@locale@std@@CAXPAV123@@Z) already defined in msvcprtd.lib(locale0_implib.obj) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static class std::locale::_Locimp * __cdecl std::locale::_Getgloballocale(void)" (?_Getgloballocale@locale@std@@CAPAV_Locimp@12@XZ) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "private: static class std::locale::_Locimp * __cdecl std::locale::_Init(void)" (?_Init@locale@std@@CAPAV_Locimp@12@XZ) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "public: static void __cdecl std::_Locinfo::_Locinfo_ctor(class std::_Locinfo *,class std::basic_string,class std::allocator const &)" (?_Locinfo_ctor@_Locinfo@std@@SAXPAV12@ABV?$basic_string@DU?$char_traits@D@std@@V?$allocator@D@2@@2@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(locale0.obj) : error LNK2005: "public: static void __cdecl std::_Locinfo::_Locinfo_dtor(class std::_Locinfo *)" (?_Locinfo_dtor@_Locinfo@std@@SAXPAV12@@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(xlock.obj) : error LNK2005: "public: __thiscall std::_Lockit::_Lockit(int)" (??0_Lockit@std@@QAE@H@Z) already defined in msvcprtd.lib(MSVCP90D.dll) 3libcpmtd.lib(xlock.obj) : error LNK2005: "public: __thiscall std::_Lockit::~_Lockit(void)" (??1_Lockit@std@@QAE@XZ) already defined in msvcprtd.lib(MSVCP90D.dll)

    Read the article

  • XSD Schema for XML with multiple structures

    - by Xetius
    I am attempting to write an XML Schema to cover a number of XML conditions which I may encounter. I have the same root element (serviceRequest) with different child elements. I was trying to use the xs:extension element to define multiple versions, but it is complaining about unexpected element orderInclusionCriteria etc. Am I going about this the right way, or is there a better way to define this? The other way I thought about this was to have a single xs:choice with all the options inside it, but this seemed somewhat inelegant. These XSD files are for use within XMLBeans if that makes any difference. I have Given the following 2 examples of XML: 1) <?xml version="1.0" encoding="utf-8"?> <serviceRequest method="GOO" debug="NO"> <sessionId sID="ABC1234567" /> <orderInclusionCriteria accountId="1234567" accountNum="1234567890" /> </serviceRequest> 2) <?xml version="1.0" encoding="utf-8"?> <serviceRequest method="GOO" debug="NO"> <sessionId sID="ABC1234567" /> <action aType='MakePayment'> <makePayment accountID='CH91015165S' amount='5.00' /> </action> </serviceRequest> I thought I could use the following schema file: <?xml version="1.0" encoding="UTF-8"?> <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="serviceRequest" type="ServiceRequestType" /> <xs:element name="session" type="SessionType" /> <xs:attribute name="method" type="xs:string" /> <xs:attribute name="debug" type="xs:string" /> <xs:complexType name="SessionType"> <xs:attribute name="sID" use="required"> <xs:simpleType> <xs:restriction base="xs:string"/> </xs:simpleType> </xs:attribute> </xs:complexType> <xs:complexType name="ServiceRequestType"> <xs:sequence> <xs:element ref="session" /> </xs:sequence> <xs:attribute ref="method" /> <xs:attribute ref="debug" /> </xs:complexType> <xs:complexType name="OrderTrackingServiceRequest"> <xs:complexContent> <xs:extension base="ServiceRequestType"> <xs:complexType> <xs:sequence> <xs:element name="OrderInclusionCriteria" type="xs:string" /> </xs:sequence> </xs:complexType> </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="Action"> <xs:complexContent> <xs:extension base="ServiceRequestType"> <xs:complexType> <xs:sequence> <xs:element name="makePayment"> <xs:complexType> <xs:attribute name="accountID" type="xs:string" /> <xs:attribute name="amount" type="xs:string" /> <xs:complexType> </xs:element> </xs:sequence> <xs:attribute name="aType" type="xs:string" /> </xs:complexType> </xs:extension> </xs:complexContent> </xs:complexType> </xs:schema>

    Read the article

  • Select Multiple Images Using GalleryView

    - by hwrdprkns
    Hi guys, I was just wondering if Android had built in code so that I could select multiple images in a gallery-view and then have those images exported as filenames in a string array(ex /sdcard/~f1.jpg, /sdcard/~f2.jpg,...). I have the gallery code here, but I'm not sure what modifications need to be made. Any help is appreciated. Thanks! // take_picture = (Button)findViewById(R.id.take_picture); // Here we set up a string array of the thumbnail ID column we want to // get back String[] proj = { MediaStore.Images.Thumbnails._ID }; if(proj.length == 0) { nopic.setVisibility(View.VISIBLE); } // Now we create the cursor pointing to the external thumbnail store cursor = managedQuery( MediaStore.Images.Thumbnails.EXTERNAL_CONTENT_URI, proj, // Which // columns // to // return null, // WHERE clause; which rows to return (all rows) null, // WHERE clause selection arguments (none) null); // Order-by clause (ascending by name) /* take_picture.setOnClickListener(new View.OnClickListener() { public void onClick(View v) { Intent i = new Intent(GalleryActivity.this, CameraActivity.class); startActivity(i); } }); */ // We now get the column index of the thumbnail id column_index = cursor .getColumnIndexOrThrow(MediaStore.Images.Thumbnails._ID); // Reference the Gallery view g = (Gallery) findViewById(R.id.gallery); if(proj.length == 0) { nopic.setVisibility(View.VISIBLE); g.setVisibility(View.GONE); } // Set the adapter to our custom adapter (below) g.setAdapter(new ImageAdapter(this)); // Set a item click listener, and just Toast the clicked position g.setOnItemClickListener(new OnItemClickListener() { public void onItemClick(AdapterView parent, View v, int position, long id) { // Now we want to actually get the data location of the file String[] proj = { MediaStore.Images.Media.DATA }; // We request our cursor again cursor = managedQuery( MediaStore.Images.Media.EXTERNAL_CONTENT_URI, proj, // Which // columns // to // return null, // WHERE clause; which rows to return (all rows) null, // WHERE clause selection arguments (none) null); // Order-by clause (ascending by name) // We want to get the column index for the data uri column_index = cursor .getColumnIndexOrThrow(MediaStore.Images.Media.DATA); // Lets move to the selected item in the cursor cursor.moveToPosition((int) g.getSelectedItemId()); // And here we get the filename String filename = cursor.getString(column_index); Log.v("GalleryActivity", filename); Toast.makeText(GalleryActivity.this, filename, Toast.LENGTH_SHORT).show(); setPrefs(filename); Intent i = new Intent(GalleryActivity.this, OtherClass.class); startActivity(i); } }); } And the ImageAdapter code here: public class ImageAdapter extends BaseAdapter { int mGalleryItemBackground; public ImageAdapter(Context c) { mContext = c; // See res/values/attrs.xml for the that defines // Gallery1. TypedArray a = obtainStyledAttributes(R.styleable.Gallery); mGalleryItemBackground = a.getResourceId( R.styleable.Gallery_android_galleryItemBackground, 0); a.recycle(); } public int getCount() { return cursor.getCount(); } public Object getItem(int position) { return position; } public long getItemId(int position) { return position; } public View getView(int position, View convertView, ViewGroup parent) { ImageView i = new ImageView(mContext); if (convertView == null) { cursor.moveToPosition(position); int id = cursor.getInt(column_index); i.setImageURI(Uri.withAppendedPath( MediaStore.Images.Thumbnails.EXTERNAL_CONTENT_URI, "" + id)); i.setScaleType(ImageView.ScaleType.FIT_XY); i.setLayoutParams(new Gallery.LayoutParams(200, 200)); // The preferred Gallery item background i.setBackgroundResource(mGalleryItemBackground); } return i; } } Again any help is appreciateds! Just to let you guys know, the gallery works fine (for one image) as in it exports the filename correctly. Just need to know if there is an easy way to select multiples and export them. Thanks again!

    Read the article

  • Difference between SQL 2005 and SQL 2008 for inserting multiple rows with XML

    - by Sam Dahan
    I am using the following SQL code for inserting multiple rows of data in a table. The data is passed to the stored procedure using an XML variable : INSERT INTO MyTable SELECT SampleTime = T.Item.value('SampleTime[1]', 'datetime'), Volume1 = T.Item.value('Volume1[1]', 'float'), Volume2 = T.Item.value('Volume2[1]', 'float') FROM @xml.nodes('//Root/MyRecord') T(item) I have a whole bunch of unit tests to verify that I am inserting the right information, the right number of records, etc.. when I call the stored procedure. All fine and dandy - that is, until we began to monkey around with the compatibility level of the database. The code above worked beautifully as long as we kept the compatibility level of the DB at 90 (SQL 2005). When we set the compatibility level at 100 (SQL 2008), the unit tests failed, because the stored procedure using the code above times out. The unit tests are dropping the database, re-creating it from scripts, and running the tests on the brand new DB, so it's not - I think - a question of the 'old compatibility level' sticking around. Using the SQL Management studio, I made up a quick test SQL script. Using the same XML chunk, I alter the DB compat level , truncate the table, then use the code above to insert 650 rows. When the level is 90 (SQL 2005), it runs in milliseconds. When the level is 100 (SQL 2008) it sometimes takes over a minute, sometimes runs in milliseconds. I'd appreciate any insight anyone might have into that. EDIT The script takes over a minute to run with my actual data, which has more rows than I show here, is a real table, and has an index. With the following example code, the difference goes between milliseconds and around 5 seconds. --use [master] --ALTER DATABASE MyDB SET compatibility_level =100 use [MyDB] declare @xml xml set @xml = '<?xml version="1.0"?> <Root xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <Record> <SampleTime>2009-01-24T00:00:00</SampleTime> <Volume1>0</Volume1> <Volume2>0</Volume2> </Record> ..... 653 records, sample time spaced out 4 hours ........ </Root>' DECLARE @myTable TABLE( ID int IDENTITY(1,1) NOT NULL, [SampleTime] [datetime] NOT NULL, [Volume1] [float] NULL, [Volume2] [float] NULL) INSERT INTO @myTable select T.Item.value('SampleTime[1]', 'datetime') as SampleTime, Volume1 = T.Item.value('Volume1[1]', 'float'), Volume2 = T.Item.value('Volume2[1]', 'float') FROM @xml.nodes('//Root/Record') T(item) I uncomment the 2 lines at the top, select them and run just that (the ALTER DATABASE statement), then comment the 2 lines, deselect any text and run the whole thing. When I change from 90 to 100, it runs all the time in 5 seconds (I change the level once, but I run the series several times to see if I have consistent results). When I change from 100 to 90, it runs in milliseconds all the time. Just so you can play with it too. I am using SQL Server 2008 R2 standard edition.

    Read the article

  • SQL Server 2008: Using Multiple dts Ranges to Build a Set of Dates

    - by raoulcousins
    I'm trying to build a query for a medical database that counts the number of patients that were on at least one medication from a class of medications (the medications listed below in the FAST_MEDS CTE) and had either: 1) A diagnosis of myopathy (the list of diagnoses in the FAST_DX CTE) 2) A CPK lab value above 1000 (the lab value in the FAST_LABS CTE) and this diagnosis or lab happened AFTER a patient was on a statin. The query I've included below does that under the assumption that once a patient is on a statin, they're on a statin forever. The first CTE collects the ids of patients that were on a statin along with the first date of their diagnosis, the second those with a diagnosis, and the third those with a high lab value. After this I count those that match the above criteria. What I would like to do is drop the assumption that once a patient is on a statin, they're on it for life. The table edw_dm.patient_medications has a column called start_dts and end_dts. This table has one row for each prescription written, with start_dts and end_dts denoting the start and end date of the prescription. End_dts could be null, which I'll take to assume that the patient is currently on this medication (it could be a missing record, but I can't do anything about this). If a patient is on two different statins, the start and ends dates can overlap, and there may be multiple records of the same medication for a patient, as in a record showing 3-11-2000 to 4-5-2003 and another for the same patient showing 5-6-2007 to 7-8-2009. I would like to use these two columns to build a query where I'm only counting the patients that had a lab value or diagnosis done during a time when they were already on a statin, or in the first n (say 3) months after they stopped taking a statin. I'm really not sure how to go about rewriting the first CTE to get this information and how to do the comparison after the CTEs are built. I know this is a vague question, but I'm really stumped. Any ideas? As always, thank you in advance. Here's the current query: WITH FAST_MEDS AS ( select distinct statins.mrd_pt_id, min(year(statins.order_dts)) as statin_yr from edw_dm.patient_medications as statins inner join mrd.medications as mrd on statins.mrd_med_id = mrd.mrd_med_id WHERE mrd.generic_nm in ( 'Lovastatin (9664708500)', 'lovastatin-niacin', 'Lovastatin/Niacin', 'Lovastatin', 'Simvastatin (9678583966)', 'ezetimibe-simvastatin', 'niacin-simvastatin', 'ezetimibe/Simvastatin', 'Niacin/Simvastatin', 'Simvastatin', 'Aspirin Buffered-Pravastatin', 'aspirin-pravastatin', 'Aspirin/Pravastatin', 'Pravastatin', 'amlodipine-atorvastatin', 'Amlodipine/atorvastatin', 'atorvastatin', 'fluvastatin', 'rosuvastatin' ) and YEAR(statins.order_dts) IS NOT NULL and statins.mrd_pt_id IS NOT NULL group by statins.mrd_pt_id ) select * into #meds from FAST_MEDS ; --return patients who had a diagnosis in the list and the year that --diagnosis was given with FAST_DX AS ( SELECT pd.mrd_pt_id, YEAR(pd.init_noted_dts) as init_yr FROM edw_dm.patient_diagnoses as pd inner join mrd.diagnoses as mrd on pd.mrd_dx_id = mrd.mrd_dx_id and mrd.icd9_cd in ('728.89','729.1','710.4','728.3','729.0','728.81','781.0','791.3') ) select * into #dx from FAST_DX; --return patients who had a high cpk value along with the year the cpk --value was taken with FAST_LABS AS ( SELECT pl.mrd_pt_id, YEAR(pl.order_dts) as lab_yr FROM edw_dm.patient_labs as pl inner join mrd.labs as mrd on pl.mrd_lab_id = mrd.mrd_lab_id and mrd.lab_nm = 'CK (CPK)' WHERE pl.lab_val between 1000 AND 999998 ) select * into #labs from FAST_LABS; -- count the number of patients who had a lab value or a medication -- value taken sometime AFTER their initial statin diagnosis select count(distinct p.mrd_pt_id) as ct from mrd.patient_demographics as p join #meds as m on p.mrd_pt_id = m.mrd_pt_id AND ( EXISTS ( SELECT 'A' FROM #labs l WHERE p.mrd_pt_id = l.mrd_pt_id and l.lab_yr >= m.statin_yr ) OR EXISTS( SELECT 'A' FROM #dx d WHERE p.mrd_pt_id = d.mrd_pt_id AND d.init_yr >= m.statin_yr ) )

    Read the article

  • using getScript to import plugin on page using multiple versions of jQuery

    - by mikez302
    I am developing an app on a page that uses jQuery 1.2.6, but I would like to use jQuery 1.4.2 for my app. I really don't like to use multiple versions of jQuery like this but the copy on the page (1.2.6) is something I have no control over. I decided to isolate my code like this: <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <html><head> <script type="text/javascript" src="jquery-1.2.6.min.js> <script type="text/javascript" src="pageStuff.js"> </head> <body> Welcome to our page. <div id="app"> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4.2/jquery.js"></script> <script type="text/javascript" src="myStuff.js"> </div> </body></html> The file myStuff.js has my own code that is supposed to use jQuery 1.4.2, and it looks like this: (function($) { //wrap everything in function to add ability to use $ var with noConflict var jQuery = $; //my code })(jQuery.noConflict(true)); This is an extremely simplified version, but I hope you get the idea of what I did. For a while, everything worked fine. However, I decided to want to use a jQuery plugin in a separate file. I tested it and it acted funny. After some experimentation, I found out that the plugin was using the old version of jQuery, when I wanted it to use the new version. Does anyone know how to import and run a js file from the context within the function wrapping the code in myStuff.js? In case this matters to anyone, here is how I know the plugin is using the old version, and what I did to try to solve the problem: I made a file called test.js, consisting of this line: alert($.fn.jquery); I tried referencing the file in a script tag the way external Javascript is usually included, below myStuff.js, and it came up as 1.2.6, like I expected. I then got rid of that script tag and put this line in myStuff.js: $.getScript("test.js"); and it still came back as 1.2.6. That wasn't a big surprise -- according to jQuery's documentation, scripts included that way are executed in the global context. I then tried doing this instead: var testFn = $.proxy($.getScript, this); testFn("test.js"); and it still came back as 1.2.6. After some tinkering, I found out that the "this" keyword referred to the window, which I assume means the global context. I am looking for something to put in place of "this" to refer to the context of the enclosing function, or some other way to make the code in the file run from the enclosing function. I noticed that if I copy and paste the code, it works fine, but it is a big plugin that is used in many places, and I would prefer not to clutter up my file with their code. I am out of ideas. Does anyone else know how to do this?

    Read the article

  • Reuse a facelet in multiple beans

    - by Seitaridis
    How do I invoke/access a property of a managed bean when the bean name is known, but is not yet constructed? For example: <p:selectOneMenu value="#{eval.evaluateAsBean(bean).text}" > <f:selectItems value="#{eval.evaluateAsBean(bean).values}" var="val" itemLabel="#{val}" itemValue="#{val}" /> </p:selectOneMenu> If there is a managed bean called testBean and in my view bean has the "testBean"value, I want the text or values property of testBean to be called. EDIT1 The context An object consists of a list of properties(values). One property is modified with a custom JSF editor, depending on its type. The list of editors is determined from the object's type, and displayed in a form using custom:include tags. This custom tag is used to dynamically include the editors <custom:include src="#{editor.component}">. The component property points to the location of the JSF editor. In my example some editors(rendered as select boxes) will use the same facelet(dynamicDropdown.xhtml). Every editor has a session scoped managed bean. I want to reuse the same facelet with multiple beans and to pass the name of the bean to dynamicDropdown.xhtml using the bean param. genericAccount.xhtml <p:dataTable value="#{group.editors}" var="editor"> <p:column headerText="Key"> <h:outputText value="#{editor.name}" /> </p:column> <p:column headerText="Value"> <h:panelGroup rendered="#{not editor.href}"> <h:outputText value="#{editor.component}" escape="false" /> </h:panelGroup> <h:panelGroup rendered="#{editor.href}"> <custom:include src="#{editor.component}"> <ui:param name="enabled" value="#{editor.enabled}"/> <ui:param name="bean" value="#{editor.bean}"/> <custom:include> </h:panelGroup> </p:column> </p:dataTable> #{editor.component} refers to a dynamicDropdown.xhtml file. dynamicDropdown.xhtml <ui:composition xmlns="http://www.w3.org/1999/xhtml" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:p="http://primefaces.prime.com.tr/ui"> <p:selectOneMenu value="#{eval.evaluateAsBean(bean).text}" > <f:selectItems value="#{eval.evaluateAsBean(bean).values}" var="val" itemLabel="#{val}" itemValue="#{val}" /> </p:selectOneMenu> </ui:composition> eval is a managed bean: @ManagedBean(name = "eval") @ApplicationScoped public class ELEvaluator { ... public Object evaluateAsBean(String el) { FacesContext context = FacesContext.getCurrentInstance(); Object bean = context.getELContext() .getELResolver().getValue(context.getELContext(), null, el); return bean; } ... }

    Read the article

  • Multiple data series in real time plot

    - by Gr3n
    Hi, I'm kind of new to Python and trying to create a plotting app for values read via RS232 from a sensor. I've managed (after some reading and copying examples online) to get a plot working that updates on a timer which is great. My only trouble is that I can't manage to get multiple data series into the same plot. Does anyone have a solution to this? This is the code that I've worked out this far: import os import pprint import random import sys import wx # The recommended way to use wx with mpl is with the WXAgg backend import matplotlib matplotlib.use('WXAgg') from matplotlib.figure import Figure from matplotlib.backends.backend_wxagg import FigureCanvasWxAgg as FigCanvas, NavigationToolbar2WxAgg as NavigationToolbar import numpy as np import pylab DATA_LENGTH = 100 REDRAW_TIMER_MS = 20 def getData(): return int(random.uniform(1000, 1020)) class GraphFrame(wx.Frame): # the main frame of the application def __init__(self): wx.Frame.__init__(self, None, -1, "Usart plotter", size=(800,600)) self.Centre() self.data = [] self.paused = False self.create_menu() self.create_status_bar() self.create_main_panel() self.redraw_timer = wx.Timer(self) self.Bind(wx.EVT_TIMER, self.on_redraw_timer, self.redraw_timer) self.redraw_timer.Start(REDRAW_TIMER_MS) def create_menu(self): self.menubar = wx.MenuBar() menu_file = wx.Menu() m_expt = menu_file.Append(-1, "&Save plot\tCtrl-S", "Save plot to file") self.Bind(wx.EVT_MENU, self.on_save_plot, m_expt) menu_file.AppendSeparator() m_exit = menu_file.Append(-1, "E&xit\tCtrl-X", "Exit") self.Bind(wx.EVT_MENU, self.on_exit, m_exit) self.menubar.Append(menu_file, "&File") self.SetMenuBar(self.menubar) def create_main_panel(self): self.panel = wx.Panel(self) self.init_plot() self.canvas = FigCanvas(self.panel, -1, self.fig) # pause button self.pause_button = wx.Button(self.panel, -1, "Pause") self.Bind(wx.EVT_BUTTON, self.on_pause_button, self.pause_button) self.Bind(wx.EVT_UPDATE_UI, self.on_update_pause_button, self.pause_button) self.hbox1 = wx.BoxSizer(wx.HORIZONTAL) self.hbox1.Add(self.pause_button, border=5, flag=wx.ALL | wx.ALIGN_CENTER_VERTICAL) self.vbox = wx.BoxSizer(wx.VERTICAL) self.vbox.Add(self.canvas, 1, flag=wx.LEFT | wx.TOP | wx.GROW) self.vbox.Add(self.hbox1, 0, flag=wx.ALIGN_LEFT | wx.TOP) self.panel.SetSizer(self.vbox) #self.vbox.Fit(self) def create_status_bar(self): self.statusbar = self.CreateStatusBar() def init_plot(self): self.dpi = 100 self.fig = Figure((3.0, 3.0), dpi=self.dpi) self.axes = self.fig.add_subplot(111) self.axes.set_axis_bgcolor('white') self.axes.set_title('Usart data', size=12) pylab.setp(self.axes.get_xticklabels(), fontsize=8) pylab.setp(self.axes.get_yticklabels(), fontsize=8) # plot the data as a line series, and save the reference # to the plotted line series # self.plot_data = self.axes.plot( self.data, linewidth=1, color="blue", )[0] def draw_plot(self): # redraws the plot xmax = len(self.data) if len(self.data) > DATA_LENGTH else DATA_LENGTH xmin = xmax - DATA_LENGTH ymin = 0 ymax = 4096 self.axes.set_xbound(lower=xmin, upper=xmax) self.axes.set_ybound(lower=ymin, upper=ymax) # enable grid #self.axes.grid(True, color='gray') # Using setp here is convenient, because get_xticklabels # returns a list over which one needs to explicitly # iterate, and setp already handles this. # pylab.setp(self.axes.get_xticklabels(), visible=True) self.plot_data.set_xdata(np.arange(len(self.data))) self.plot_data.set_ydata(np.array(self.data)) self.canvas.draw() def on_pause_button(self, event): self.paused = not self.paused def on_update_pause_button(self, event): label = "Resume" if self.paused else "Pause" self.pause_button.SetLabel(label) def on_save_plot(self, event): file_choices = "PNG (*.png)|*.png" dlg = wx.FileDialog( self, message="Save plot as...", defaultDir=os.getcwd(), defaultFile="plot.png", wildcard=file_choices, style=wx.SAVE) if dlg.ShowModal() == wx.ID_OK: path = dlg.GetPath() self.canvas.print_figure(path, dpi=self.dpi) self.flash_status_message("Saved to %s" % path) def on_redraw_timer(self, event): if not self.paused: newData = getData() self.data.append(newData) self.draw_plot() def on_exit(self, event): self.Destroy() def flash_status_message(self, msg, flash_len_ms=1500): self.statusbar.SetStatusText(msg) self.timeroff = wx.Timer(self) self.Bind( wx.EVT_TIMER, self.on_flash_status_off, self.timeroff) self.timeroff.Start(flash_len_ms, oneShot=True) def on_flash_status_off(self, event): self.statusbar.SetStatusText('') if __name__ == '__main__': app = wx.PySimpleApp() app.frame = GraphFrame() app.frame.Show() app.MainLoop()

    Read the article

  • Hover/Fadeto/Toggle Multiple Class Changing

    - by Slick Willis
    So my problem is rather simple and complex at the same time. I am trying to create links that fade in when you mouseover them and fade out when you mouseout of them. At the same time that you are going over them I would like a pic to slide from the left. This is the easy part, I have every thing working. The image fades and another image slides. I did this by using a hover, fadeto, and toggle("slide"). I would like to do this in a table format with multiple images being able to be scrolled over and sliding images out. The problem is that I am calling my sliding image to a class and when I hover over the letters both images slide out. Does anybody have a solution for this? I posted the code that I used below: <html> <head> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-1.4.2.min.js'></script> <script type='text/javascript' src='http://accidentalwords.squarespace.com/storage/jquery/jquery-custom-181/jquery-ui-1.8.1.custom.min.js'></script> <style type="text/css"> .text-slide { display: none; margin: 0px; width: 167px; height: 50px; } </style> <script> $(document).ready(function(){ $(".letterbox-fade").fadeTo(1,0.25); $(".letterbox-fade").hover(function () { $(this).stop().fadeTo(250,1); $(".text-slide").toggle("slide", {}, 1000); }, function() { $(this).stop().fadeTo(250,0.25); $(".text-slide").toggle("slide", {}, 1000); }); }); </script> </head> <body style="background-color: #181818"> <table> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/A-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> <tr> <td><div class="letterbox-fade"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/B-Letterbox-Selected.png" /></div></td> <td><div class="text-slide"><img src="http://accidentalwords.squarespace.com/storage/sidebar/icons/TEST.png" /></div></td> </tr> </table> </body> </html>

    Read the article

  • opengl - Rendering multiple cubes

    - by opiop65
    I have this code (Doesn't work at all) static void initGl() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glMatrixMode(GL_PROJECTION); glLoadIdentity(); GLU.gluPerspective(45.0f, Display.getWidth() / Display.getHeight(), 1.0f, 1000.0f); glMatrixMode(GL_MODELVIEW); glLoadIdentity(); glClearColor(0.0f, 0.0f, 0.0f, 0.0f); glClearDepth(1.0f); glDepthFunc(GL_LEQUAL); glEnable(GL_DEPTH_TEST); glShadeModel(GL_SMOOTH); glHint(GL_PERSPECTIVE_CORRECTION_HINT, GL_NICEST); } public static void renderGL() { glViewport(0, 0, Display.getWidth(), Display.getHeight()); glClearColor(0.0f, 0.0f, 0.0f, 0.5f); glLoadIdentity(); glTranslatef(0.0f, 0.0f, -60.0f); drawCube(); } public static void drawCube() { for (int x = 0; x < 100; x++) { for (int y = 0; y < 100; y++) { for (int z = 0; z < 100; z++) { glBegin(GL_QUADS); glColor3f(1, 0, 0); glVertex3f(-x, -y, z); glVertex3f(x, -y, z); glVertex3f(x, y, z); glVertex3f(-x, y, z); glColor3f(1, 0, 1); glVertex3f(x, -y, -z); glVertex3f(-x, -y, -z); glVertex3f(-x, y, -z); glVertex3f(x, y, -z); glColor3f(1, 1, 1); glVertex3f(-x, y, z); glVertex3f(x, y, z); glVertex3f(x, y, -z); glVertex3f(-x, y, -z); glColor3f(0, 0, 1); glVertex3f(x, -y, z); glVertex3f(-x, -y, z); glVertex3f(-x, -y, -z); glVertex3f(x, -y, -z); glColor3f(1, 1, 0); glVertex3f(x, -y, z); glVertex3f(x, -y, -z); glVertex3f(x, y, -z); glVertex3f(x, y, z); glColor3f(0, 2, 1); glVertex3f(-x, -y, -z); glVertex3f(-x, -y, z); glVertex3f(-x, y, z); glVertex3f(-x, y, -z); glEnd(); } } } All it does it freeze up the program and eventually it will render the red side of the cube. This obviously has to do with gltranslatef, but I don't know why that isn't working. My question is, how do I render multiple cubes at once? Are there any tutorials out there on voxel engines? Sorry for the horrible code, I realize I probably need a array to do this. I'm quite new at opengl.

    Read the article

  • Get Two row with multiple column in asp.net c#

    - by Gaurav Naik
    How to get data from database with two rows and multiple column with seperator will be there after the 1 row end as an example: <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box3"> <div class="_t1_box"><a href="#"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div> <div class="_thum_bar"> <div class="box1"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> <div class="box2"> <div class="_t1_box"><a href="#!/condom_details"><img src="images/pack/pack1.png" border="0"></a></div> <div class="_t2_box"> <h1>Dotted Condom</h1> <p>Dotted condoms for additional friction. Pure ecstasy makes this a KamaSutra all time favourite.</p> <h2><a href="#!/condom_details">Add to cart</a></h2> </div> </div> </div> <div class="_t_spacer">&nbsp;</div>

    Read the article

  • multiple timer to one process (without linking to rt)

    - by Richard
    Hi, is there any way to register multiple timer to a single process? I have tried following code, yet without success. (Use "gcc -lrt" to compile it...). Program output nothing, which should atleast print "test". Is it possibly due to the dependence to linking to rt? #define TT_SIGUSR1 (SIGRTMAX) #define TT_SIGUSR2 (SIGRTMAX - 1) #define TIME_INTERVAL_1 1 #define TIME_INTERVAL_2 2 #include <signal.h> #include <time.h> #include <stdio.h> #include <unistd.h> #include <linux/unistd.h> #include <sys/syscall.h> #include <sys/time.h> #include <sys/types.h> #include <sched.h> #include <signal.h> #include <setjmp.h> #include <errno.h> #include <assert.h> timer_t create_timer(int signo) { timer_t timerid; struct sigevent se; se.sigev_signo = signo; if (timer_create(CLOCK_REALTIME, &se, &timerid) == -1) { fprintf(stderr, "Failed to create timer\n"); exit(-1); } return timerid; } void set_timer(timer_t timerid, int seconds) { struct itimerspec timervals; timervals.it_value.tv_sec = seconds; timervals.it_value.tv_nsec = 0; timervals.it_interval.tv_sec = seconds; timervals.it_interval.tv_nsec = 0; if (timer_settime(timerid, 0, &timervals, NULL) == -1) { fprintf(stderr, "Failed to start timer\n"); exit(-1); } return; } void install_sighandler2(int signo, void(*handler)(int)) { struct sigaction sigact; sigemptyset(&sigact.sa_mask); sigact.sa_flags = SA_SIGINFO; //register the Signal Handler sigact.sa_sigaction = handler; // Set up sigaction to catch signal first timer if (sigaction(signo, &sigact, NULL) == -1) { printf("sigaction failed"); return -1; } } void install_sighandler(int signo, void(*handler)(int)) { sigset_t set; struct sigaction act; /* Setup the handler */ act.sa_handler = handler; act.sa_flags = SA_RESTART; sigaction(signo, &act, 0); /* Unblock the signal */ sigemptyset(&set); sigaddset(&set, signo); sigprocmask(SIG_UNBLOCK, &set, NULL); return; } void signal_handler(int signo) { printf("receiving sig %d", signo); } int main() { printf("test"); timer_t timer1 = create_timer(TT_SIGUSR1); timer_t timer2 = create_timer(TT_SIGUSR2); set_timer(timer1, TIME_INTERVAL_1); set_timer(timer2, TIME_INTERVAL_2); install_sighandler2(TT_SIGUSR1, signal_handler); install_sighandler(TT_SIGUSR2, signal_handler); while (1) ; return 0; }

    Read the article

  • PHP-How to Pass Multiple Value In Form Field

    - by Tall boY
    hi i have a php based sorting method with drop down menu to sort no of rows, it is working fine. i have another sorting links to sort id & title, it is also working fine. but together they are not working fine. what happens is that when i sort(say by title) using links, result gets sorted by title, then if i sort rows using drop down menu rows get sorted but result gets back to default of id sort. sorting codes for id & tite is if ($orderby == 'title' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=asc'>title-asc:</a></li> ";} if ($orderby == 'title' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=title&sort=desc'>title-desc:</a></li> ";} if ($orderby == 'id' && $sortby == 'asc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=asc'>id-asc:</a></li> ";} if ($orderby == 'id' && $sortby == 'desc') {echo " <li id='scurrent'><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} else {echo " <li><a href='?rpp=$rowsperpage&order=id&sort=desc'>id-desc:</a></li> ";} ?> sorting codes for rows is <form action="is-test.php" method="get"> <select name="rpp" onchange="this.form.submit()"> <option value="10" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this method passes only rows per page(rpp) into url. i want it to pass order, sort& rpp. is there a way around to pass multiple values in form fields like this. <form action="is-test.php" method="get"> <select name="rpp, order, sort" onchange="this.form.submit()"> <option value="10, $orderby, $sortby" <?php if ($rowsperpage == 10) echo 'selected="selected"' ?>>10</option> <option value="20, $orderby, $sortby" <?php if ($rowsperpage == 20) echo 'selected="selected"' ?>>20</option> <option value="30, $orderby, $sortby" <?php if ($rowsperpage == 30) echo 'selected="selected"' ?>>30</option> </select> </form> this may seem silly but it just to give you an idea of what i am trying to implement,(i am very new to php) please suggest any way to make this work. thanks

    Read the article

  • NoMethodError Rails multiple file uploads

    - by Danny McClelland
    Hi Everyone, I am working on getting multiple file uploads working for an model in my application, I have included the code below: delivers_controller.rb # POST /delivers def create @deliver = Deliver.new(params[:deliver]) process_file_uploads(@deliver) if @deliver.save flash[:notice] = 'Task was successfully created.' redirect_to(@deliver) else render :action => "new" end end protected def process_file_uploads(deliver) i = 0 while params[:attachment]['file_'+i.to_s] != "" && !params[:attachment]['file_'+i.to_s].nil? deliver.assets.build(:data => params[:attachment]['file_'+i.to_s]) i += 1 end end deliver.rb has_many :assets, :as => :attachable, :dependent => :destroy validate :validate_attachments Max_Attachments = 5 Max_Attachment_Size = 5.megabyte def validate_attachments errors.add_to_base("Too many attachments - maximum is #{Max_Attachments}") if assets.length > Max_Attachments assets.each {|a| errors.add_to_base("#{a.name} is over #{Max_Attachment_Size/1.megabyte}MB") if a.file_size > Max_Attachment_Size} end assets_controller.rb class AssetsController < ApplicationController def show asset = Asset.find(params[:id]) # do security check here send_file asset.data.path, :type => asset.data_content_type end def destroy asset = Asset.find(params[:id]) @asset_id = asset.id.to_s @allowed = Deliver::Max_Attachments - asset.attachable.assets.count asset.destroy end end asset.rb class Asset < ActiveRecord::Base has_attached_file :data, belongs_to :attachable, :polymorphic => true def url(*args) data.url(*args) end def name data_file_name end def content_type data_content_type end def file_size data_file_size end end Whenever I create a new deliver item and try to attach any files I get the following error: NoMethodError in DeliversController#create You have a nil object when you didn't expect it! You might have expected an instance of ActiveRecord::Base. The error occurred while evaluating nil.[] /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:60:in `process_file_uploads' /Users/danny/Dropbox/SVN/railsapps/macandco/surveymanager/trunk/app/controllers/delivers_controller.rb:46:in `create' new.html.erb (Deliver view) <% content_for :header do -%> Deliver Repositories <% end -%> <% form_for(@deliver, :html => { :multipart => true }) do |f| %> <%= f.error_messages %> <p> <%= f.label :caseref %><br /> <%= f.text_field :caseref %> </p> <p> <%= f.label :casesubject %><br /> <%= f.text_area :casesubject %> </p> <p> <%= f.label :description %><br /> <%= f.text_area :description %> </p> <p>Pending Attachments: (Max of <%= Deliver::Max_Attachments %> each under <%= Deliver::Max_Attachment_Size/1.megabyte%>MB) <% if @deliver.assets.count >= Deliver::Max_Attachments %> <input id="newfile_data" type="file" disabled /> <% else %> <input id="newfile_data" type="file" /> <% end %> <div id="attachment_list"><ul id="pending_files"></ul></div> </p> <p> <%= f.submit 'Create' %> </p> <% end %> <%= link_to 'Back', delivers_path %> Show.html.erb (Delivers view) <% content_for :header do -%> Deliver Repositories <% end -%> <p> <b>Title:</b> <%=h @deliver.caseref %> </p> <p> <b>Body:</b> <%=h @deliver.casesubject %> </p> <p><b>Attached Files:</b><div id="attachment_list"><%= render :partial => "attachment", :collection => @deliver.assets %></div></p> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', deliver_path %> <%- if logged_in? %> <%= link_to 'Edit', edit_deliver_path(@deliver) %> | <%= link_to 'Back', delivers_path %> <% end %> _attachment.html.erb (Delivers view) <% if !attachment.id.nil? %><li id='attachment_<%=attachment.id %>'><a href='<%=attachment.url %>'><%=attachment.name %></a> (<%=attachment.file_size/1.kilobyte %>KB) <%= link_to_remote "Remove", :url => asset_path(:id => attachment), :method => :delete, :html => { :title => "Remove this attachment", :id => "remove" } %></li> <% end %> I have been banging my head against the wall with the error all day, if anyone can shed some light on it, I would be eternally grateful! Thanks, Danny

    Read the article

  • How to publish multiple jar files to maven on a clean install

    - by Abhijit Hukkeri
    I have a used the maven assembly plugin to create multiple jar from one jar now the problem is that I have to publish these jar to the local repo, just like other maven jars publish by them self when they are built maven clean install how will I be able to do this here is my pom file <project> <parent> <groupId>parent.common.bundles</groupId> <version>1.0</version> <artifactId>child-bundle</artifactId> </parent> <modelVersion>4.0.0</modelVersion> <groupId>common.dataobject</groupId> <artifactId>common-dataobject</artifactId> <packaging>jar</packaging> <name>common-dataobject</name> <version>1.0</version> <dependencies> </dependencies> <build> <plugins> <plugin> <groupId>org.jibx</groupId> <artifactId>maven-jibx-plugin</artifactId> <version>1.2.1</version> <configuration> <directory>src/main/resources/jibx_mapping</directory> <includes> <includes>binding.xml</includes> </includes> <verbose>false</verbose> </configuration> <executions> <execution> <goals> <goal>bind</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-assembly-plugin</artifactId> <executions> <execution> <id>make-business-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>flight-dto</finalName> <descriptors> <descriptor>src/main/assembly/car-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> <execution> <id>make-gui-assembly</id> <phase>package</phase> <goals> <goal>single</goal> </goals> <configuration> <appendAssemblyId>false</appendAssemblyId> <finalName>app_gui</finalName> <descriptors> <descriptor>src/main/assembly/bike-assembly.xml</descriptor> </descriptors> <attach>true</attach> </configuration> </execution> </executions> </plugin> </plugins> </build> </project> Here is my assembly file <assembly> <id>app_business</id> <formats> <format>jar</format> </formats> <baseDirectory>target</baseDirectory> <includeBaseDirectory>false</includeBaseDirectory> <fileSets> <fileSet> <directory>${project.build.outputDirectory}</directory> <outputDirectory></outputDirectory> <includes> <include>com/dataobjects/**</include> </includes> </fileSet> </fileSets> </assembly>

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 204 205 206 207 208 209 210 211 212 213 214 215  | Next Page >