Search Results

Search found 5274 results on 211 pages for 'stream operators'.

Page 208/211 | < Previous Page | 204 205 206 207 208 209 210 211  | Next Page >

  • Unable to Create New Incidents in Dynamics CRM with Java and Axis2

    - by Lutz
    So I've been working on trying to figure this out, oddly when I ran it one machine I got a generic Axis Fault with no description, but now on another machine I'm getting a different error message, but I'm still stuck. Basically I'm just trying to do what I thought would be a fairly trivial task of creating a new incident in Microsoft Dynamics CRM 4.0 via a web services call. I started by downloading the XML from http://hostname/MSCrmServices/2007/CrmService.asmx and generating code from it using Axis2. Anyway, here's my program, any help would be greatly appreciated, as I've been stuck on this for way longer than I thought I'd be and I'm really out of ideas here. public class TestCRM { private static String endpointURL = "http://theHost/MSCrmServices/2007/CrmService.asmx"; private static String userName = "myUserNameHere"; private static String password = "myPasswordHere"; private static String host = "theHostname"; private static int port = 80; private static String domain = "theDomain"; private static String orgName = "theOrganization"; public static void main(String[] args) { CrmServiceStub stub; try { stub = new CrmServiceStub(endpointURL); setOptions(stub._getServiceClient().getOptions()); RetrieveMultipleDocument rmd = RetrieveMultipleDocument.Factory.newInstance(); com.microsoft.schemas.crm._2007.webservices.RetrieveMultipleDocument.RetrieveMultiple rm = com.microsoft.schemas.crm._2007.webservices.RetrieveMultipleDocument.RetrieveMultiple.Factory.newInstance(); QueryExpression query = QueryExpression.Factory.newInstance(); query.setColumnSet(AllColumns.Factory.newInstance()); query.setEntityName(EntityName.INCIDENT.toString()); rm.setQuery(query); rmd.setRetrieveMultiple(rm); TargetCreateIncident tinc = TargetCreateIncident.Factory.newInstance(); Incident inc = tinc.addNewIncident(); inc.setDescription("This is a test of ticket creation through a web services call."); CreateDocument cd = CreateDocument.Factory.newInstance(); Create create = Create.Factory.newInstance(); create.setEntity(inc); cd.setCreate(create); Incident test = (Incident)cd.getCreate().getEntity(); CrmAuthenticationTokenDocument catd = CrmAuthenticationTokenDocument.Factory.newInstance(); CrmAuthenticationToken token = CrmAuthenticationToken.Factory.newInstance(); token.setAuthenticationType(0); token.setOrganizationName(orgName); catd.setCrmAuthenticationToken(token); //The two printlns below spit back XML that looks okay to me? System.out.println(cd); System.out.println(catd); /* stuff that doesn't work */ CreateResponseDocument crd = stub.create(cd, catd, null, null); //this line throws the error CreateResponse cr = crd.getCreateResponse(); System.out.println("create result: " + cr.getCreateResult()); /* End stuff that doesn't work */ System.out.println(); System.out.println(); System.out.println(); boolean fetchNext = true; while(fetchNext){ RetrieveMultipleResponseDocument rmrd = stub.retrieveMultiple(rmd, catd, null, null); //This retrieve using the CRMAuthenticationToken catd works just fine RetrieveMultipleResponse rmr = rmrd.getRetrieveMultipleResponse(); BusinessEntityCollection bec = rmr.getRetrieveMultipleResult(); String pagingCookie = bec.getPagingCookie(); fetchNext = bec.getMoreRecords(); ArrayOfBusinessEntity aobe = bec.getBusinessEntities(); BusinessEntity[] myEntitiesAtLast = aobe.getBusinessEntityArray(); for(int i=0; i<myEntitiesAtLast.length; i++){ //cast to whatever you asked for... Incident myEntity = (Incident) myEntitiesAtLast[i]; System.out.println("["+(i+1)+"]: " + myEntity); } } } catch (Exception e) { e.printStackTrace(); } } private static void setOptions(Options options){ HttpTransportProperties.Authenticator auth = new HttpTransportProperties.Authenticator(); List authSchemes = new ArrayList(); authSchemes.add(HttpTransportProperties.Authenticator.NTLM); auth.setAuthSchemes(authSchemes); auth.setUsername(userName); auth.setPassword(password); auth.setHost(host); auth.setPort(port); auth.setDomain(domain); auth.setPreemptiveAuthentication(false); options.setProperty(HTTPConstants.AUTHENTICATE, auth); options.setProperty(HTTPConstants.REUSE_HTTP_CLIENT, "true"); } } Also, here's the error message I receive: org.apache.axis2.AxisFault: com.ctc.wstx.exc.WstxUnexpectedCharException: Unexpected character 'S' (code 83) in prolog; expected '<' at [row,col {unknown-source}]: [1,1] at org.apache.axis2.AxisFault.makeFault(AxisFault.java:430) at org.apache.axis2.transport.TransportUtils.createSOAPMessage(TransportUtils.java:123) at org.apache.axis2.transport.TransportUtils.createSOAPMessage(TransportUtils.java:67) at org.apache.axis2.description.OutInAxisOperationClient.handleResponse(OutInAxisOperation.java:354) at org.apache.axis2.description.OutInAxisOperationClient.send(OutInAxisOperation.java:417) at org.apache.axis2.description.OutInAxisOperationClient.executeImpl(OutInAxisOperation.java:229) at org.apache.axis2.client.OperationClient.execute(OperationClient.java:165) at com.spanlink.crm.dynamics4.webservice.CrmServiceStub.create(CrmServiceStub.java:618) at com.spanlink.crm.dynamics4.runtime.TestCRM.main(TestCRM.java:82) Caused by: org.apache.axiom.om.OMException: com.ctc.wstx.exc.WstxUnexpectedCharException: Unexpected character 'S' (code 83) in prolog; expected '<' at [row,col {unknown-source}]: [1,1] at org.apache.axiom.om.impl.builder.StAXOMBuilder.next(StAXOMBuilder.java:260) at org.apache.axiom.soap.impl.builder.StAXSOAPModelBuilder.getSOAPEnvelope(StAXSOAPModelBuilder.java:161) at org.apache.axiom.soap.impl.builder.StAXSOAPModelBuilder.<init>(StAXSOAPModelBuilder.java:110) at org.apache.axis2.builder.BuilderUtil.getSOAPBuilder(BuilderUtil.java:682) at org.apache.axis2.transport.TransportUtils.createDocumentElement(TransportUtils.java:215) at org.apache.axis2.transport.TransportUtils.createSOAPMessage(TransportUtils.java:145) at org.apache.axis2.transport.TransportUtils.createSOAPMessage(TransportUtils.java:108) ... 7 more Caused by: com.ctc.wstx.exc.WstxUnexpectedCharException: Unexpected character 'S' (code 83) in prolog; expected '<' at [row,col {unknown-source}]: [1,1] at com.ctc.wstx.sr.StreamScanner.throwUnexpectedChar(StreamScanner.java:623) at com.ctc.wstx.sr.BasicStreamReader.nextFromProlog(BasicStreamReader.java:2047) at com.ctc.wstx.sr.BasicStreamReader.next(BasicStreamReader.java:1069) at javax.xml.stream.util.StreamReaderDelegate.next(StreamReaderDelegate.java:60) at org.apache.axiom.om.impl.builder.SafeXMLStreamReader.next(SafeXMLStreamReader.java:183) at org.apache.axiom.om.impl.builder.StAXOMBuilder.parserNext(StAXOMBuilder.java:597) at org.apache.axiom.om.impl.builder.StAXOMBuilder.next(StAXOMBuilder.java:172) ... 13 more

    Read the article

  • threaded serial port IOException when writing

    - by John McDonald
    Hi, I'm trying to write a small application that simply reads data from a socket, extracts some information (two integers) from the data and sends the extracted information off on a serial port. The idea is that it should start and just keep going. In short, it works, but not for long. After a consistently short period I start to receive IOExceptions and socket receive buffer is swamped. The thread framework has been taken from the MSDN serial port example. The delay in send(), readThread.Join(), is an effort to delay read() in order to allow serial port interrupt processing a chance to occur, but I think I've misinterpreted the join function. I either need to sync the processes more effectively or throw some data away as it comes in off the socket, which would be fine. The integer data is controlling a pan tilt unit and I'm sure four times a second would be acceptable, but not sure on how to best acheive either, any ideas would be greatly appreciated, cheers. using System; using System.Collections.Generic; using System.Text; using System.IO.Ports; using System.Threading; using System.Net; using System.Net.Sockets; using System.IO; namespace ConsoleApplication1 { class Program { static bool _continue; static SerialPort _serialPort; static Thread readThread; static Thread sendThread; static String sendString; static Socket s; static int byteCount; static Byte[] bytesReceived; // synchronise send and receive threads static bool dataReceived; const int FIONREAD = 0x4004667F; static void Main(string[] args) { dataReceived = false; readThread = new Thread(Read); sendThread = new Thread(Send); bytesReceived = new Byte[16384]; // Create a new SerialPort object with default settings. _serialPort = new SerialPort("COM4", 38400, Parity.None, 8, StopBits.One); // Set the read/write timeouts _serialPort.WriteTimeout = 500; _serialPort.Open(); string moveMode = "CV "; _serialPort.WriteLine(moveMode); s = null; IPHostEntry hostEntry = Dns.GetHostEntry("localhost"); foreach (IPAddress address in hostEntry.AddressList) { IPEndPoint ipe = new IPEndPoint(address, 10001); Socket tempSocket = new Socket(ipe.AddressFamily, SocketType.Stream, ProtocolType.Tcp); tempSocket.Connect(ipe); if (tempSocket.Connected) { s = tempSocket; s.ReceiveBufferSize = 16384; break; } else { continue; } } readThread.Start(); sendThread.Start(); while (_continue) { Thread.Sleep(10); ;// Console.WriteLine("main..."); } readThread.Join(); _serialPort.Close(); s.Close(); } public static void Read() { while (_continue) { try { //Console.WriteLine("Read"); if (!dataReceived) { byte[] outValue = BitConverter.GetBytes(0); // Check how many bytes have been received. s.IOControl(FIONREAD, null, outValue); uint bytesAvailable = BitConverter.ToUInt32(outValue, 0); if (bytesAvailable > 0) { Console.WriteLine("Read thread..." + bytesAvailable); byteCount = s.Receive(bytesReceived); string str = Encoding.ASCII.GetString(bytesReceived); //str = Encoding::UTF8->GetString( bytesReceived ); string[] split = str.Split(new Char[] { '\t', '\r', '\n' }); string filteredX = (split.GetValue(7)).ToString(); string filteredY = (split.GetValue(8)).ToString(); string[] AzSplit = filteredX.Split(new Char[] { '.' }); filteredX = (AzSplit.GetValue(0)).ToString(); string[] ElSplit = filteredY.Split(new Char[] { '.' }); filteredY = (ElSplit.GetValue(0)).ToString(); // scale values int x = (int)(Convert.ToInt32(filteredX) * 1.9); string scaledAz = x.ToString(); int y = (int)(Convert.ToInt32(filteredY) * 1.9); string scaledEl = y.ToString(); String moveAz = "PS" + scaledAz + " "; String moveEl = "TS" + scaledEl + " "; sendString = moveAz + moveEl; dataReceived = true; } } } catch (TimeoutException) {Console.WriteLine("timeout exception");} catch (NullReferenceException) {Console.WriteLine("Read NULL reference exception");} } } public static void Send() { while (_continue) { try { if (dataReceived) { // sleep Read() thread to allow serial port interrupt processing readThread.Join(100); // send command to PTU dataReceived = false; Console.WriteLine(sendString); _serialPort.WriteLine(sendString); } } catch (TimeoutException) { Console.WriteLine("Timeout exception"); } catch (IOException) { Console.WriteLine("IOException exception"); } catch (NullReferenceException) { Console.WriteLine("Send NULL reference exception"); } } } } }

    Read the article

  • Is That REST API Really RPC? Roy Fielding Seems to Think So.

    - by Rich Apodaca
    A large amount of what I thought I knew about REST is apparently wrong - and I'm not alone. This question has a long lead-in, but it seems to be necessary because the information is a bit scattered. The actual question comes at the end if you're already familiar with this topic. From the first paragraph of Roy Fielding's REST APIs must be hypertext-driven, it's pretty clear he believes his work is being widely misinterpreted: I am getting frustrated by the number of people calling any HTTP-based interface a REST API. Today’s example is the SocialSite REST API. That is RPC. It screams RPC. There is so much coupling on display that it should be given an X rating. Fielding goes on to list several attributes of a REST API. Some of them seem to go against both common practice and common advice on SO and other forums. For example: A REST API should be entered with no prior knowledge beyond the initial URI (bookmark) and set of standardized media types that are appropriate for the intended audience (i.e., expected to be understood by any client that might use the API). ... A REST API must not define fixed resource names or hierarchies (an obvious coupling of client and server). ... A REST API should spend almost all of its descriptive effort in defining the media type(s) used for representing resources and driving application state, or in defining extended relation names and/or hypertext-enabled mark-up for existing standard media types. ... The idea of "hypertext" plays a central role - much more so than URI structure or what HTTP verbs mean. "Hypertext" is defined in one of the comments: When I [Fielding] say hypertext, I mean the simultaneous presentation of information and controls such that the information becomes the affordance through which the user (or automaton) obtains choices and selects actions. Hypermedia is just an expansion on what text means to include temporal anchors within a media stream; most researchers have dropped the distinction. Hypertext does not need to be HTML on a browser. Machines can follow links when they understand the data format and relationship types. I'm guessing at this point, but the first two points above seem to suggest that API documentation for a Foo resource that looks like the following leads to tight coupling between client and server and has no place in a RESTful system. GET /foos/{id} # read a Foo POST /foos/{id} # create a Foo PUT /foos/{id} # update a Foo Instead, an agent should be forced to discover the URIs for all Foos by, for example, issuing a GET request against /foos. (Those URIs may turn out to follow the pattern above, but that's beside the point.) The response uses a media type that is capable of conveying how to access each item and what can be done with it, giving rise to the third point above. For this reason, API documentation should focus on explaining how to interpret the hypertext contained in the response. Furthermore, every time a URI to a Foo resource is requested, the response contains all of the information needed for an agent to discover how to proceed by, for example, accessing associated and parent resources through their URIs, or by taking action after the creation/deletion of a resource. The key to the entire system is that the response consists of hypertext contained in a media type that itself conveys to the agent options for proceeding. It's not unlike the way a browser works for humans. But this is just my best guess at this particular moment. Fielding posted a follow-up in which he responded to criticism that his discussion was too abstract, lacking in examples, and jargon-rich: Others will try to decipher what I have written in ways that are more direct or applicable to some practical concern of today. I probably won’t, because I am too busy grappling with the next topic, preparing for a conference, writing another standard, traveling to some distant place, or just doing the little things that let me feel I have I earned my paycheck. So, two simple questions for the REST experts out there with a practical mindset: how do you interpret what Fielding is saying and how do you put it into practice when documenting/implementing REST APIs? Edit: this question is an example of how hard it can be to learn something if you don't have a name for what you're talking about. The name in this case is "Hypermedia as the Engine of Application State" (HATEOAS).

    Read the article

  • WCF- Large Data

    - by Pinu
    I have a WCF Web Service with basicHTTPBinding , the server side the transfer mode is streamedRequest as the client will be sending us large file in the form of memory stream. But on client side when i use transfer mode as streamedRequest its giving me a this errro "The remote server returned an error: (400) Bad Request" And when i look in to trace information , i see this as the error message Exception: There is a problem with the XML that was received from the network. See inner exception for more details. InnerException: The body of the message cannot be read because it is empty. I am able to send up to 5MB of data using trasfermode as buffered , but it will effect the performance of my web service in the long run , if there are many clients who are trying to access the service in buffered transfer mode. SmartConnect.Service1Client Serv = new SmartConnectClient.SmartConnect.Service1Client(); SmartConnect.OrderCertMailResponse OrderCert = new SmartConnectClient.SmartConnect.OrderCertMailResponse(); OrderCert.UserID = "abcd"; OrderCert.Password = "7a80f6623"; OrderCert.SoftwareKey = "90af1"; string applicationDirectory = @"\\inid\utty\Bran"; byte[] CertMail = File.ReadAllBytes(applicationDirectory + @"\5mb_test.zip"); MemoryStream str = new MemoryStream(CertMail); //OrderCert.Color = true; //OrderCert.Duplex = false; //OrderCert.FirstClass = true; //OrderCert.File = str; //OrderCert.ReturnAddress1 = "Test123"; //OrderCert.ReturnAddress2 = "Test123"; //OrderCert.ReturnAddress3 = "Test123"; //OrderCert.ReturnAddress4 = "Test123"; OrderCert.File = str; //string OrderNumber = ""; //string Password = OrderCert.Password; //int ReturnCode = 0; //string ReturnMessage = ""; //string SoftwareKey = OrderCert.SoftwareKey; //string UserID = OrderCert.UserID; //OrderCert.File = str; MemoryStream FileStr = str; Serv.OrderCertMail(OrderCert); // Serv.OrderCertMail(ref OrderNumber, ref Password, ref ReturnCode, ref ReturnMessage, ref SoftwareKey, ref UserID, ref FileStr ); lblON.Text = OrderCert.OrderNumber; Serv.Close(); // My Web Service - Service Contract [OperationContract] OrderCertMailResponse OrderCertMail(OrderCertMailResponse OrderCertMail); [MessageContract] public class OrderCertMailResponse { string userID = ""; string password = ""; string softwareID = ""; MemoryStream file = null; //MemoryStream str = null; [MessageHeader] //[DataMember] public string UserID { get { return userID; } set { userID = value; } } [MessageHeader] //[DataMember] public string Password { get { return password; } set { password = value; } } [MessageHeader] //[DataMember] public string SoftwareKey { get { return softwareID; } set { softwareID = value; } } [MessageBodyMember] // [DataMember] public MemoryStream File { get { return file; } set { file = value; } } [MessageHeader] //[DataMember] public string ReturnMessage; [MessageHeader] //[DataMember] public int ReturnCode; [MessageHeader] public string OrderNumber; //// Control file fields //[MessageHeader] ////[DataMember] //public string ReturnAddress1; //[MessageHeader] ////[DataMember] //public string ReturnAddress2; //[MessageHeader] ////[DataMember] //public string ReturnAddress3; //[MessageHeader] ////[DataMember] //public string ReturnAddress4; //[MessageHeader] ////[DataMember] //public bool FirstClass; //[MessageHeader] ////[DataMember] //public bool Color; //[MessageHeader] ////[DataMember] //public bool Duplex; } [ServiceBehavior(IncludeExceptionDetailInFaults = true)] public class Service1 : IService1 { public OrderCertMailResponse OrderCertMail(OrderCertMailResponse OrderCertMail) { OrderService CertOrder = new OrderService(); ClientUserInfo Info = new ClientUserInfo(); ControlFileInfo Control = new ControlFileInfo(); //Info.Password = "f2496623"; // hard coded password for development testing purposes //Info.SoftwareKey = "6dbb71"; // hard coded software key this is a developement software key //Info.UserName = "sdfs"; // hard coded UserID - for testing Info.UserName = OrderCertMail.UserID.ToString(); Info.Password = OrderCertMail.Password.ToString(); Info.SoftwareKey = OrderCertMail.SoftwareKey.ToString(); //Control.ReturnAddress1 = OrderCertMail.ReturnAddress1; //Control.ReturnAddress2 = OrderCertMail.ReturnAddress2; //Control.ReturnAddress3 = OrderCertMail.ReturnAddress3; //Control.ReturnAddress4 = OrderCertMail.ReturnAddress4; //Control.CertMailFirstClass = OrderCertMail.FirstClass; //Control.CertMailColor = OrderCertMail.Color; //Control.CertMailDuplex = OrderCertMail.Duplex; //byte[] CertFile = new byte[0]; //byte[] CertFile = null; //string applicationDirectory = @"\\intrepid\utility\Bryan"; // byte[] CertMailFile = File.ReadAllBytes(applicationDirectory + @"\3mb_test.zip"); //MemoryStream str = new MemoryStream(CertMailFile); OrderCertMailResponseClass OrderCertResponse = CertOrder.OrderCertmail(Info,Control,OrderCertMail.File); OrderCertMail.ReturnMessage = OrderCertResponse.ReturnMessage.ToString(); OrderCertMail.ReturnCode = Convert.ToInt32(OrderCertResponse.ReturnCode.ToString()); OrderCertMail.OrderNumber = OrderCertResponse.OrderNumber; return OrderCertMail; }

    Read the article

  • "Expected initializer before '<' token" in header file

    - by Sarah
    I'm pretty new to programming and am generally confused by header files and includes. I would like help with an immediate compile problem and would appreciate general suggestions about cleaner, safer, slicker ways to write my code. I'm currently repackaging a lot of code that used to be in main() into a Simulation class. I'm getting a compile error with the header file for this class. I'm compiling with gcc version 4.2.1. // Simulation.h #ifndef SIMULATION_H #define SIMULATION_H #include <cstdlib> #include <iostream> #include <cmath> #include <string> #include <fstream> #include <set> #include <boost/multi_index_container.hpp> #include <boost/multi_index/hashed_index.hpp> #include <boost/multi_index/member.hpp> #include <boost/multi_index/ordered_index.hpp> #include <boost/multi_index/mem_fun.hpp> #include <boost/multi_index/composite_key.hpp> #include <boost/shared_ptr.hpp> #include <boost/tuple/tuple_comparison.hpp> #include <boost/tuple/tuple_io.hpp> #include "Parameters.h" #include "Host.h" #include "rng.h" #include "Event.h" #include "Rdraws.h" typedef multi_index_container< // line 33 - first error boost::shared_ptr< Host >, indexed_by< hashed_unique< const_mem_fun<Host,int,&Host::getID> >, // 0 - ID index ordered_non_unique< tag<age>,const_mem_fun<Host,int,&Host::getAgeInY> >, // 1 - Age index hashed_non_unique< tag<household>,const_mem_fun<Host,int,&Host::getHousehold> >, // 2 - Household index ordered_non_unique< // 3 - Eligible by age & household tag<aeh>, composite_key< Host, const_mem_fun<Host,int,&Host::getAgeInY>, const_mem_fun<Host,bool,&Host::isEligible>, const_mem_fun<Host,int,&Host::getHousehold> > >, ordered_non_unique< // 4 - Eligible by household (all single adults) tag<eh>, composite_key< Host, const_mem_fun<Host,bool,&Host::isEligible>, const_mem_fun<Host,int,&Host::getHousehold> > >, ordered_non_unique< // 5 - Household & age tag<ah>, composite_key< Host, const_mem_fun<Host,int,&Host::getHousehold>, const_mem_fun<Host,int,&Host::getAgeInY> > > > // end indexed_by > HostContainer; typedef std::set<int> HHSet; class Simulation { public: Simulation( int sid ); ~Simulation(); // MEMBER FUNCTION PROTOTYPES void runDemSim( void ); void runEpidSim( void ); void ageHost( int id ); int calcPartnerAge( int a ); void executeEvent( Event & te ); void killHost( int id ); void pairHost( int id ); void partner2Hosts( int id1, int id2 ); void fledgeHost( int id ); void birthHost( int id ); void calcSI( void ); double beta_ij_h( int ai, int aj, int s ); double beta_ij_nh( int ai, int aj, int s ); private: // SIMULATION OBJECTS double t; double outputStrobe; int idCtr; int hholdCtr; int simID; RNG rgen; HostContainer allHosts; // shared_ptr to Hosts - line 102 - second error HHSet allHouseholds; int numInfecteds[ INIT_NUM_AGE_CATS ][ INIT_NUM_STYPES ]; EventPQ currentEvents; // STREAM MANAGEMENT void writeOutput(); void initOutput(); void closeOutput(); std::ofstream ageDistStream; std::ofstream ageDistTStream; std::ofstream hhDistStream; std::ofstream hhDistTStream; std::string ageDistFile; std::string ageDistTFile; std::string hhDistFile; std::string hhDistTFile; }; #endif I'm hoping the other files aren't so relevant to this problem. When I compile with g++ -g -o -c a.out -I /Applications/boost_1_42_0/ Host.cpp Simulation.cpp rng.cpp main.cpp Rdraws.cpp I get Simulation.h:33: error: expected initializer before '<' token Simulation.h:102: error: 'HostContainer' does not name a type and then a bunch of other errors related to not recognizing the HostContainer. It seems like I have all the right Boost #includes for the HostContainer to be understood. What else could be going wrong? I would appreciate immediate suggestions, troubleshooting tips, and other advice about my code. My plan is to create a "HostContainer.h" file that includes the typedef and structs that define its tags, similar to what I'm doing in "Event.h" for the EventPQ container. I'm assuming this is legal and good form.

    Read the article

  • ExpressionEngine Segment Variables Lost on Site Index Page

    - by Jesse Bunch
    Hey Everyone, I've been messing with this for days now and can't seem to figure it out. I am trying to pass a 2nd segment variable to my client's index page. The URL I'm trying is: http://www.compupay.com/site/CSCPA/. The problem is, rather than showing the site's index page with the segment variable of "CSCPA" still in the URL, it shows the index page with no segment variables. Initially, I thought it was a .htaccess problem but I couldn't find anything in it that seemed out of whack. Any ideas? I am posting the .htaccess file so another pair of eyes can see it. Thanks for the help! # -- LG .htaccess Generator Start -- # .htaccess generated by LG .htaccess Generator v1.0.0 # http://leevigraham.com/cms-customisation/expressionengine/addon/lg-htaccess-generator/ # secure .htaccess file <Files .htaccess> order allow,deny deny from all </Files> # Dont list files in index pages IndexIgnore * #URL Segment Support AcceptPathInfo On Options +FollowSymLinks #Redirect old incoming links Redirect 301 /contactus.cfm http://www.compupay.com/about_compupay/contact_us/ Redirect 301 /Internet_Payroll.cfm http://www.compupay.com/payroll_solutions/c/online_payroll/ Redirect 301 /Internet_Payroll_XpressPayroll.cfm http://www.compupay.com/payroll_solutions/xpresspayroll/ Redirect 301 /about_compupay.cfm http://www.compupay.com/about_compupay/news/ Redirect 301 /after_payroll.cfm http://www.compupay.com/after_payroll_solutions/ Redirect 301 /news101507.cfm http://www.compupay.com/about_compupay/news/ Redirect 301 /quote.cfm http://www.compupay.com/payroll_solutions/get_a_free_quote/ Redirect 301 /solution_finder_sm.cfm http://www.compupay.com/ Redirect 301 /state_payroll/mississippi_payroll.cfm http://www.compupay.com/resource_center/state_resources/ Redirect 301 /state_payroll/washington_payroll.cfm http://www.compupay.com/resource_center/state_resources/ #Redirect for old top linked to pages Redirect 301 /Payroll_Services.cfm http://www.compupay.com/payroll_solutions/ Redirect 301 /About_CompuPay.cfm http://www.compupay.com/about_compupay/ Redirect 301 /Partnerships.cfm http://www.compupay.com/business_partner_solutions/ Redirect 301 /about_compupay.cfm?subpage=393 http://www.compupay.com/about_compupay/ Redirect 301 /quote.cfm http://www.compupay.com/payroll_solutions/get_a_free_quote/ Redirect 301 /After_Payroll.cfm http://www.compupay.com/after_payroll_solutions/ Redirect 301 /Accountant_Services.cfm http://www.compupay.com/accountant_solutions/ Redirect 301 /careers/careers_payroll.cfm http://www.compupay.com/about_compupay/careers/ Redirect 301 /Industry_Resources.cfm http://www.compupay.com/resource_center/ Redirect 301 /Client_Resources.cfm http://www.compupay.com/resource_center/client_login/ Redirect 301 /client_resources.cfm?subpage=375 http://www.compupay.com/resource_center/client_login/ Redirect 301 /solution_finder_sm.cfm http://www.compupay.com/payroll_solutions/ Redirect 301 /Internet_Payroll_PowerPayroll.cfm http://www.compupay.com/payroll_solutions/powerpayroll/ Redirect 301 /Payroll_Outsourcing.cfm http://www.compupay.com/payroll_solutions/why_outsource/ Redirect 301 /Phone_Payroll_Fax_Payroll.cfm http://www.compupay.com/payroll_solutions/phone_fax_payroll/ Redirect 301 /contactus.cfm http://www.compupay.com/about_compupay/contact_us/ Redirect 301 /state_payroll/iowa_payroll.cfm http://www.compupay.com/resource_center/state_resources/ Redirect 301 /Construction_Payroll.cfm http://www.compupay.com/payroll_solutions/specialty_payroll/ Redirect 301 /PC_Payroll.cfm http://www.compupay.com/payroll_solutions/c/pc_payroll/ Redirect 301 /state_payroll/washington_payroll.cfm http://www.compupay.com/resource_center/state_resources/ Redirect 301 /Internet_Payroll_XpressPayroll.cfm http://www.compupay.com/payroll_solutions/xpresspayroll/ Redirect 301 /accountant_services.cfm?subpage=404 http://www.compupay.com/accountant_solutions/ Redirect 301 /after_payroll.cfm http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=361 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=362 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=363 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=364 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=365 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=366 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=367 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=368 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=369 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /after_payroll.cfm?subpage=416 http://www.compupay.com/after_payroll_solutions/ Redirect 301 /payload_payroll.cfm http://www.compupay.com/payroll_solutions/payload/ Redirect 301 /payroll_services.cfm?subpage=358 http://www.compupay.com/payroll_solutions/ Redirect 301 /payroll_services.cfm?subpage=399 http://www.compupay.com/payroll_solutions/ Redirect 301 /payroll_services.cfm?subpage=409 http://www.compupay.com/payroll_solutions/ Redirect 301 /payroll_services.cfm?subpage=413 http://www.compupay.com/payroll_solutions/ Redirect 301 /payroll_services.cfm?subpage=418 http://www.compupay.com/payroll_solutions/ Redirect 301 /state_payroll/mississippi_payroll.cfm http://www.compupay.com/resource_center/state_resources/ <IfModule mod_rewrite.c> RewriteEngine On RewriteBase / # Remove the www # RewriteCond %{HTTP_HOST} ^www\.(.+)$ [NC] # RewriteRule ^ http://%{HTTP_HOST}%{REQUEST_URI} [L,R=301] # Force www RewriteCond %{HTTP_HOST} !^www.compupay.com$ [NC] RewriteRule ^(.*)$ http://www.compupay.com/$1 [R=301,L] # Add a trailing slash to paths without an extension RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_URI} !(\.[a-zA-Z0-9]{1,5}|/)$ RewriteRule ^(.*)$ $1/ [L,R=301] #Legacy Partner Link Redirect RewriteCond %{QUERY_STRING} partnerCode=(.*) [NC] RewriteRule compupay_payroll.cfm site/%1? [R=301,L] # Catch any remaining requests for .cfm files RewriteCond %{REQUEST_URI} \.cfm RewriteRule ^.*$ http://www.compupay.com/ [R=301,L] #Expression Engine RewriteCond %{REQUEST_FILENAME} !-f RewriteCond %{REQUEST_FILENAME} !-d RewriteRule ^(.*)$ /index.php?/$1 [L] AcceptPathInfo On </IfModule> # Remove IE image toolbar <FilesMatch "\.(html|htm|php)$"> Header set imagetoolbar "no" </FilesMatch> # enable gzip compression <FilesMatch "\.(js|css|php)$"> SetOutputFilter DEFLATE </FilesMatch> #Deal with ETag <IfModule mod_headers.c> <FilesMatch "\.(ico|flv|jpg|jpeg|png|gif)$"> Header unset Last-Modified </FilesMatch> <FilesMatch "\.(ico|flv|jpg|jpeg|png|gif|js|css|swf)$"> Header unset ETag FileETag None Header set Cache-Control "public" </FilesMatch> </IfModule> <IfModule mod_expires.c> <FilesMatch "\.(ico|flv|jpg|jpeg|png|gif|css|js)$"> ExpiresActive on ExpiresDefault "access plus 1 year" </FilesMatch> </IfModule> #Force Download PDFs <FilesMatch "\.(?i:pdf)$"> ForceType application/octet-stream Header set Content-Disposition attachment </FilesMatch> #Increase Upload Size php_value upload_max_filesize 5M php_value post_max_size 5M # -- LG .htaccess Generator End --

    Read the article

  • Ethernet Communication Error

    - by SivaKumar
    Hi, I wrote a program to query the status of the Ethernet printer for that i created a TCP Stream Socket and i send the query command to the printer.In case of Error less condition it returns No error status but in error case its getting hang at recv command.Even i used Non blocking now the recv command returns nothing and error set as Resource temporarily unavailable. code: #include <stdio.h> #include <sys/types.h> #include <sys/socket.h> #include <netinet/in.h> #include <netdb.h> #include <string.h> #include <unistd.h> #include <arpa/inet.h> #include <errno.h> #include <stdlib.h> #include <fcntl.h> #include <sys/ioctl.h> #include <sys/socket.h> #include <signal.h> #include <termios.h> #include <poll.h> #include <netinet/tcp.h> #include <stdarg.h> int main() { int ConnectSocket,ConnectSocket1,select_err,err,nRet,nBytesRead; struct timeval waitTime = {10,30}; fd_set socket_set; unsigned char * dataBuf = NULL; unsigned char tempVar, tempVar1, tempVar2, tempVar3; char reset[] = "\033E 2\r"; char print[] = "\033A 1\r"; char buf[1024]={0}; ConnectSocket = socket(AF_INET, SOCK_STREAM, IPPROTO_TCP); printf("The Socket ID is %d\n",ConnectSocket); if (ConnectSocket < 0) { perror("socket()"); return 0; } struct sockaddr_in clientService; clientService.sin_family = AF_INET; clientService.sin_addr.s_addr = inet_addr("192.168.0.129"); //Printer IP clientService.sin_port = htons( 9100); // Printer Port if ( connect( ConnectSocket, (struct sockaddr*) &clientService, sizeof(clientService) ) == -1) { perror("connect()"); close(ConnectSocket); return -1; } /* if((nRet = ioctl(ConnectSocket , FIONREAD, &nBytesRead) == -1)) { perror("ioctl()"); } perror("ioctl()"); */ FD_ZERO(&socket_set); FD_SET(ConnectSocket, &socket_set); do { errno=0; select_err = select(ConnectSocket+1, NULL, &socket_set, NULL, &waitTime); }while(errno==EINPROGRESS); if (-1 == select_err || 0 == select_err) { int optVal = 0; int optLen = sizeof(optVal); if(select_err == -1) { perror("select() write-side"); } else { //Timeout errno=0; err = getsockopt(ConnectSocket, SOL_SOCKET, SO_ERROR, (char*)&optVal, &optLen); printf("the return of the getsockopt is %d\n",err); printf("the opt val is %s\n",(char*)optVal); perror("getsockopt()"); if(err == -1) { perror("getsockopt() write-side"); } } printf("Select Failed during write - ConnectSocket: %d\n", ConnectSocket); //close(ConnectSocket); return -1; } err = send(ConnectSocket,print,sizeof(print)-1, 0); printf("\n No of Bytes Send is %d\n",err); if(err == -1 || err ==0) { perror("send()"); //close(ConnectSocket); return -1; } FD_ZERO(&socket_set); FD_SET(ConnectSocket, &socket_set); do { errno=0; select_err = select(ConnectSocket+1, NULL, &socket_set, NULL, &waitTime); }while(errno==EINPROGRESS); if (-1 == select_err || 0 == select_err) { printf("Select Failed during write - ConnectSocket: %d\n", ConnectSocket); return -1; } err = send(ConnectSocket,reset,sizeof(reset)-1, 0); printf("\n No of Bytes Send is %d\n",err); if(err == -1 || err ==0) { perror("send()"); //close(ConnectSocket); return -1; } FD_ZERO(&socket_set); FD_SET(ConnectSocket, &socket_set); printf("i am in reading \n"); select_err = select(ConnectSocket+1, &socket_set, NULL, NULL, &waitTime); printf("the retun of the read side select is %d \n",select_err); perror("select()"); if (-1 == select_err|| 0 == select_err) { printf("Read timeout; ConnectSocket: %d\n", ConnectSocket); close(ConnectSocket); perror("close()"); return -1; } printf("Before Recv\n"); nBytesRead = recv(ConnectSocket , buf, 1024, 0); printf("No of Bytes read is %d\n",nBytesRead); printf("%s\n",buf); if(nBytesRead == -1) { perror("recv()"); close(ConnectSocket); perror("clode()"); return -1; } close(ConnectSocket); return 1; }

    Read the article

  • Why is my unsafe code block slower than my safe code?

    - by jomtois
    I am attempting to write some code that will expediently process video frames. I am receiving the frames as a System.Windows.Media.Imaging.WriteableBitmap. For testing purposes, I am just applying a simple threshold filter that will process a BGRA format image and assign each pixel to either be black or white based on the average of the BGR pixels. Here is my "Safe" version: public static void ApplyFilter(WriteableBitmap Bitmap, byte Threshold) { // Let's just make this work for this format if (Bitmap.Format != PixelFormats.Bgr24 && Bitmap.Format != PixelFormats.Bgr32) { return; } // Calculate the number of bytes per pixel (should be 4 for this format). var bytesPerPixel = (Bitmap.Format.BitsPerPixel + 7) / 8; // Stride is bytes per pixel times the number of pixels. // Stride is the byte width of a single rectangle row. var stride = Bitmap.PixelWidth * bytesPerPixel; // Create a byte array for a the entire size of bitmap. var arraySize = stride * Bitmap.PixelHeight; var pixelArray = new byte[arraySize]; // Copy all pixels into the array Bitmap.CopyPixels(pixelArray, stride, 0); // Loop through array and change pixels to black or white based on threshold for (int i = 0; i < pixelArray.Length; i += bytesPerPixel) { // i=B, i+1=G, i+2=R, i+3=A var brightness = (byte)((pixelArray[i] + pixelArray[i + 1] + pixelArray[i + 2]) / 3); var toColor = byte.MinValue; // Black if (brightness >= Threshold) { toColor = byte.MaxValue; // White } pixelArray[i] = toColor; pixelArray[i + 1] = toColor; pixelArray[i + 2] = toColor; } Bitmap.WritePixels(new Int32Rect(0, 0, Bitmap.PixelWidth, Bitmap.PixelHeight), pixelArray, stride, 0); } Here is what I think is a direct translation using an unsafe code block and the WriteableBitmap Back Buffer instead of the forebuffer: public static void ApplyFilterUnsafe(WriteableBitmap Bitmap, byte Threshold) { // Let's just make this work for this format if (Bitmap.Format != PixelFormats.Bgr24 && Bitmap.Format != PixelFormats.Bgr32) { return; } var bytesPerPixel = (Bitmap.Format.BitsPerPixel + 7) / 8; Bitmap.Lock(); unsafe { // Get a pointer to the back buffer. byte* pBackBuffer = (byte*)Bitmap.BackBuffer; for (int i = 0; i < Bitmap.BackBufferStride*Bitmap.PixelHeight; i+= bytesPerPixel) { var pCopy = pBackBuffer; var brightness = (byte)((*pBackBuffer + *pBackBuffer++ + *pBackBuffer++) / 3); pBackBuffer++; var toColor = brightness >= Threshold ? byte.MaxValue : byte.MinValue; *pCopy = toColor; *++pCopy = toColor; *++pCopy = toColor; } } // Bitmap.AddDirtyRect(new Int32Rect(0,0, Bitmap.PixelWidth, Bitmap.PixelHeight)); Bitmap.Unlock(); } This is my first foray into unsafe code blocks and pointers, so maybe the logic is not optimal. I have tested both blocks of code on the same WriteableBitmaps using: var threshold = Convert.ToByte(op.Result); var copy2 = copyFrame.Clone(); Stopwatch stopWatch = new Stopwatch(); stopWatch.Start(); BinaryFilter.ApplyFilterUnsafe(copyFrame, threshold); stopWatch.Stop(); var unsafesecs = stopWatch.ElapsedMilliseconds; stopWatch.Reset(); stopWatch.Start(); BinaryFilter.ApplyFilter(copy2, threshold); stopWatch.Stop(); Debug.WriteLine(string.Format("Unsafe: {1}, Safe: {0}", stopWatch.ElapsedMilliseconds, unsafesecs)); So I am analyzing the same image. A test run of an incoming stream of video frames: Unsafe: 110, Safe: 53 Unsafe: 136, Safe: 42 Unsafe: 106, Safe: 36 Unsafe: 95, Safe: 43 Unsafe: 98, Safe: 41 Unsafe: 88, Safe: 36 Unsafe: 129, Safe: 65 Unsafe: 100, Safe: 47 Unsafe: 112, Safe: 50 Unsafe: 91, Safe: 33 Unsafe: 118, Safe: 42 Unsafe: 103, Safe: 80 Unsafe: 104, Safe: 34 Unsafe: 101, Safe: 36 Unsafe: 154, Safe: 83 Unsafe: 134, Safe: 46 Unsafe: 113, Safe: 76 Unsafe: 117, Safe: 57 Unsafe: 90, Safe: 41 Unsafe: 156, Safe: 35 Why is my unsafe version always slower? Is it due to using the back buffer? Or am I doing something wrong? Thanks

    Read the article

  • Asp.net Google Charts SSL handler for GeoMap

    - by Ian
    Hi All, I am trying to view Google charts in a site using SSL. Google Charts do not support SSL so if we use the standard charts, we get warning messages. My plan is to create a ASHX handler that is co9ntained in the secure site that will retrieve the content from Google and serve this to the page the user is viewing. Using VS 2008 SP1 and the included web server, my idea works perfectly for both Firefox and IE 8 & 9(Preview) and I am able to see my geomap displayed on my page as it should be. But my problem is when I publish to IIS7 the page using my handler to generate the geomap works in Firefox but not IE(every version). There are no errors anywhere or in any log files, but when i right click in IE in the area where the map should be displayed, I see the message in the context menu saying "movie not loaded" Below is the code from my handler and the aspx page. I have disabled compression in my web.config. Even in IE I am hitting all my break points and when I use the IE9 Developer tools, the web page is correctly generated with all the correct code, url's and references. If you have any better ways to accomplish this or how i can fix my problem, I will appreciate it. Thanks Ian Handler(ASHX) public void ProcessRequest(HttpContext context) { String url = "http://charts.apis.google.com/jsapi"; string query = context.Request.QueryString.ToString(); if (!string.IsNullOrEmpty(query)) { url = query; } HttpWebRequest request = (HttpWebRequest)HttpWebRequest.Create(new Uri(HttpUtility.UrlDecode(url))); request.UserAgent = context.Request.UserAgent; WebResponse response = request.GetResponse(); string PageContent = string.Empty; StreamReader Reader; Stream webStream = response.GetResponseStream(); string contentType = response.ContentType; context.Response.BufferOutput = true; context.Response.ContentType = contentType; context.Response.Cache.SetCacheability(HttpCacheability.NoCache); context.Response.Cache.SetNoServerCaching(); context.Response.Cache.SetMaxAge(System.TimeSpan.Zero); string newUrl = IanLearning.Properties.Settings.Default.HandlerURL; //"https://localhost:444/googlesecurecharts.ashx?"; if (response.ContentType.Contains("javascript")) { Reader = new StreamReader(webStream); PageContent = Reader.ReadToEnd(); PageContent = PageContent.Replace("http://", newUrl + "http://"); PageContent = PageContent.Replace("charts.apis.google.com", newUrl + "charts.apis.google.com"); PageContent = PageContent.Replace(newUrl + "http://maps.google.com/maps/api/", "http://maps.google.com/maps/api/"); context.Response.Write(PageContent); } else { { byte[] bytes = ReadFully(webStream); context.Response.BinaryWrite(bytes); } } context.Response.Flush(); response.Close(); webStream.Close(); context.Response.End(); context.ApplicationInstance.CompleteRequest(); } ASPX Page <%@ Page Title="" Language="C#" MasterPageFile="~/Site2.Master" AutoEventWireup="true" CodeBehind="googlechart.aspx.cs" Inherits="IanLearning.googlechart" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" runat="server"> <script type='text/javascript' src='~/googlesecurecharts.ashx?'></script> <script type='text/javascript'> google.load('visualization', '1', { 'packages': ['geomap'] }); google.setOnLoadCallback(drawMap); var geomap; function drawMap() { var data = new google.visualization.DataTable(); data.addRows(6); data.addColumn('string', 'City'); data.addColumn('number', 'Sales'); data.setValue(0, 0, 'ZA'); data.setValue(0, 1, 200); data.setValue(1, 0, 'US'); data.setValue(1, 1, 300); data.setValue(2, 0, 'BR'); data.setValue(2, 1, 400); data.setValue(3, 0, 'CN'); data.setValue(3, 1, 500); data.setValue(4, 0, 'IN'); data.setValue(4, 1, 600); data.setValue(5, 0, 'ZW'); data.setValue(5, 1, 700); var options = {}; options['region'] = 'world'; options['dataMode'] = 'regions'; options['showZoomOut'] = false; var container = document.getElementById('map_canvas'); geomap = new google.visualization.GeoMap(container); google.visualization.events.addListener( geomap, 'regionClick', function(e) { drillDown(e['region']); }); geomap.draw(data, options); }; function drillDown(regionData) { alert(regionData); } </script> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder1" runat="server"> <div id='map_canvas'> </div> </asp:Content>

    Read the article

  • Fragment shaders on a texture

    - by Snowangelic
    Hello stack overflow. I am trying to add some post-processing capabilities to a program. The rendering is done using openGL. I just want to allow the program to load some home made fragment shader and use them on the video stream. I wrote a little piece of shader using "OpenGL Shader Builder" that just turns a texture in grayscale. The shaders works well in the shader builder but I can't make it work in the main program. The screens stays all black. Here is the setup : @implementation PluginGLView - (id) initWithCoder: (NSCoder *) coder { const GLubyte * strExt; if ((self = [super initWithCoder:coder]) == nil) return nil; glLock = [[NSLock alloc] init]; if (nil == glLock) { [self release]; return nil; } // Init pixel format attribs NSOpenGLPixelFormatAttribute attrs[] = { NSOpenGLPFAAccelerated, NSOpenGLPFANoRecovery, NSOpenGLPFADoubleBuffer, 0 }; // Get pixel format from OpenGL NSOpenGLPixelFormat* pixFmt = [[NSOpenGLPixelFormat alloc] initWithAttributes:attrs]; if (!pixFmt) { NSLog(@"No Accelerated OpenGL pixel format found\n"); NSOpenGLPixelFormatAttribute attrs2[] = { NSOpenGLPFANoRecovery, 0 }; // Get pixel format from OpenGL pixFmt = [[NSOpenGLPixelFormat alloc] initWithAttributes:attrs2]; if (!pixFmt) { NSLog(@"No OpenGL pixel format found!\n"); [self release]; return nil; } } [self setPixelFormat:[pixFmt autorelease]]; /* long swapInterval = 1 ; [[self openGLContext] setValues:&swapInterval forParameter:NSOpenGLCPSwapInterval]; */ [glLock lock]; [[self openGLContext] makeCurrentContext]; // Init object members strExt = glGetString (GL_EXTENSIONS); texture_range = gluCheckExtension ((const unsigned char *)"GL_APPLE_texture_range", strExt) ? GL_TRUE : GL_FALSE; texture_hint = GL_STORAGE_SHARED_APPLE ; client_storage = gluCheckExtension ((const unsigned char *)"GL_APPLE_client_storage", strExt) ? GL_TRUE : GL_FALSE; rect_texture = gluCheckExtension((const unsigned char *)"GL_EXT_texture_rectangle", strExt) ? GL_TRUE : GL_FALSE; // Setup some basic OpenGL stuff glPixelStorei(GL_UNPACK_ALIGNMENT, 1); glTexEnvi(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_REPLACE); glColor4f(1.0f, 1.0f, 1.0f, 1.0f); glClearColor(0.0f, 0.0f, 0.0f, 1.0f); glClear(GL_COLOR_BUFFER_BIT); // Loads the shaders shader=LoadShader(GL_FRAGMENT_SHADER,"/Users/alexandremathieu/fragment.fs"); program=glCreateProgram(); glAttachShader(program, shader); glLinkProgram(program); glUseProgram(program); [NSOpenGLContext clearCurrentContext]; [glLock unlock]; image_width = 1024; image_height = 512; image_depth = 16; image_type = GL_UNSIGNED_SHORT_1_5_5_5_REV; image_base = (GLubyte *) calloc(((IMAGE_COUNT * image_width * image_height) / 3) * 4, image_depth >> 3); if (image_base == nil) { [self release]; return nil; } // Create and load textures for the first time [self loadTextures:GL_TRUE]; // Init fps timer //gettimeofday(&cycle_time, NULL); drawBG = YES; // Call for a redisplay noDisplay = YES; PSXDisplay.Disabled = 1; [self setNeedsDisplay:true]; return self; } And here is the "render screen" function wich basically...renders the screen. - (void)renderScreen { int bufferIndex = whichImage; glBindTexture(GL_TEXTURE_RECTANGLE_EXT, bufferIndex+1); glUseProgram(program); int loc=glGetUniformLocation(program, "texture"); glUniform1i(loc,bufferIndex+1); glTexSubImage2D(GL_TEXTURE_RECTANGLE_EXT, 0, 0, 0, image_width, image_height, GL_BGRA, image_type, image[bufferIndex]); glBegin(GL_QUADS); glTexCoord2f(0.0f, 0.0f); glVertex2f(-1.0f, 1.0f); glTexCoord2f(0.0f, image_height); glVertex2f(-1.0f, -1.0f); glTexCoord2f(image_width, image_height); glVertex2f(1.0f, -1.0f); glTexCoord2f(image_width, 0.0f); glVertex2f(1.0f, 1.0f); glEnd(); [[self openGLContext] flushBuffer]; [NSOpenGLContext clearCurrentContext]; //[glLock unlock]; } and finally here's the shader. uniform sampler2DRect texture; void main() { vec4 color, texel; color = gl_Color; texel = texture2DRect(texture, gl_TexCoord[0].xy); color *= texel; // Begin Shader float gray=0.0; gray+=(color.r + color.g + color.b)/3.0; color=vec4(gray,gray,gray,color.a); // End Shader gl_FragColor = color; } The loading and using of shaders works since I am able to turn the screen all red with this shader void main(){ gl_FragColor=vec4(1.0,0.0,0.0,1.0); } If the shader contains a syntax error I get an error message from the LoadShader function etc. If I remove the use of the shader, everything works normally. I think the problem comes from the "passing the texture as a uniform parameter" thing. But these are my very firsts step with openGL and I cant be sure of anything. Don't hesitate to ask for more info. Thank you Stack O.

    Read the article

  • How to create a SOAP REQUEST using ASP.NET (VB) without using Visual

    - by user311691
    Hi all , I urgently need your help . I am new to consuming a web service using SOAP protocol. I have been given a demo webservice URL which ends in .WSDL and NOT .asml?WSDL. The problem is I cannot add a web reference using Visual studio OR Disco.exe or Wsdl.exe - This webservice has been created on a java platform and for security reasons the only way to make a invoke the webservice is at runtime using SOAP protocol IN asp.net (VB). I I have created some code but cannot seem to send the soap object to the receiving web service. If I could get a solution with step by step instructions on how I can send a SOAP REQUEST. Below is my code and all am trying to do is send a SOAP REQUEST and receive a SOAP RESPONSE which I will display in my browser. <%@ page language="vb" %> <%@ Import Namespace="System.Data"%> <%@ Import Namespace="System.Xml"%> <%@ Import Namespace="System.Net"%> <%@ Import Namespace="System.IO"%> <%@ Import Namespace="System.Text"%> <script runat=server> Private Sub Page_Load() Dim objHTTPReq As HttpWebRequest Dim WebserviceUrl As String = "http://xx.xx.xx:8084/asy/wsdl/asy.wsdl" objHTTPReq = CType(WebRequest.Create(WebserviceUrl), HttpWebRequest) Dim soapXML As String soapXML = "<?xml version='1.0' encoding='utf-8'?>" & _ " <soap:Envelope xmlns:xsi='http://www.w3.org/2001/XMLSchema-instance'" & _ " xmlns:xsd='http://www.w3.org/2001/XMLSchema'"& _ " xmlns:soap='http://schemas.xmlsoap.org/soap/envelope/' >"& _ " <soap:Body> "& _ " <validatePaymentData xmlns='http://asybanks.webservices.asycuda.org'> " & _ " <bankCode>"& bankCode &"</bankCode> " & _ " <PaymentDataType>" & _ " <paymentType>"& payment_type &"</paymentType> " & _ " <amount>"& ass_amount &"</amount> " & _ " <ReferenceType>" & _ " <year>"& year &"</year> " & _ " <customsOfficeCode>"& station &"</customsOfficeCode> " & _ " </ReferenceType>" & _ " <accountNumber>"& zra_account &"</accountNumber> " & _ " </PaymentDataType> " & _ " </validatePaymentData> " & _ " </soap:Body> " & _ " </soap:Envelope> " objHTTPReq.Headers.Add("SOAPAction", "http://asybanks.webservices.asycuda.org") objHTTPReq.ContentType = "text/xml; charset=utf-8" objHTTPReq.ContentLength = soapXML.Length objHTTPReq.Accept = "text/xml" objHTTPReq.Method = "POST" Dim objHTTPRes As HttpWebResponse = CType(objHTTPReq.GetResponse(), HttpWebResponse) Dim dataStream As Stream = objHTTPRes.GetResponseStream() Dim reader As StreamReader = new StreamReader(dataStream) Dim responseFromServer As String = reader.ReadToEnd() OurXml.text = responseFromServer End Sub </script> <html xmlns="http://www.w3.org/1999/xhtml"> <head runat="server"> <title> XML TRANSACTION SIMULATION - N@W@ TJ </title> </head> <body> <form id="form1" runat="server"> <div> <p>ZRA test Feedback:</p> <asp:label id="OurXml" runat="server"/> </div> </form> </body> </html> the demo webservice looks like this: <?xml version="1.0" encoding="UTF-8" ?> - <!-- WEB SERVICE JAVA DEMO --> - <definitions targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://schemas.xmlsoap.org/wsdl/" xmlns:apachesoap="http://xml.apache.org/xml-soap" xmlns:soap="http://schemas.xmlsoap.org/wsdl/soap/" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:y="http://asybanks.webservices.asycuda.org"> - <types> - <xs:schema elementFormDefault="qualified" targetNamespace="http://asybanks.webservices.asycuda.org" xmlns="http://www.w3.org/2001/XMLSchema"> SOME OTHER INFORMATION AT THE BOTTOM <soap:address location="http://xx.xx.xx:8084/asy/services/asy" /> </port> </service> </definitions> From the above excerpt of the wsdl url webservice, I am not sure which namespace to use for soapACTION - please advise.... Please if you could comment every stage of a soap request and provide a working demo - I would be most grateful as I would be learning rather than just assuming stuff :)

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • ASp.Net Mvc 1.0 Dynamic Images Returned from Controller taking 154 seconds+ to display in IE8, firef

    - by julian guppy
    I have a curious problem with IE, IIS 6.0 dynamic PNG files and I am baffled as to how to fix.. Snippet from Helper (this returns the URL to the view for requesting the images from my Controller. string url = LinkBuilder.BuildUrlFromExpression(helper.ViewContext.RequestContext, helper.RouteCollection, c = c.FixHeight(ir.Filename, ir.AltText, "FFFFFF")); url = url.Replace("&", "&"); sb.Append(string.Format("<removed id=\"TheImage\" src=\"{0}\" alt=\"\" /", url)+Environment.NewLine); This produces a piece of html as follows:- img id="TheImage" src="/ImgText/FixHeight?sFile=Images%2FUser%2FJulianGuppy%2FMediums%2Fconservatory.jpg&backgroundColour=FFFFFF" alt="" / brackets missing because i cant post an image... even though I dont want to post an image I jsut want to post the markup... sigh Snippet from Controller ImgTextController /// <summary> /// This function fixes the height of the image /// </summary> /// <param name="sFile"></param> /// <param name="alternateText"></param> /// <param name="backgroundColour"></param> /// <returns></returns> [AcceptVerbs(HttpVerbs.Get)] public ActionResult FixHeight(string sFile, string alternateText, string backgroundColour) { #region File if (string.IsNullOrEmpty(sFile)) { return new ImgTextResult(); } // MVC specific change to prepend the new directory if (sFile.IndexOf("Content") == -1) { sFile = "~/Content/" + sFile; } // open the file System.Drawing.Image img; try { img = System.Drawing.Image.FromFile(Server.MapPath(sFile)); } catch { img = null; } // did we fail? if (img == null) { return new ImgTextResult(); } #endregion File #region Width // Sort out the width from the image passed to me Int32 nWidth = img.Width; #endregion Width #region Height Int32 nHeight = img.Height; #endregion Height // What is the ideal height given a width of 2100 this should be 1400. var nIdealHeight = (int)(nWidth / 1.40920096852); // So is the actual height of the image already greater than the ideal height? Int32 nSplit; if (nIdealHeight < nHeight) { // Yes, do nothing, well i need to return the iamge... nSplit = 0; } else { // rob wants to not show the white at the top or bottom, so if we were to crop the image how would be do it // 1. Calculate what the width should be If we dont adjust the heigt var newIdealWidth = (int)(nHeight * 1.40920096852); // 2. This newIdealWidth should be smaller than the existing width... so work out the split on that Int32 newSplit = (nWidth - newIdealWidth) / 2; // 3. Now recrop the image using 0-nHeight as the height (i.e. full height) // but crop the sides so that its the correct aspect ration var newRect = new Rectangle(newSplit, 0, newIdealWidth, nHeight); img = CropImage(img, newRect); nHeight = img.Height; nWidth = img.Width; nSplit = 0; } // No, so I want to place this image on a larger canvas and we do this by Creating a new image to be the size that we want System.Drawing.Image canvas = new Bitmap(nWidth, nIdealHeight, PixelFormat.Format24bppRgb); Graphics g = Graphics.FromImage(canvas); #region Color // Whilst we can set the background colour we shall default to white if (string.IsNullOrEmpty(backgroundColour)) { backgroundColour = "FFFFFF"; } Color bc = ColorTranslator.FromHtml("#" + backgroundColour); #endregion Color // Filling the background (which gives us our broder) Brush backgroundBrush = new SolidBrush(bc); g.FillRectangle(backgroundBrush, -1, -1, nWidth + 1, nIdealHeight + 1); // draw the image at the position var rect = new Rectangle(0, nSplit, nWidth, nHeight); g.DrawImage(img, rect); return new ImgTextResult { Image = canvas, ImageFormat = ImageFormat.Png }; } My ImgTextResult is a class that returns an Action result for me but embedding the image from a memory stream into the response.outputstream. snippet from my ImageResults /// <summary> /// Execute the result /// </summary> /// <param name="context"></param> public override void ExecuteResult(ControllerContext context) { // output context.HttpContext.Response.Clear(); context.HttpContext.Response.ContentType = "image/png"; try { var memStream = new MemoryStream(); Image.Save(memStream, ImageFormat.Png); context.HttpContext.Response.BinaryWrite(memStream.ToArray()); context.HttpContext.Response.Flush(); context.HttpContext.Response.Close(); memStream.Dispose(); Image.Dispose(); } catch (Exception ex) { string a = ex.Message; } } Now all of this works locally and lovely, and indeed all of this works on my production server BUT Only for Firefox, Safari, Chrome (and other browsers) IE has a fit and decides that it either wont display the image or it does display the image after approx 154seconds of waiting..... I have made sure my HTML is XHTML compliant, I have made sure I am getting no Routing errors or crashes in my event log on the server.... Now obviously I have been a muppet and have done something wrong... but what I cant fathom is why in development all works fine, and in production all non IE browsers also work fine, but IE 8 using IIS 6.0 production server is having some kind of problem in returning this PNG and I dont have an error to trace... so what I am looking for is guidance as to how I can debug this problem.

    Read the article

  • Saving image from Gallery to db - Coursor IllegalStateException

    - by MyWay
    I want to save to db some strings with image. Image can be taken from gallery or user can set the sample one. In the other activity I have a listview which should present the rows with image and name. I'm facing so long this problem. It occurs when I wanna display listview with the image from gallery, If the sample image is saved in the row everything works ok. My problem is similar to this one: how to save image taken from camera and show it to listview - crashes with "IllegalStateException" but I can't find there the solution for me My table in db looks like this: public static final String KEY_ID = "_id"; public static final String ID_DETAILS = "INTEGER PRIMARY KEY AUTOINCREMENT"; public static final int ID_COLUMN = 0; public static final String KEY_NAME = "name"; public static final String NAME_DETAILS = "TEXT NOT NULL"; public static final int NAME_COLUMN = 1; public static final String KEY_DESCRIPTION = "description"; public static final String DESCRIPTION_DETAILS = "TEXT"; public static final int DESCRIPTION_COLUMN = 2; public static final String KEY_IMAGE ="image" ; public static final String IMAGE_DETAILS = "BLOP"; public static final int IMAGE_COLUMN = 3; //method which create our table private static final String CREATE_PRODUCTLIST_IN_DB = "CREATE TABLE " + DB_TABLE + "( " + KEY_ID + " " + ID_DETAILS + ", " + KEY_NAME + " " + NAME_DETAILS + ", " + KEY_DESCRIPTION + " " + DESCRIPTION_DETAILS + ", " + KEY_IMAGE +" " + IMAGE_DETAILS + ");"; inserting statement: public long insertToProductList(String name, String description, byte[] image) { ContentValues value = new ContentValues(); // get the id of column and value value.put(KEY_NAME, name); value.put(KEY_DESCRIPTION, description); value.put(KEY_IMAGE, image); // put into db return db.insert(DB_TABLE, null, value); } Button which add the picture and onActivityResult method which saves the image and put it into the imageview public void AddPicture(View v) { // creating specified intent which have to get data Intent intent = new Intent(Intent.ACTION_PICK); // From where we want choose our pictures intent.setType("image/*"); startActivityForResult(intent, PICK_IMAGE); } @Override protected void onActivityResult(int requestCode, int resultCode, Intent data) { // TODO Auto-generated method stub super.onActivityResult(requestCode, resultCode, data); // if identification code match to the intent, //if yes we know that is our picture, if(requestCode ==PICK_IMAGE ) { // check if the data comes with intent if(data!= null) { Uri chosenImage = data.getData(); String[] filePathColumn = {MediaStore.Images.Media.DATA}; Cursor cursor = getContentResolver().query(chosenImage, filePathColumn, null, null, null); cursor.moveToFirst(); int columnIndex = cursor.getColumnIndex(filePathColumn[0]); String filePat = cursor.getString(columnIndex); cursor.close(); ImageOfProduct = BitmapFactory.decodeFile(filePat); if(ImageOfProduct!=null) { picture.setImageBitmap(ImageOfProduct); } messageDisplayer("got picture, isn't null " + IdOfPicture); } } } Then the code which converts bitmap to byte[] public byte[] bitmapToByteConvert(Bitmap bit ) { // stream of data getted for compressed bitmap ByteArrayOutputStream gettedData = new ByteArrayOutputStream(); // compressing method bit.compress(CompressFormat.PNG, 0, gettedData); // our byte array return gettedData.toByteArray(); } The method which put data to the row: byte[] image=null; // if the name isn't put to the editView if(name.getText().toString().trim().length()== 0) { messageDisplayer("At least you need to type name of product if you want add it to the DB "); } else{ String desc = description.getText().toString(); if(description.getText().toString().trim().length()==0) { messageDisplayer("the description is set as none"); desc = "none"; } DB.open(); if(ImageOfProduct!= null){ image = bitmapToByteConvert(ImageOfProduct); messageDisplayer("image isn't null"); } else { BitmapDrawable drawable = (BitmapDrawable) picture.getDrawable(); image = bitmapToByteConvert(drawable.getBitmap()); } if(image.length>0 && image!=null) { messageDisplayer(Integer.toString(image.length)); } DB.insertToProductList(name.getText().toString(), desc, image ); DB.close(); messageDisplayer("well done you add the product"); finish(); You can see that I'm checking here the length of array to be sure that I don't send empty one. And here is the place where Error appears imo, this code is from activity which presents the listview with data taken from db private void LoadOurLayoutListWithInfo() { // firstly wee need to open connection with db db= new sqliteDB(getApplicationContext()); db.open(); // creating our custom adaprer, the specification of it will be typed // in our own class (MyArrayAdapter) which will be created below ArrayAdapter<ProductFromTable> customAdapter = new MyArrayAdapter(); //get the info from whole table tablecursor = db.getAllColumns(); if(tablecursor != null) { startManagingCursor(tablecursor); tablecursor.moveToFirst(); } // now we moving all info from tablecursor to ourlist if(tablecursor != null && tablecursor.moveToFirst()) { do{ // taking info from row in table int id = tablecursor.getInt(sqliteDB.ID_COLUMN); String name= tablecursor.getString(sqliteDB.NAME_COLUMN); String description= tablecursor.getString(sqliteDB.DESCRIPTION_COLUMN); byte[] image= tablecursor.getBlob(3); tablefromDB.add(new ProductFromTable(id,name,description,image)); // moving until we didn't find last row }while(tablecursor.moveToNext()); } listView = (ListView) findViewById(R.id.tagwriter_listoftags); //as description says // setAdapter = The ListAdapter which is responsible for maintaining //the data backing this list and for producing a view to represent //an item in that data set. listView.setAdapter(customAdapter); } I put the info from row tho objects which are stored in list. I read tones of question but I can't find any solution for me. Everything works when I put the sample image ( which is stored in app res folder ). Thx for any advice

    Read the article

  • Using C# to detect whether a filename character is considered international

    - by Morten Mertner
    I've written a small console application (source below) to locate and optionally rename files containing international characters, as they are a source of constant pain with most source control systems (some background on this below). The code I'm using has a simple dictionary with characters to look for and replace (and nukes every other character that uses more than one byte of storage), but it feels very hackish. What's the right way to (a) find out whether a character is international? and (b) what the best ASCII substitution character would be? Let me provide some background information on why this is needed. It so happens that the danish Å character has two different encodings in UTF-8, both representing the same symbol. These are known as NFC and NFD encodings. Windows and Linux will create NFC encoding by default but respect whatever encoding it is given. Mac will convert all names (when saving to a HFS+ partition) to NFD and therefore returns a different byte stream for the name of a file created on Windows. This effectively breaks Subversion, Git and lots of other utilities that don't care to properly handle this scenario. I'm currently evaluating Mercurial, which turns out to be even worse at handling international characters.. being fairly tired of these problems, either source control or the international character would have to go, and so here we are. My current implementation: public class Checker { private Dictionary<char, string> internationals = new Dictionary<char, string>(); private List<char> keep = new List<char>(); private List<char> seen = new List<char>(); public Checker() { internationals.Add( 'æ', "ae" ); internationals.Add( 'ø', "oe" ); internationals.Add( 'å', "aa" ); internationals.Add( 'Æ', "Ae" ); internationals.Add( 'Ø', "Oe" ); internationals.Add( 'Å', "Aa" ); internationals.Add( 'ö', "o" ); internationals.Add( 'ü', "u" ); internationals.Add( 'ä', "a" ); internationals.Add( 'é', "e" ); internationals.Add( 'è', "e" ); internationals.Add( 'ê', "e" ); internationals.Add( '¦', "" ); internationals.Add( 'Ã', "" ); internationals.Add( '©', "" ); internationals.Add( ' ', "" ); internationals.Add( '§', "" ); internationals.Add( '¡', "" ); internationals.Add( '³', "" ); internationals.Add( '­', "" ); internationals.Add( 'º', "" ); internationals.Add( '«', "-" ); internationals.Add( '»', "-" ); internationals.Add( '´', "'" ); internationals.Add( '`', "'" ); internationals.Add( '"', "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 147 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 148 } )[ 0 ], "-" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 153 } )[ 0 ], "'" ); internationals.Add( Encoding.UTF8.GetString( new byte[] { 226, 128, 166 } )[ 0 ], "." ); keep.Add( '-' ); keep.Add( '=' ); keep.Add( '\'' ); keep.Add( '.' ); } public bool IsInternationalCharacter( char c ) { var s = c.ToString(); byte[] bytes = Encoding.UTF8.GetBytes( s ); if( bytes.Length > 1 && ! internationals.ContainsKey( c ) && ! seen.Contains( c ) ) { Console.WriteLine( "X '{0}' ({1})", c, string.Join( ",", bytes ) ); seen.Add( c ); if( ! keep.Contains( c ) ) { internationals[ c ] = ""; } } return internationals.ContainsKey( c ); } public bool HasInternationalCharactersInName( string name, out string safeName ) { StringBuilder sb = new StringBuilder(); Array.ForEach( name.ToCharArray(), c => sb.Append( IsInternationalCharacter( c ) ? internationals[ c ] : c.ToString() ) ); int length = sb.Length; sb.Replace( " ", " " ); while( sb.Length != length ) { sb.Replace( " ", " " ); } safeName = sb.ToString().Trim(); string namePart = Path.GetFileNameWithoutExtension( safeName ); if( namePart.EndsWith( "." ) ) safeName = namePart.Substring( 0, namePart.Length - 1 ) + Path.GetExtension( safeName ); return name != safeName; } } And this would be invoked like this: FileInfo file = new File( "Århus.txt" ); string safeName; if( checker.HasInternationalCharactersInName( file.Name, out safeName ) ) { // rename file }

    Read the article

  • c windows connect() fails. error 10049

    - by Joshua Moore
    The following two pieces of code compile, but I get a connect() failed error on the client side. (compiled with MinGW). Client Code: // thanks to cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoClientWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define RCVBUFSIZE 32 // size of receive buffer void DieWithError(char *errorMessage); int main(int argc, char* argv[]) { int sock; struct sockaddr_in echoServAddr; unsigned short echoServPort; char *servIP; char *echoString; char echoBuffer[RCVBUFSIZE]; int echoStringLen; int bytesRcvd, totalBytesRcvd; WSAData wsaData; if((argc < 3) || (argc > 4)){ fprintf(stderr, "Usage: %s <Sever IP> <Echo Word> [<Echo Port>]\n", argv[0]); exit(1); } if (argc==4) echoServPort = atoi(argv[3]); // use given port if any else echoServPort = 7; // echo is well-known port for echo service if(WSAStartup(MAKEWORD(2, 0), &wsaData) != 0){ // load winsock 2.0 dll fprintf(stderr, "WSAStartup() failed"); exit(1); } // create reliable, stream socket using tcp if((sock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP)) < 0) DieWithError("socket() failed"); // construct the server address structure memset(&echoServAddr, 0, sizeof(echoServAddr)); echoServAddr.sin_family = AF_INET; echoServAddr.sin_addr.s_addr = inet_addr(servIP); // server IP address echoServAddr.sin_port = htons(echoServPort); // establish connection to the echo server if(connect(sock, (struct sockaddr*)&echoServAddr, sizeof(echoServAddr)) < 0) DieWithError("connect() failed"); echoStringLen = strlen(echoString); // determine input length // send the string, includeing the null terminator to the server if(send(sock, echoString, echoStringLen, 0)!= echoStringLen) DieWithError("send() sent a different number of bytes than expected"); totalBytesRcvd = 0; printf("Received: "); // setup to print the echoed string while(totalBytesRcvd < echoStringLen){ // receive up to the buffer size (minus 1 to leave space for a null terminator) bytes from the sender if(bytesRcvd = recv(sock, echoBuffer, RCVBUFSIZE-1, 0) <= 0) DieWithError("recv() failed or connection closed prematurely"); totalBytesRcvd += bytesRcvd; // keep tally of total bytes echoBuffer[bytesRcvd] = '\0'; printf("%s", echoBuffer); // print the echo buffer } printf("\n"); closesocket(sock); WSACleanup(); exit(0); } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } Server Code: // thanks cs.baylor.edu/~donahoo/practical/CSockets/code/TCPEchoServerWS.c #include <stdio.h> #include <winsock.h> #include <stdlib.h> #define MAXPENDING 5 // maximum outstanding connection requests #define RCVBUFSIZE 1000 void DieWithError(char *errorMessage); void HandleTCPClient(int clntSocket); // tcp client handling function int main(int argc, char **argv) { int serverSock; int clientSock; struct sockaddr_in echoServerAddr; struct sockaddr_in echoClientAddr; unsigned short echoServerPort; int clientLen; // length of client address data structure WSAData wsaData; if (argc!=2){ fprintf(stderr, "Usage: %s <Server Port>\n", argv[0]); exit(1); } echoServerPort = atoi(argv[1]); if(WSAStartup(MAKEWORD(2, 0), &wsaData)!=0){ fprintf(stderr, "WSAStartup() failed"); exit(1); } // create socket for incoming connections if((serverSock=socket(PF_INET, SOCK_STREAM, IPPROTO_TCP))<0) DieWithError("socket() failed"); // construct local address structure memset(&echoServerAddr, 0, sizeof(echoServerAddr)); echoServerAddr.sin_family = AF_INET; echoServerAddr.sin_addr.s_addr = htonl(INADDR_ANY); // any incoming interface echoServerAddr.sin_port = htons(echoServerPort); // local port // bind to the local address if(bind(serverSock, (struct sockaddr*)&echoServerAddr, sizeof(echoServerAddr) )<0) DieWithError("bind() failed"); // mark the socket so it will listen for incoming connections if(listen(serverSock, MAXPENDING)<0) DieWithError("listen() failed"); for (;;){ // run forever // set the size of the in-out parameter clientLen = sizeof(echoClientAddr); // wait for a client to connect if((clientSock = accept(serverSock, (struct sockaddr*)&echoClientAddr, &clientLen)) < 0) DieWithError("accept() failed"); // clientSock is connected to a client printf("Handling client %s\n", inet_ntoa(echoClientAddr.sin_addr)); HandleTCPClient(clientSock); } // NOT REACHED } void DieWithError(char *errorMessage) { fprintf(stderr, "%s: %d\n", errorMessage, WSAGetLastError()); exit(1); } void HandleTCPClient(int clientSocket) { char echoBuffer[RCVBUFSIZE]; // buffer for echostring int recvMsgSize; // size of received message // receive message from client if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0) <0)) DieWithError("recv() failed"); // send received string and receive again until end of transmission while(recvMsgSize > 0){ // echo message back to client if(send(clientSocket, echoBuffer, recvMsgSize, 0)!=recvMsgSize) DieWithError("send() failed"); // see if there's more data to receive if((recvMsgSize = recv(clientSocket, echoBuffer, RCVBUFSIZE, 0)) <0) DieWithError("recv() failed"); } closesocket(clientSocket); // close client socket } How can I fix this?

    Read the article

  • how can we generate the bit greater than 60000?

    - by thinthinyu
    we can now generate about 50000bits. my code cannot generate more than 60000 bit..please help me............m_B is member variable and type is CString. // LFSR_ECDlg.cpp : implementation file // #include "stdafx.h" #include "myecc.h" #include "LFSR_ECDlg.h" #include "MyClass.h" #ifdef _DEBUG #define new DEBUG_NEW #undef THIS_FILE static char THIS_FILE[] = __FILE__; #endif extern MyClass mycrv; ///////////////////////////////////////////////////////////////////////////// // LFSR_ECDlg dialog LFSR_ECDlg::LFSR_ECDlg(CWnd* pParent /*=NULL*/) : CDialog(LFSR_ECDlg::IDD, pParent) { //{{AFX_DATA_INIT(LFSR_ECDlg) m_C1 = 0; m_C2 = 0; m_B = _T(""); m_p = _T(""); m_Qty = 0; m_time = _T(""); //}}AFX_DATA_INIT } void LFSR_ECDlg::DoDataExchange(CDataExchange* pDX) { CDialog::DoDataExchange(pDX); //{{AFX_DATA_MAP(LFSR_ECDlg) DDX_Text(pDX, IDC_C1, m_C1); DDX_Text(pDX, IDC_C2, m_C2); DDX_Text(pDX, IDC_Sequence, m_B); DDX_Text(pDX, IDC_Sequence2, m_p); DDX_Text(pDX, IDC_QTY, m_Qty); DDV_MinMaxLong(pDX, m_Qty, 0, 2147483647); DDX_Text(pDX, IDC_time, m_time); //}}AFX_DATA_MAP } BEGIN_MESSAGE_MAP(LFSR_ECDlg, CDialog) //{{AFX_MSG_MAP(LFSR_ECDlg) ON_WM_SETCURSOR() ON_EN_CHANGE(IDC_Sequence, OnGeneratorLFSR) ON_MESSAGE(WM_MYPAINTMESSAGE,PaintMyCaption)//by ttyu ON_BN_CLICKED(IDC_save, Onsave) //}}AFX_MSG_MAP END_MESSAGE_MAP() ///////////////////////////////////////////////////////////////////////////// // LFSR_ECDlg message handlers bool LFSR_ECDlg::CheckDataEntry() { //if((m_Px>=mycrv.p)|(m_Py>=mycrv.p)) {AfxMessageBox("Seed [P] is invalid!");return false;}//by ttyu if((m_C1<=0) | (m_C1>mycrv.n)) {AfxMessageBox("Constant c1 is not valid!");return false;} if((m_C2<=0 )| (m_C2>mycrv.n)) {AfxMessageBox("Constant c2 is not valid!");return false;} return true; } void LFSR_ECDlg::OnOK() { UpdateData(true); static int stime,etime,dtime; CString txt; m_time=""; CTime t(CTime::GetCurrentTime()); CString txt1; txt1=""; //ms = t.GetDay(); // TODO: Add extra validation here stime=t.GetTime(); txt1.Format("%d",stime); AfxMessageBox (txt1); txt=""; if (CheckDataEntry()) OnGeneratorLFSR(); etime=t.GetTime(); CString txt2; txt2=""; txt2.Format("%d",etime); AfxMessageBox (txt2); dtime=etime-stime; txt.Format("%f",dtime); m_time+=txt; // UpdateData(false); //rtime.Format("%s, %s %d, %d.",day,month,dd,yy); //CDialog::OnOK(); } void LFSR_ECDlg::OnCancel() { // TODO: Add extra cleanup here CDialog::OnCancel(); } void LFSR_ECDlg::OnGeneratorLFSR() { // TODO: If this is a RICHEDIT control, the control will not // send this notification unless you override the CDialog::OnInitDialog() // function and call CRichEditCtrl().SetEventMask() // with the ENM_CHANGE flag ORed into the mask. // TODO: Add your control notification handler code here point P0,P1,P2; P0 = mycrv.G; P1 = mycrv.MulPoint(P0,2); int C1=m_C1, C2=m_C2, n=m_Qty, k=0; int q= (mycrv.p-1) / 2; m_p = ""; m_B = ""; CString txt; for(int i=0;i<n;i++) { txt=""; if(P0==mycrv.O) txt.Format("O"); else txt.Format("(%d, %d)",P0.x,P0.y); m_p +=txt; m_p += 13; m_p += 10; if((P0.y >= 0)&&(P0.y <= q)) m_B += "0"; else if(P0 == mycrv.O) m_B += "0"; else m_B += "1"; //m_B += 13;//by ttyu // m_B += 10;//by ttyu P2 = mycrv.AddPoints(mycrv.MulPoint(P1,C2), mycrv.MulPoint(P0,C1)); P0 = P1; P1 = P2; } } BOOL LFSR_ECDlg::OnInitDialog() { CDialog::OnInitDialog(); // TODO: Add extra initialization here //code for dlg bar CString str="LFSR_EC"; m_cap.SetCaption (str); m_cap.Install (this,WM_MYPAINTMESSAGE); ////////////////////////////// return TRUE; // return TRUE unless you set the focus to a control // EXCEPTION: OCX Property Pages should return FALSE } LRESULT LFSR_ECDlg::PaintMyCaption(WPARAM wp, LPARAM lp) { m_cap.PaintCaption(wp,lp); return 0; } BOOL LFSR_ECDlg::OnSetCursor(CWnd* pWnd, UINT nHitTest, UINT message) { // TODO: Add your message handler code here and/or call default return CDialog::OnSetCursor(pWnd, nHitTest, message); } void LFSR_ECDlg::Onsave() { this->UpdateData(); CFile bitstream; char strFilter[] = { "Stream Records (*.mpl)|*.mpl| (*.pis)|*.pis|All Files (*.*)|*.*||" }; CFileDialog FileDlg(FALSE, ".mpl", NULL, 0, strFilter); //insertion//by TTT CFile cf_object; if( FileDlg.DoModal() == IDOK ){ cf_object.Open( FileDlg.GetFileName(), CFile::modeCreate|CFile::modeWrite); //char szText[100]; //strcpy(szText, "File Write Test"); CString txt; txt=""; txt.Format("%s",m_B);//by ANO AfxMessageBox (txt);//by ANO int mB_size=m_B.GetLength(); cf_object.Write (m_B,mB_size); //insertion end /* if( FileDlg.DoModal() == IDOK ) { if( bitstream.Open(FileDlg.GetFileName(), CFile::modeCreate | CFile::modeWrite) == FALSE ) return; CArchive ar(&bitstream, CArchive::store); CString txt; txt=""; txt.Format("%s",m_B);//by ANO AfxMessageBox (txt);//by ANO //txt=m_B;//by ANO ar <<txt;//by ANO ar.Close(); } else return; bitstream.Close(); */ // TODO: Add your control notification handler code here } }

    Read the article

  • C++ Program performs better when piped

    - by ET1 Nerd
    I haven't done any programming in a decade. I wanted to get back into it, so I made this little pointless program as practice. The easiest way to describe what it does is with output of my --help codeblock: ./prng_bench --help ./prng_bench: usage: ./prng_bench $N $B [$T] This program will generate an N digit base(B) random number until all N digits are the same. Once a repeating N digit base(B) number is found, the following statistics are displayed: -Decimal value of all N digits. -Time & number of tries taken to randomly find. Optionally, this process is repeated T times. When running multiple repititions, averages for all N digit base(B) numbers are displayed at the end, as well as total time and total tries. My "problem" is that when the problem is "easy", say a 3 digit base 10 number, and I have it do a large number of passes the "total time" is less when piped to grep. ie: command ; command |grep took : ./prng_bench 3 10 999999 ; ./prng_bench 3 10 999999|grep took .... Pass# 999999: All 3 base(10) digits = 3 base(10). Time: 0.00005 secs. Tries: 23 It took 191.86701 secs & 99947208 tries to find 999999 repeating 3 digit base(10) numbers. An average of 0.00019 secs & 99 tries was needed to find each one. It took 159.32355 secs & 99947208 tries to find 999999 repeating 3 digit base(10) numbers. If I run the same command many times w/o grep time is always VERY close. I'm using srand(1234) for now, to test. The code between my calls to clock_gettime() for start and stop do not involve any stream manipulation, which would obviously affect time. I realize this is an exercise in futility, but I'd like to know why it behaves this way. Below is heart of the program. Here's a link to the full source on DB if anybody wants to compile and test. https://www.dropbox.com/s/6olqnnjf3unkm2m/prng_bench.cpp clock_gettime() requires -lrt. for (int pass_num=1; pass_num<=passes; pass_num++) { //Executes $passes # of times. clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &temp_time); //get time start_time = timetodouble(temp_time); //convert time to double, store as start_time for(i=1, tries=0; i!=0; tries++) { //loops until 'comparison for' fully completes. counts reps as 'tries'. <------------ for (i=0; i<Ndigits; i++) //Move forward through array. | results[i]=(rand()%base); //assign random num of base to element (digit). | /*for (i=0; i<Ndigits; i++) //---Debug Lines--------------- | std::cout<<" "<<results[i]; //---a LOT of output.---------- | std::cout << "\n"; //---Comment/decoment to disable/enable.*/ // | for (i=Ndigits-1; i>0 && results[i]==results[0]; i--); //Move through array, != element breaks & i!=0, new digits drawn. -| } //If all are equal i will be 0, nested for condition satisfied. -| clock_gettime(CLOCK_PROCESS_CPUTIME_ID, &temp_time); //get time draw_time = (timetodouble(temp_time) - start_time); //convert time to dbl, subtract start_time, set draw_time to diff. total_time += draw_time; //add time for this pass to total. total_tries += tries; //add tries for this pass to total. /*Formated output for each pass: Pass# ---: All -- base(--) digits = -- base(10) Time: ----.---- secs. Tries: ----- (LINE) */ std::cout<<"Pass# "<<std::setw(width_pass)<<pass_num<<": All "<<Ndigits<<" base("<<base<<") digits = " <<std::setw(width_base)<<results[0]<<" base(10). Time: "<<std::setw(width_time)<<draw_time <<" secs. Tries: "<<tries<<"\n"; } if(passes==1) return 0; //No need for totals and averages of 1 pass. /* It took ----.---- secs & ------ tries to find --- repeating -- digit base(--) numbers. (LINE) An average of ---.---- secs & ---- tries was needed to find each one. (LINE)(LINE) */ std::cout<<"It took "<<total_time<<" secs & "<<total_tries<<" tries to find " <<passes<<" repeating "<<Ndigits<<" digit base("<<base<<") numbers.\n" <<"An average of "<<total_time/passes<<" secs & "<<total_tries/passes <<" tries was needed to find each one. \n\n"; return 0;

    Read the article

  • ActiveMQ - "Cannot send, channel has already failed" every 2 seconds?

    - by quanta
    ActiveMQ 5.7.0 In the activemq.log, I'm seeing this exception every 2 seconds: 2013-11-05 13:00:52,374 | DEBUG | Transport Connection to: tcp://127.0.0.1:37501 failed: org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://127.0.0.1:37501 | org.apache.activemq.broker.TransportConnection.Transport | Async Exception Handler org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://127.0.0.1:37501 at org.apache.activemq.transport.AbstractInactivityMonitor.doOnewaySend(AbstractInactivityMonitor.java:282) at org.apache.activemq.transport.AbstractInactivityMonitor.oneway(AbstractInactivityMonitor.java:271) at org.apache.activemq.transport.TransportFilter.oneway(TransportFilter.java:85) at org.apache.activemq.transport.WireFormatNegotiator.oneway(WireFormatNegotiator.java:104) at org.apache.activemq.transport.MutexTransport.oneway(MutexTransport.java:68) at org.apache.activemq.broker.TransportConnection.dispatch(TransportConnection.java:1312) at org.apache.activemq.broker.TransportConnection.processDispatch(TransportConnection.java:838) at org.apache.activemq.broker.TransportConnection.iterate(TransportConnection.java:873) at org.apache.activemq.thread.PooledTaskRunner.runTask(PooledTaskRunner.java:129) at org.apache.activemq.thread.PooledTaskRunner$1.run(PooledTaskRunner.java:47) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) Due to this keyword InactivityIOException, the first thing comes to my mind is InactivityMonitor, but the strange thing is MaxInactivityDuration=30000: 2013-11-05 13:11:02,672 | DEBUG | Sending: WireFormatInfo { version=9, properties={MaxFrameSize=9223372036854775807, CacheSize=1024, CacheEnabled=true, SizePrefixDisabled=false, MaxInactivityDurationInitalDelay=10000, TcpNoDelayEnabled=true, MaxInactivityDuration=30000, TightEncodingEnabled=true, StackTraceEnabled=true}, magic=[A,c,t,i,v,e,M,Q]} | org.apache.activemq.transport.WireFormatNegotiator | ActiveMQ BrokerService[localhost] Task-2 Moreover, I also didn't see something like this: No message received since last read check for ... or: Channel was inactive for too (30000) long Do a netstat, I see these connections in TIME_WAIT state: tcp 0 0 127.0.0.1:38545 127.0.0.1:61616 TIME_WAIT - tcp 0 0 127.0.0.1:38544 127.0.0.1:61616 TIME_WAIT - tcp 0 0 127.0.0.1:38522 127.0.0.1:61616 TIME_WAIT - Here're the output when running tcpdump: Internet Protocol Version 4, Src: 127.0.0.1 (127.0.0.1), Dst: 127.0.0.1 (127.0.0.1) Version: 4 Header length: 20 bytes Differentiated Services Field: 0x00 (DSCP 0x00: Default; ECN: 0x00: Not-ECT (Not ECN-Capable Transport)) 0000 00.. = Differentiated Services Codepoint: Default (0x00) .... ..00 = Explicit Congestion Notification: Not-ECT (Not ECN-Capable Transport) (0x00) Total Length: 296 Identification: 0x7b6a (31594) Flags: 0x02 (Don't Fragment) 0... .... = Reserved bit: Not set .1.. .... = Don't fragment: Set ..0. .... = More fragments: Not set Fragment offset: 0 Time to live: 64 Protocol: TCP (6) Header checksum: 0xc063 [correct] [Good: True] [Bad: False] Source: 127.0.0.1 (127.0.0.1) Destination: 127.0.0.1 (127.0.0.1) Transmission Control Protocol, Src Port: 61616 (61616), Dst Port: 54669 (54669), Seq: 1, Ack: 2, Len: 244 Source port: 61616 (61616) Destination port: 54669 (54669) [Stream index: 11] Sequence number: 1 (relative sequence number) [Next sequence number: 245 (relative sequence number)] Acknowledgement number: 2 (relative ack number) Header length: 32 bytes Flags: 0x018 (PSH, ACK) 000. .... .... = Reserved: Not set ...0 .... .... = Nonce: Not set .... 0... .... = Congestion Window Reduced (CWR): Not set .... .0.. .... = ECN-Echo: Not set .... ..0. .... = Urgent: Not set .... ...1 .... = Acknowledgement: Set .... .... 1... = Push: Set .... .... .0.. = Reset: Not set .... .... ..0. = Syn: Not set .... .... ...0 = Fin: Not set Window size value: 256 [Calculated window size: 32768] [Window size scaling factor: 128] Checksum: 0xff1c [validation disabled] [Good Checksum: False] [Bad Checksum: False] Options: (12 bytes) No-Operation (NOP) No-Operation (NOP) Timestamps: TSval 2304161892, TSecr 2304161891 Kind: Timestamp (8) Length: 10 Timestamp value: 2304161892 Timestamp echo reply: 2304161891 [SEQ/ACK analysis] [Bytes in flight: 244] Constrained Application Protocol, TID: 240, Length: 244 00.. .... = Version: 0 ..00 .... = Type: Confirmable (0) .... 0000 = Option Count: 0 Code: Unknown (0) Transaction ID: 240 Payload Content-Type: text/plain (default), Length: 240, offset: 4 Line-based text data: text/plain [truncated] \001ActiveMQ\000\000\000\t\001\000\000\000<DE>\000\000\000\t\000\fMaxFrameSize\006\177<FF><FF><FF><FF> <FF><FF><FF>\000\tCacheSize\005\000\000\004\000\000\fCacheEnabled\001\001\000\022SizePrefixDisabled\001\000\000 MaxInactivityDurationInitalDelay\006\ It is very likely a tcp port check. This is what I see when trying telnet from another host: 2013-11-05 16:12:41,071 | DEBUG | Transport Connection to: tcp://10.8.20.9:46775 failed: java.io.EOFException | org.apache.activemq.broker.TransportConnection.Transport | ActiveMQ Transport: tcp:///10.8.20.9:46775@61616 java.io.EOFException at java.io.DataInputStream.readInt(DataInputStream.java:375) at org.apache.activemq.openwire.OpenWireFormat.unmarshal(OpenWireFormat.java:275) at org.apache.activemq.transport.tcp.TcpTransport.readCommand(TcpTransport.java:229) at org.apache.activemq.transport.tcp.TcpTransport.doRun(TcpTransport.java:221) at org.apache.activemq.transport.tcp.TcpTransport.run(TcpTransport.java:204) at java.lang.Thread.run(Thread.java:662) 2013-11-05 16:12:41,071 | DEBUG | Transport Connection to: tcp://10.8.20.9:46775 failed: org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection.Transport | Async Exception Handler org.apache.activemq.transport.InactivityIOException: Cannot send, channel has already failed: tcp://10.8.20.9:46775 at org.apache.activemq.transport.AbstractInactivityMonitor.doOnewaySend(AbstractInactivityMonitor.java:282) at org.apache.activemq.transport.AbstractInactivityMonitor.oneway(AbstractInactivityMonitor.java:271) at org.apache.activemq.transport.TransportFilter.oneway(TransportFilter.java:85) at org.apache.activemq.transport.WireFormatNegotiator.oneway(WireFormatNegotiator.java:104) at org.apache.activemq.transport.MutexTransport.oneway(MutexTransport.java:68) at org.apache.activemq.broker.TransportConnection.dispatch(TransportConnection.java:1312) at org.apache.activemq.broker.TransportConnection.processDispatch(TransportConnection.java:838) at org.apache.activemq.broker.TransportConnection.iterate(TransportConnection.java:873) at org.apache.activemq.thread.PooledTaskRunner.runTask(PooledTaskRunner.java:129) at org.apache.activemq.thread.PooledTaskRunner$1.run(PooledTaskRunner.java:47) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:662) 2013-11-05 16:12:41,071 | DEBUG | Unregistering MBean org.apache.activemq:BrokerName=localhost,Type=Connection,ConnectorName=ope nwire,ViewType=address,Name=tcp_//10.8.20.9_46775 | org.apache.activemq.broker.jmx.ManagementContext | ActiveMQ Transport: tcp:/ //10.8.20.9:46775@61616 2013-11-05 16:12:41,073 | DEBUG | Stopping connection: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,073 | DEBUG | Stopping transport tcp:///10.8.20.9:46775@61616 | org.apache.activemq.transport.tcp.TcpTranspo rt | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,073 | DEBUG | Initialized TaskRunnerFactory[ActiveMQ Task] using ExecutorService: java.util.concurrent.Threa dPoolExecutor@23cc2a28 | org.apache.activemq.thread.TaskRunnerFactory | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Closed socket Socket[addr=/10.8.20.9,port=46775,localport=61616] | org.apache.activemq.transpo rt.tcp.TcpTransport | ActiveMQ Task-1 2013-11-05 16:12:41,074 | DEBUG | Forcing shutdown of ExecutorService: java.util.concurrent.ThreadPoolExecutor@23cc2a28 | org.apache.activemq.util.ThreadPoolUtils | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Stopped transport: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,074 | DEBUG | Connection Stopped: tcp://10.8.20.9:46775 | org.apache.activemq.broker.TransportConnection | ActiveMQ BrokerService[localhost] Task-5 2013-11-05 16:12:41,902 | DEBUG | Sending: WireFormatInfo { version=9, properties={MaxFrameSize=9223372036854775807, CacheSize=1024, CacheEnabled=true, SizePrefixDisabled=false, MaxInactivityDurationInitalDelay=10000, TcpNoDelayEnabled=true, MaxInactivityDuration=30000, TightEncodingEnabled=true, StackTraceEnabled=true}, magic=[A,c,t,i,v,e,M,Q]} | org.apache.activemq.transport.WireFormatNegotiator | ActiveMQ BrokerService[localhost] Task-5 So the question is: how can I find out the process that is trying to connect to my ActiveMQ (from localhost) every 2 seconds?

    Read the article

  • mysql: Bind on unix socket: Permission denied

    - by Alex
    Can't start mysql with: sudo /usr/bin/mysqld_safe --datadir=/srv/mysql/myDB --log-error=/srv/mysql/logs/mysqld-myDB.log --pid-file=/srv/mysql/pids/mysqld-myDB.pid --user=mysql --socket=/srv/mysql/sockets/mysql-myDB.sock --port=3700 120222 13:40:48 mysqld_safe Starting mysqld daemon with databases from /srv/mysql/myDB 120222 13:40:54 mysqld_safe mysqld from pid file /srv/mysql/pids/mysqld-myDB.pid ended /srv/mysql/logs/mysqld-myDB.log: 120222 13:43:53 mysqld_safe Starting mysqld daemon with databases from /srv/mysql/myDB 120222 13:43:53 [Note] Plugin 'FEDERATED' is disabled. /usr/sbin/mysqld: Table 'plugin' is read only 120222 13:43:53 [ERROR] Can't open the mysql.plugin table. Please run mysql_upgrade to create it. 120222 13:43:53 InnoDB: Completed initialization of buffer pool 120222 13:43:53 InnoDB: Started; log sequence number 32 4232720908 120222 13:43:53 [ERROR] Can't start server : Bind on unix socket: Permission denied 120222 13:43:53 [ERROR] Do you already have another mysqld server running on socket: /srv/mysql/sockets/mysql-myDB.sock ? 120222 13:43:53 [ERROR] Aborting 120222 13:43:53 InnoDB: Starting shutdown... One instance mysqld is running: $ ps aux | grep mysql mysql 1093 0.0 0.2 169972 18700 ? Ssl 11:50 0:02 /usr/sbin/mysqld $ Port 3700 is available: $ netstat -a | grep 3700 $ Directory with sockets is empty: $ ls /srv/mysql/sockets/ $ There are all permissions: $ ls -l /srv/mysql/ total 20 drwxrwxrwx 2 mysql mysql 4096 2012-02-22 13:28 logs drwxrwxrwx 13 mysql mysql 4096 2012-02-22 13:44 myDB drwxrwxrwx 2 mysql mysql 4096 2012-02-22 12:55 pids drwxrwxrwx 2 mysql mysql 4096 2012-02-22 12:55 sockets drwxrwxrwx 2 mysql mysql 4096 2012-02-22 13:25 version Apparmor config: $cat /etc/apparmor.d/usr.sbin.mysqld # vim:syntax=apparmor # Last Modified: Tue Jun 19 17:37:30 2007 #include <tunables/global> /usr/sbin/mysqld flags=(complain) { #include <abstractions/base> #include <abstractions/nameservice> #include <abstractions/user-tmp> #include <abstractions/mysql> #include <abstractions/winbind> capability dac_override, capability sys_resource, capability setgid, capability setuid, network tcp, /etc/hosts.allow r, /etc/hosts.deny r, /etc/mysql/*.pem r, /etc/mysql/conf.d/ r, /etc/mysql/conf.d/* r, /etc/mysql/*.cnf r, /usr/lib/mysql/plugin/ r, /usr/lib/mysql/plugin/*.so* mr, /usr/sbin/mysqld mr, /usr/share/mysql/** r, /var/log/mysql.log rw, /var/log/mysql.err rw, /var/lib/mysql/ r, /var/lib/mysql/** rwk, /var/log/mysql/ r, /var/log/mysql/* rw, /{,var/}run/mysqld/mysqld.pid w, /{,var/}run/mysqld/mysqld.sock w, /srv/mysql/ r, /srv/mysql/** rwk, /sys/devices/system/cpu/ r, # Site-specific additions and overrides. See local/README for details. #include <local/usr.sbin.mysqld> } Any suggestions? UPD1: $ touch /srv/mysql/sockets/mysql-myDB.sock $ sudo chown mysql:mysql /srv/mysql/sockets/mysql-myDB.sock $ ls -l /srv/mysql/sockets/mysql-myDB.sock -rw-rw-r-- 1 mysql mysql 0 2012-02-22 14:29 /srv/mysql/sockets/mysql-myDB.sock $ sudo /usr/bin/mysqld_safe --datadir=/srv/mysql/myDB --log-error=/srv/mysql/logs/mysqld-myDB.log --pid-file=/srv/mysql/pids/mysqld-myDB.pid --user=mysql --socket=/srv/mysql/sockets/mysql-myDB.sock --port=3700 120222 14:30:18 mysqld_safe Can't log to error log and syslog at the same time. Remove all --log-error configuration options for --syslog to take effect. 120222 14:30:18 mysqld_safe Logging to '/srv/mysql/logs/mysqld-myDB.log'. 120222 14:30:18 mysqld_safe Starting mysqld daemon with databases from /srv/mysqlmyDB 120222 14:30:24 mysqld_safe mysqld from pid file /srv/mysql/pids/mysqld-myDB.pid ended $ ls -l /srv/mysql/sockets/mysql-myDB.sock ls: cannot access /srv/mysql/sockets/mysql-myDB.sock: No such file or directory $ UPD2: $ sudo netstat -lnp | grep mysql tcp 0 0 0.0.0.0:3306 0.0.0.0:* LISTEN 1093/mysqld unix 2 [ ACC ] STREAM LISTENING 5912 1093/mysqld /var/run/mysqld/mysqld.sock $ sudo lsof | grep /srv/mysql/sockets/mysql-myDB.sock lsof: WARNING: can't stat() fuse.gvfs-fuse-daemon file system /home/sears/.gvfs Output information may be incomplete. UPD3: $ cat /etc/mysql/my.cnf # # The MySQL database server configuration file. # # You can copy this to one of: # - "/etc/mysql/my.cnf" to set global options, # - "~/.my.cnf" to set user-specific options. # # One can use all long options that the program supports. # Run program with --help to get a list of available options and with # --print-defaults to see which it would actually understand and use. # # For explanations see # http://dev.mysql.com/doc/mysql/en/server-system-variables.html # This will be passed to all mysql clients # It has been reported that passwords should be enclosed with ticks/quotes # escpecially if they contain "#" chars... # Remember to edit /etc/mysql/debian.cnf when changing the socket location. [client] port = 3306 socket = /var/run/mysqld/mysqld.sock # Here is entries for some specific programs # The following values assume you have at least 32M ram # This was formally known as [safe_mysqld]. Both versions are currently parsed. [mysqld_safe] socket = /var/run/mysqld/mysqld.sock nice = 0 [mysqld] # # * Basic Settings # # # * IMPORTANT # If you make changes to these settings and your system uses apparmor, you may # also need to also adjust /etc/apparmor.d/usr.sbin.mysqld. # user = mysql socket = /var/run/mysqld/mysqld.sock port = 3306 basedir = /usr datadir = /var/lib/mysql tmpdir = /tmp skip-external-locking # # Instead of skip-networking the default is now to listen only on # localhost which is more compatible and is not less secure. #bind-address = 127.0.0.1 # # * Fine Tuning # key_buffer = 16M max_allowed_packet = 16M thread_stack = 192K thread_cache_size = 8 # This replaces the startup script and checks MyISAM tables if needed # the first time they are touched myisam-recover = BACKUP #max_connections = 100 #table_cache = 64 #thread_concurrency = 10 # # * Query Cache Configuration # query_cache_limit = 1M query_cache_size = 16M # # * Logging and Replication # # Both location gets rotated by the cronjob. # Be aware that this log type is a performance killer. # As of 5.1 you can enable the log at runtime! #general_log_file = /var/log/mysql/mysql.log #general_log = 1 log_error = /var/log/mysql/error.log # Here you can see queries with especially long duration #log_slow_queries = /var/log/mysql/mysql-slow.log #long_query_time = 2 #log-queries-not-using-indexes # # The following can be used as easy to replay backup logs or for replication. # note: if you are setting up a replication slave, see README.Debian about # other settings you may need to change. #server-id = 1 #log_bin = /var/log/mysql/mysql-bin.log expire_logs_days = 10 max_binlog_size = 100M #binlog_do_db = include_database_name #binlog_ignore_db = include_database_name # # * InnoDB # # InnoDB is enabled by default with a 10MB datafile in /var/lib/mysql/. # Read the manual for more InnoDB related options. There are many! # # * Security Features # # Read the manual, too, if you want chroot! # chroot = /var/lib/mysql/ # # For generating SSL certificates I recommend the OpenSSL GUI "tinyca". # # ssl-ca=/etc/mysql/cacert.pem # ssl-cert=/etc/mysql/server-cert.pem # ssl-key=/etc/mysql/server-key.pem [mysqldump] quick quote-names max_allowed_packet = 16M [mysql] #no-auto-rehash # faster start of mysql but no tab completition [isamchk] key_buffer = 16M # # * IMPORTANT: Additional settings that can override those from this file! # The files must end with '.cnf', otherwise they'll be ignored. # !includedir /etc/mysql/conf.d/

    Read the article

  • Compat Wireless Drivers Centrino N-2230

    - by user2699451
    So I am using linux and am having trouble installing the Compat Wireless drivers Hardware: Intel Centrino N-2230 OS: Linux Mint 64bit (kernel 13.08-generic) I followed this link http://www.mathyvanhoef.com/2012/09/compat-wireless-injection-patch-for.html Output: apt-get install linux-headers-$(uname -r) Reading package lists... Done Building dependency tree Reading state information... Done linux-headers-3.8.0-19-generic is already the newest version. 0 upgraded, 0 newly installed, 0 to remove and 19 not upgraded. charles-W55xEU compat-wireless-2010-10-16 # cd ~ charles-W55xEU ~ # dir adt-bundle-linux-x86_64-20130917.zip Desktop known_hosts_backup charles-W55xEU ~ # wget http://www.orbit-lab.org/kernel/compat-wireless-3-stable/v3.6/compat-wireless-3.6.2-1-snp.tar.bz2 --2013-10-29 10:28:23-- http://www.orbit-lab.org/kernel/compat-wireless-3-stable/v3.6/compat-wireless-3.6.2-1-snp.tar.bz2 Resolving www.orbit-lab.org (www.orbit-lab.org)... 128.6.192.131 Connecting to www.orbit-lab.org (www.orbit-lab.org)|128.6.192.131|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 4443700 (4,2M) [application/x-bzip2] Saving to: ‘compat-wireless-3.6.2-1-snp.tar.bz2’ 100%[======================================>] 4 443 700 13,5KB/s in 11m 3s 2013-10-29 10:39:27 (6,55 KB/s) - ‘compat-wireless-3.6.2-1-snp.tar.bz2’ saved [4443700/4443700] charles-W55xEU ~ # tar -xf compat-wireless-3.6.2-1-snp.tar.bz2 charles-W55xEU ~ # cd compat-wireless-3.6-rc6-1 bash: cd: compat-wireless-3.6-rc6-1: No such file or directory charles-W55xEU ~ # dir adt-bundle-linux-x86_64-20130917.zip Desktop compat-wireless-3.6.2-1-snp known_hosts_backup compat-wireless-3.6.2-1-snp.tar.bz2 charles-W55xEU ~ # cd compat-wireless-3.6.2-1-snp/ charles-W55xEU compat-wireless-3.6.2-1-snp # dir code-metrics.txt defconfigs linux-next-pending pending-stable compat drivers MAINTAINERS README config.mk enable-older-kernels Makefile scripts COPYRIGHT include net udev crap linux-next-cherry-picks patches charles-W55xEU compat-wireless-3.6.2-1-snp # wget http://patches.aircrack-ng.org/mac80211.compat08082009.wl_frag+ack_v1.patch --2013-10-29 10:40:52-- http://patches.aircrack-ng.org/mac80211.compat08082009.wl_frag+ack_v1.patch Resolving patches.aircrack-ng.org (patches.aircrack-ng.org)... 213.186.33.2, 2001:41d0:1:1b00:213:186:33:2 Connecting to patches.aircrack-ng.org (patches.aircrack-ng.org)|213.186.33.2|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 1049 (1,0K) [text/plain] Saving to: ‘mac80211.compat08082009.wl_frag+ack_v1.patch’ 100%[======================================>] 1 049 --.-K/s in 0s 2013-10-29 10:40:56 (180 MB/s) - ‘mac80211.compat08082009.wl_frag+ack_v1.patch’ saved [1049/1049] charles-W55xEU compat-wireless-3.6.2-1-snp # patch -p1 < mac80211.compat08082009.wl_frag+ack_v1.patch patching file net/mac80211/tx.c Hunk #1 succeeded at 792 (offset 115 lines). charles-W55xEU compat-wireless-3.6.2-1-snp # wget -Ocompatwireless_chan_qos_frag.patch http://pastie.textmate.org/pastes/4882675/download --2013-10-29 10:43:18-- http://pastie.textmate.org/pastes/4882675/download Resolving pastie.textmate.org (pastie.textmate.org)... 178.79.137.125 Connecting to pastie.textmate.org (pastie.textmate.org)|178.79.137.125|:80... connected. HTTP request sent, awaiting response... 301 Moved Permanently Location: http://pastie.org/pastes/4882675/download [following] --2013-10-29 10:43:20-- http://pastie.org/pastes/4882675/download Resolving pastie.org (pastie.org)... 96.126.119.119 Connecting to pastie.org (pastie.org)|96.126.119.119|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 2036 (2,0K) [application/octet-stream] Saving to: ‘compatwireless_chan_qos_frag.patch’ 100%[======================================>] 2 036 --.-K/s in 0,001s 2013-10-29 10:43:21 (3,35 MB/s) - ‘compatwireless_chan_qos_frag.patch’ saved [2036/2036] charles-W55xEU compat-wireless-3.6.2-1-snp # patch -p1 < compatwireless_chan_qos_frag.patch patching file drivers/net/wireless/rtl818x/rtl8187/dev.c patching file net/mac80211/tx.c Hunk #1 succeeded at 1495 (offset 8 lines). patching file net/wireless/chan.c charles-W55xEU compat-wireless-3.6.2-1-snp # make ./scripts/gen-compat-autoconf.sh /root/compat-wireless-3.6.2-1-snp/.config /root/compat-wireless-3.6.2-1-snp/config.mk > include/linux/compat_autoconf.h make -C /lib/modules/3.8.0-19-generic/build M=/root/compat-wireless-3.6.2-1-snp modules make[1]: Entering directory `/usr/src/linux-headers-3.8.0-19-generic' CC [M] /root/compat-wireless-3.6.2-1-snp/compat/main.o LD [M] /root/compat-wireless-3.6.2-1-snp/compat/compat.o CC [M] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:8:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_pci.h:217:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_pci_init’ In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:10:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_gmac_cmn.h:95:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_gmac_cmn_init’ In file included from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8:0: /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:25:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:152:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:17:21: warning: ‘bcma_bus_next_num’ defined but not used [-Wunused-variable] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:93:12: warning: ‘bcma_register_cores’ defined but not used [-Wunused-function] make[3]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o] Error 1 make[2]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma] Error 2 make[1]: *** [_module_/root/compat-wireless-3.6.2-1-snp] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.8.0-19-generic' make: *** [modules] Error 2 charles-W55xEU compat-wireless-3.6.2-1-snp # make install Warning: You may or may not need to update your initframfs, you should if any of the modules installed are part of your initramfs. To add support for your distribution to do this automatically send a patch against ./scripts/update-initramfs. If your distribution does not require this send a patch against the '/usr/bin/lsb_release -i -s': LinuxMint tag for your distribution to avoid this warning. make -C /lib/modules/3.8.0-19-generic/build M=/root/compat-wireless-3.6.2-1-snp modules make[1]: Entering directory `/usr/src/linux-headers-3.8.0-19-generic' CC [M] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:8:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_pci.h:217:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_pci_init’ In file included from /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma.h:10:0, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:8, from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8: /root/compat-wireless-3.6.2-1-snp/include/linux/bcma/bcma_driver_gmac_cmn.h:95:23: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_core_gmac_cmn_init’ In file included from /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:8:0: /root/compat-wireless-3.6.2-1-snp/drivers/bcma/bcma_private.h:25:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:152:15: error: expected ‘=’, ‘,’, ‘;’, ‘asm’ or ‘__attribute__’ before ‘bcma_bus_register’ /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:17:21: warning: ‘bcma_bus_next_num’ defined but not used [-Wunused-variable] /root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.c:93:12: warning: ‘bcma_register_cores’ defined but not used [-Wunused-function] make[3]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma/main.o] Error 1 make[2]: *** [/root/compat-wireless-3.6.2-1-snp/drivers/bcma] Error 2 make[1]: *** [_module_/root/compat-wireless-3.6.2-1-snp] Error 2 make[1]: Leaving directory `/usr/src/linux-headers-3.8.0-19-generic' make: *** [modules] Error 2 charles-W55xEU compat-wireless-3.6.2-1-snp # It keeps giving errors, same with other sites, I get the same errors??? I am lost, help needed

    Read the article

  • Ubuntu server has slow performance

    - by Rich
    I have a custom built Ubuntu 11.04 server with a 6 disk software RAID 10 primary drive. On it I'm primarily running a PostgreSQL and a few other utilities that stream data from the web. I often find after a few hours of uptime the server starts to lag with all kinds of processes. For example, it may take 10-15 seconds after log-in to get a shell prompt. It might take 5-10 seconds for top to come up. An ls might take a second or two. When I look at top there is almost no CPU usage. There's a fair amount of memory used by the PostgreSQL server but not enough to bleed into swap. I have no idea where to go from here, other than to suspect the RAID10 (I've only ever had software RAID 1's before). Edit: Output from top: top - 11:56:03 up 1:46, 3 users, load average: 0.89, 0.73, 0.72 Tasks: 119 total, 1 running, 118 sleeping, 0 stopped, 0 zombie Cpu(s): 0.2%us, 0.0%sy, 0.0%ni, 93.5%id, 6.2%wa, 0.0%hi, 0.0%si, 0.0%st Mem: 16325596k total, 3478248k used, 12847348k free, 20880k buffers Swap: 19534176k total, 0k used, 19534176k free, 3041992k cached PID USER PR NI VIRT RES SHR S %CPU %MEM TIME+ COMMAND 1747 woodsp 20 0 109m 10m 4888 S 1 0.1 0:42.70 python 357 root 20 0 0 0 0 S 0 0.0 0:00.40 jbd2/sda3-8 1 root 20 0 24324 2284 1344 S 0 0.0 0:00.84 init 2 root 20 0 0 0 0 S 0 0.0 0:00.00 kthreadd 3 root 20 0 0 0 0 S 0 0.0 0:00.24 ksoftirqd/0 6 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/0 7 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/0 8 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/1 10 root 20 0 0 0 0 S 0 0.0 0:00.02 ksoftirqd/1 12 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/1 13 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/2 14 root 20 0 0 0 0 S 0 0.0 0:00.00 kworker/2:0 15 root 20 0 0 0 0 S 0 0.0 0:00.00 ksoftirqd/2 16 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/2 17 root RT 0 0 0 0 S 0 0.0 0:00.00 migration/3 18 root 20 0 0 0 0 S 0 0.0 0:00.00 kworker/3:0 19 root 20 0 0 0 0 S 0 0.0 0:00.02 ksoftirqd/3 20 root RT 0 0 0 0 S 0 0.0 0:00.01 watchdog/3 21 root 0 -20 0 0 0 S 0 0.0 0:00.00 cpuset 22 root 0 -20 0 0 0 S 0 0.0 0:00.00 khelper 23 root 20 0 0 0 0 S 0 0.0 0:00.00 kdevtmpfs 24 root 0 -20 0 0 0 S 0 0.0 0:00.00 netns 26 root 20 0 0 0 0 S 0 0.0 0:00.00 sync_supers df -h rpsharp@ncp-skookum:~$ df -h Filesystem Size Used Avail Use% Mounted on /dev/sda3 1.8T 549G 1.2T 32% / udev 7.8G 4.0K 7.8G 1% /dev tmpfs 3.2G 492K 3.2G 1% /run none 5.0M 0 5.0M 0% /run/lock none 7.8G 0 7.8G 0% /run/shm /dev/sda2 952M 128K 952M 1% /boot/efi /dev/md0 5.5T 562G 4.7T 11% /usr/local free -m psharp@ncp-skookum:~$ free -m total used free shared buffers cached Mem: 15942 3409 12533 0 20 2983 -/+ buffers/cache: 405 15537 Swap: 19076 0 19076 tail -50 /var/log/syslog Jul 3 06:31:32 ncp-skookum rsyslogd: [origin software="rsyslogd" swVersion="5.8.6" x-pid="1070" x-info="http://www.rsyslog.com"] rsyslogd was HUPed Jul 3 06:39:01 ncp-skookum CRON[14211]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 06:40:01 ncp-skookum CRON[14223]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 07:00:01 ncp-skookum CRON[14328]: (woodsp) CMD (/home/woodsp/bin/mail_tweetupdate # email an update) Jul 3 07:00:01 ncp-skookum CRON[14327]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 07:00:28 ncp-skookum sendmail[14356]: q63E0SoZ014356: from=woodsp, size=2328, class=0, nrcpts=2, msgid=<[email protected]>, relay=woodsp@localhost Jul 3 07:00:29 ncp-skookum sm-mta[14357]: q63E0Si6014357: from=<[email protected]>, size=2569, class=0, nrcpts=2, msgid=<[email protected]>, proto=ESMTP, daemon=MTA-v4, relay=localhost [127.0.0.1] Jul 3 07:00:29 ncp-skookum sendmail[14356]: q63E0SoZ014356: to=Spencer Wood <[email protected]>,Martin Lacayo <[email protected]>, ctladdr=woodsp (1004/1005), delay=00:00:01, xdelay=00:00:01, mailer=relay, pri=62328, relay=[127.0.0.1] [127.0.0.1], dsn=2.0.0, stat=Sent (q63E0Si6014357 Message accepted for delivery) Jul 3 07:00:29 ncp-skookum sm-mta[14359]: STARTTLS=client, relay=mx3.stanford.edu., version=TLSv1/SSLv3, verify=FAIL, cipher=DHE-RSA-AES256-SHA, bits=256/256 Jul 3 07:00:29 ncp-skookum sm-mta[14359]: q63E0Si6014357: to=<[email protected]>,<[email protected]>, ctladdr=<[email protected]> (1004/1005), delay=00:00:01, xdelay=00:00:00, mailer=esmtp, pri=152569, relay=mx3.stanford.edu. [171.67.219.73], dsn=2.0.0, stat=Sent (Ok: queued as 8F3505802AC) Jul 3 07:09:08 ncp-skookum CRON[14396]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 07:17:01 ncp-skookum CRON[14438]: (root) CMD ( cd / && run-parts --report /etc/cron.hourly) Jul 3 07:20:01 ncp-skookum CRON[14453]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 07:39:01 ncp-skookum CRON[14551]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 07:40:01 ncp-skookum CRON[14562]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 08:00:01 ncp-skookum CRON[14668]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 08:09:01 ncp-skookum CRON[14724]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 08:17:01 ncp-skookum CRON[14766]: (root) CMD ( cd / && run-parts --report /etc/cron.hourly) Jul 3 08:20:01 ncp-skookum CRON[14781]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Jul 3 08:39:01 ncp-skookum CRON[14881]: (root) CMD ( [ -x /usr/lib/php5/maxlifetime ] && [ -d /var/lib/php5 ] && find /var/lib/php5/ -depth -mindepth 1 -maxdepth 1 -type f -cmin +$(/usr/lib/php5/maxlifetime) ! -execdir fuser -s {} 2>/dev/null \; -delete) Jul 3 08:40:01 ncp-skookum CRON[14892]: (smmsp) CMD (test -x /etc/init.d/sendmail && /usr/share/sendmail/sendmail cron-msp) Output of hdparm -t /dev/sd{a,b,c,d,e,f} This looks suspicious? /dev/sda: Timing buffered disk reads: 2 MB in 4.84 seconds = 423.39 kB/sec /dev/sdb: Timing buffered disk reads: 420 MB in 3.01 seconds = 139.74 MB/sec /dev/sdc: Timing buffered disk reads: 390 MB in 3.00 seconds = 129.87 MB/sec /dev/sdd: Timing buffered disk reads: 416 MB in 3.00 seconds = 138.51 MB/sec /dev/sde: Timing buffered disk reads: 422 MB in 3.00 seconds = 140.50 MB/sec /dev/sdf: Timing buffered disk reads: 416 MB in 3.01 seconds = 138.26 MB/sec

    Read the article

  • Rails + Nginx + Unicorn multiple apps

    - by Mikhail Nikalyukin
    I get the server where is currently installed two apps and i need to add another one, here is my configs. nginx.conf user www-data www-data; worker_processes 4; pid /var/run/nginx.pid; events { worker_connections 768; # multi_accept on; } http { sendfile on; tcp_nopush on; tcp_nodelay on; keepalive_timeout 65; types_hash_max_size 2048; include /etc/nginx/mime.types; default_type application/octet-stream; ## # Logging Settings ## access_log /var/log/nginx/access.log; error_log /var/log/nginx/error.log; ## # Disable unknown domains ## server { listen 80 default; server_name _; return 444; } ## # Virtual Host Configs ## include /home/ruby/apps/*/shared/config/nginx.conf; } unicorn.rb deploy_to = "/home/ruby/apps/staging.domain.com" rails_root = "#{deploy_to}/current" pid_file = "#{deploy_to}/shared/pids/unicorn.pid" socket_file= "#{deploy_to}/shared/sockets/.sock" log_file = "#{rails_root}/log/unicorn.log" err_log = "#{rails_root}/log/unicorn_error.log" old_pid = pid_file + '.oldbin' timeout 30 worker_processes 10 # ????? ???? ? ??????????? ?? ????????, ???????? ??????? ? ??????? ???? ???? listen socket_file, :backlog => 1024 pid pid_file stderr_path err_log stdout_path log_file preload_app true GC.copy_on_write_friendly = true if GC.respond_to?(:copy_on_write_friendly=) before_exec do |server| ENV["BUNDLE_GEMFILE"] = "#{rails_root}/Gemfile" end before_fork do |server, worker| defined?(ActiveRecord::Base) and ActiveRecord::Base.connection.disconnect! if File.exists?(old_pid) && server.pid != old_pid begin Process.kill("QUIT", File.read(old_pid).to_i) rescue Errno::ENOENT, Errno::ESRCH end end end after_fork do |server, worker| defined?(ActiveRecord::Base) and ActiveRecord::Base.establish_connection end Also im added capistrano to the project deploy.rb # encoding: utf-8 require 'capistrano/ext/multistage' require 'rvm/capistrano' require 'bundler/capistrano' set :stages, %w(staging production) set :default_stage, "staging" default_run_options[:pty] = true ssh_options[:paranoid] = false ssh_options[:forward_agent] = true set :scm, "git" set :user, "ruby" set :runner, "ruby" set :use_sudo, false set :deploy_via, :remote_cache set :rvm_ruby_string, '1.9.2' # Create uploads directory and link task :configure, :roles => :app do run "cp #{shared_path}/config/database.yml #{release_path}/config/database.yml" # run "ln -s #{shared_path}/db/sphinx #{release_path}/db/sphinx" # run "ln -s #{shared_path}/config/unicorn.rb #{release_path}/config/unicorn.rb" end namespace :deploy do task :restart do run "if [ -f #{unicorn_pid} ] && [ -e /proc/$(cat #{unicorn_pid}) ]; then kill -s USR2 `cat #{unicorn_pid}`; else cd #{deploy_to}/current && bundle exec unicorn_rails -c #{unicorn_conf} -E #{rails_env} -D; fi" end task :start do run "cd #{deploy_to}/current && bundle exec unicorn_rails -c #{unicorn_conf} -E #{rails_env} -D" end task :stop do run "if [ -f #{unicorn_pid} ] && [ -e /proc/$(cat #{unicorn_pid}) ]; then kill -QUIT `cat #{unicorn_pid}`; fi" end end before 'deploy:finalize_update', 'configure' after "deploy:update", "deploy:migrate", "deploy:cleanup" require './config/boot' nginx.conf in app shared path upstream staging_whotracker { server unix:/home/ruby/apps/staging.whotracker.com/shared/sockets/.sock; } server { listen 209.105.242.45; server_name beta.whotracker.com; rewrite ^/(.*) http://www.beta.whotracker.com/$1 permanent; } server { listen 209.105.242.45; server_name www.beta.hotracker.com; root /home/ruby/apps/staging.whotracker.com/current/public; location ~ ^/sitemaps/ { root /home/ruby/apps/staging.whotracker.com/current/system; if (!-f $request_filename) { break; } if (-f $request_filename) { expires -1; break; } } # cache static files :P location ~ ^/(images|javascripts|stylesheets)/ { root /home/ruby/apps/staging.whotracker.com/current/public; if ($query_string ~* "^[0-9a-zA-Z]{40}$") { expires max; break; } if (!-f $request_filename) { break; } } if ( -f /home/ruby/apps/staging.whotracker.com/shared/offline ) { return 503; } location /blog { index index.php index.html index.htm; try_files $uri $uri/ /blog/index.php?q=$uri; } location ~ \.php$ { try_files $uri =404; include /etc/nginx/fastcgi_params; fastcgi_pass unix:/var/run/php-fastcgi/php-fastcgi.socket; fastcgi_index index.php; fastcgi_param SCRIPT_FILENAME $document_root$fastcgi_script_name; } location / { proxy_set_header HTTP_REFERER $http_referer; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Host $http_host; proxy_redirect off; proxy_max_temp_file_size 0; # If the file exists as a static file serve it directly without # running all the other rewite tests on it if (-f $request_filename) { break; } if (!-f $request_filename) { proxy_pass http://staging_whotracker; break; } } error_page 502 =503 @maintenance; error_page 500 504 /500.html; error_page 503 @maintenance; location @maintenance { rewrite ^(.*)$ /503.html break; } } unicorn.log executing ["/home/ruby/apps/staging.whotracker.com/shared/bundle/ruby/1.9.1/bin/unicorn_rails", "-c", "/home/ruby/apps/staging.whotracker.com/current/config/unicorn.rb", "-E", "staging", "-D", {5=>#<Kgio::UNIXServer:/home/ruby/apps/staging.whotracker.com/shared/sockets/.sock>}] (in /home/ruby/apps/staging.whotracker.com/releases/20120517114413) I, [2012-05-17T06:43:48.111717 #14636] INFO -- : inherited addr=/home/ruby/apps/staging.whotracker.com/shared/sockets/.sock fd=5 I, [2012-05-17T06:43:48.111938 #14636] INFO -- : Refreshing Gem list worker=0 ready ... master process ready ... reaped #<Process::Status: pid 2590 exit 0> worker=6 ... master complete Deploy goes successfully, but when i try to access beta.whotracker.com or ip-address i get SERVER NOT FOUND error, while others app works great. Nothing shows up in error logs. Can you please point me where is my fault?

    Read the article

< Previous Page | 204 205 206 207 208 209 210 211  | Next Page >