Search Results

Search found 81493 results on 3260 pages for 'file size'.

Page 21/3260 | < Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >

  • Not able to delete file from the server?

    - by kvijayhari
    I've a file called piture-list.php in my website... When i see them through the ftp client it shows two files with different filesizes.. as File name filesize picture-list.php 19818 picture-list.php 9063 When i select the file with 9063 and delete using ftp it deletes the file with the filesize 19818 then i used the command prompt to list files and happened to see actually there were two files one with the original name and other with a space before the filename (" picture-list.php").. I tried to move, delete the file but nothing is successful.. What may be the issue??

    Read the article

  • How to get back win32 executable file

    - by Ahmed Ezz
    i make something by wrong... when i right click into .exe file then choose OPEN with and i select choose a program then i select wrong program to open with... then i checked the checkBox that have the label [Always use the selected program to open this kind of file]... The Problem??? All .exe file changed into the wrong program i select it-- so all .exe file opened with this program... My Question?? HOW to get back all .exe file to the regular work..?? and thanks in advance :)

    Read the article

  • Regular expression from font to span (size and colour) and back (VB.NET)

    - by chapmanio
    Hi, I am looking for a regular expression that can convert my font tags (only with size and colour attributes) into span tags with the relevant inline css. This will be done in VB.NET if that helps at all. I also need a regular expression to go the other way as well. To elaborate below is an example of the conversion I am looking for: <font size="10">some text</font> To then become: <span style="font-size:10px;">some text</span> So converting the tag and putting a "px" at the end of whatever the font size is (I don't need to change/convert the font size, just stick px at the end). The regular expression needs to cope with a font tag that only has a size attribute, only a color attribute, or both: <font size="10">some text</font> <font color="#000000">some text</font> <font size="10" color="#000000">some text</font> <font color="#000000" size="10">some text</font> I also need another regular expression to do the opposite conversion. So for example: <span style="font-size:10px;">some text</span> Will become: <font size="10">some text</font> As before converting the tag but this time removing the "px", I don't need to worry about changing the font size. Again this will also need to cope with the size styling, font styling, and a combination of both: <span style="font-size:10px;">some text</span> <span style="color:#000000;">some text</span> <span style="font-size:10px; color:#000000;">some text</span> <span style="color:#000000; font-size:10px;">some text</span> I apprecitate this is a lot to ask, I am hopeless with regular expressions and need to find a way of making these conversions in my code. Thanks so much to anyone that can/is willing to help me!

    Read the article

  • Display particular data into a file

    - by Avinash K G
    I'm new to Ubuntu and have been using it for a couple of weeks now. Recently I encountered a problem where in I had to display a particular data on to a file. Here is the output displayed on the terminal. Potential vulnerability found (CVE-2009-4028) CVSS Score is 6.8 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2009-4030) CVSS Score is 4.4 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2009-5026) CVSS Score is 6.8 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0075) CVSS Score is 1.7 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0087) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0101) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0102) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0112) CVSS Score is 3.5 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0113) CVSS Score is 5.5 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0114) CVSS Score is 3.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0115) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0116) CVSS Score is 4.9 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0118) CVSS Score is 4.9 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0119) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0120) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0484) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0485) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0490) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0492) CVSS Score is 2.1 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0540) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0553) CVSS Score is 7.5 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0574) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2012-0583) CVSS Score is 4.0 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2013-1492) CVSS Score is 7.5 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2013-1506) CVSS Score is 2.8 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) Potential vulnerability found (CVE-2013-1521) CVSS Score is 6.5 Full vulnerability match (incl. edition/language) File "/usr/sbin/mysqld" (CPE = cpe:/a:mysql:mysql:5.1:::) on host glynis-desktop (key glynis-desktop) I intend to display the Potential vulnerability found field and the corresponding score alone. There seems to be about 9995 entries and I would like to display all of them. I have been using this command as of now awk '/CVSS Score is/ < /Potential vulnerability found/' output.txt but this seems to display only the name of the vulnerability or the score. How do I display this in file(text,excel) such that all the vulnerability and the corresponding score willbe displayed. Any help would be appreciated Thank you.

    Read the article

  • SQL SERVER – Shrinking Database is Bad – Increases Fragmentation – Reduces Performance

    - by pinaldave
    Earlier, I had written two articles related to Shrinking Database. I wrote about why Shrinking Database is not good. SQL SERVER – SHRINKDATABASE For Every Database in the SQL Server SQL SERVER – What the Business Says Is Not What the Business Wants I received many comments on Why Database Shrinking is bad. Today we will go over a very interesting example that I have created for the same. Here are the quick steps of the example. Create a test database Create two tables and populate with data Check the size of both the tables Size of database is very low Check the Fragmentation of one table Fragmentation will be very low Truncate another table Check the size of the table Check the fragmentation of the one table Fragmentation will be very low SHRINK Database Check the size of the table Check the fragmentation of the one table Fragmentation will be very HIGH REBUILD index on one table Check the size of the table Size of database is very HIGH Check the fragmentation of the one table Fragmentation will be very low Here is the script for the same. USE MASTER GO CREATE DATABASE ShrinkIsBed GO USE ShrinkIsBed GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Create FirstTable CREATE TABLE FirstTable (ID INT, FirstName VARCHAR(100), LastName VARCHAR(100), City VARCHAR(100)) GO -- Create Clustered Index on ID CREATE CLUSTERED INDEX [IX_FirstTable_ID] ON FirstTable ( [ID] ASC ) ON [PRIMARY] GO -- Create SecondTable CREATE TABLE SecondTable (ID INT, FirstName VARCHAR(100), LastName VARCHAR(100), City VARCHAR(100)) GO -- Create Clustered Index on ID CREATE CLUSTERED INDEX [IX_SecondTable_ID] ON SecondTable ( [ID] ASC ) ON [PRIMARY] GO -- Insert One Hundred Thousand Records INSERT INTO FirstTable (ID,FirstName,LastName,City) SELECT TOP 100000 ROW_NUMBER() OVER (ORDER BY a.name) RowID, 'Bob', CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%2 = 1 THEN 'Smith' ELSE 'Brown' END, CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 1 THEN 'New York' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 5 THEN 'San Marino' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 3 THEN 'Los Angeles' ELSE 'Houston' END FROM sys.all_objects a CROSS JOIN sys.all_objects b GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Insert One Hundred Thousand Records INSERT INTO SecondTable (ID,FirstName,LastName,City) SELECT TOP 100000 ROW_NUMBER() OVER (ORDER BY a.name) RowID, 'Bob', CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%2 = 1 THEN 'Smith' ELSE 'Brown' END, CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 1 THEN 'New York' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 5 THEN 'San Marino' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 3 THEN 'Los Angeles' ELSE 'Houston' END FROM sys.all_objects a CROSS JOIN sys.all_objects b GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Check Fragmentations in the database SELECT avg_fragmentation_in_percent, fragment_count FROM sys.dm_db_index_physical_stats (DB_ID(), OBJECT_ID('SecondTable'), NULL, NULL, 'LIMITED') GO Let us check the table size and fragmentation. Now let us TRUNCATE the table and check the size and Fragmentation. USE MASTER GO CREATE DATABASE ShrinkIsBed GO USE ShrinkIsBed GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Create FirstTable CREATE TABLE FirstTable (ID INT, FirstName VARCHAR(100), LastName VARCHAR(100), City VARCHAR(100)) GO -- Create Clustered Index on ID CREATE CLUSTERED INDEX [IX_FirstTable_ID] ON FirstTable ( [ID] ASC ) ON [PRIMARY] GO -- Create SecondTable CREATE TABLE SecondTable (ID INT, FirstName VARCHAR(100), LastName VARCHAR(100), City VARCHAR(100)) GO -- Create Clustered Index on ID CREATE CLUSTERED INDEX [IX_SecondTable_ID] ON SecondTable ( [ID] ASC ) ON [PRIMARY] GO -- Insert One Hundred Thousand Records INSERT INTO FirstTable (ID,FirstName,LastName,City) SELECT TOP 100000 ROW_NUMBER() OVER (ORDER BY a.name) RowID, 'Bob', CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%2 = 1 THEN 'Smith' ELSE 'Brown' END, CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 1 THEN 'New York' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 5 THEN 'San Marino' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 3 THEN 'Los Angeles' ELSE 'Houston' END FROM sys.all_objects a CROSS JOIN sys.all_objects b GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Insert One Hundred Thousand Records INSERT INTO SecondTable (ID,FirstName,LastName,City) SELECT TOP 100000 ROW_NUMBER() OVER (ORDER BY a.name) RowID, 'Bob', CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%2 = 1 THEN 'Smith' ELSE 'Brown' END, CASE WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 1 THEN 'New York' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 5 THEN 'San Marino' WHEN ROW_NUMBER() OVER (ORDER BY a.name)%10 = 3 THEN 'Los Angeles' ELSE 'Houston' END FROM sys.all_objects a CROSS JOIN sys.all_objects b GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Check Fragmentations in the database SELECT avg_fragmentation_in_percent, fragment_count FROM sys.dm_db_index_physical_stats (DB_ID(), OBJECT_ID('SecondTable'), NULL, NULL, 'LIMITED') GO You can clearly see that after TRUNCATE, the size of the database is not reduced and it is still the same as before TRUNCATE operation. After the Shrinking database operation, we were able to reduce the size of the database. If you notice the fragmentation, it is considerably high. The major problem with the Shrink operation is that it increases fragmentation of the database to very high value. Higher fragmentation reduces the performance of the database as reading from that particular table becomes very expensive. One of the ways to reduce the fragmentation is to rebuild index on the database. Let us rebuild the index and observe fragmentation and database size. -- Rebuild Index on FirstTable ALTER INDEX IX_SecondTable_ID ON SecondTable REBUILD GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Check Fragmentations in the database SELECT avg_fragmentation_in_percent, fragment_count FROM sys.dm_db_index_physical_stats (DB_ID(), OBJECT_ID('SecondTable'), NULL, NULL, 'LIMITED') GO You can notice that after rebuilding, Fragmentation reduces to a very low value (almost same to original value); however the database size increases way higher than the original. Before rebuilding, the size of the database was 5 MB, and after rebuilding, it is around 20 MB. Regular rebuilding the index is rebuild in the same user database where the index is placed. This usually increases the size of the database. Look at irony of the Shrinking database. One person shrinks the database to gain space (thinking it will help performance), which leads to increase in fragmentation (reducing performance). To reduce the fragmentation, one rebuilds index, which leads to size of the database to increase way more than the original size of the database (before shrinking). Well, by Shrinking, one did not gain what he was looking for usually. Rebuild indexing is not the best suggestion as that will create database grow again. I have always remembered the excellent post from Paul Randal regarding Shrinking the database is bad. I suggest every one to read that for accuracy and interesting conversation. Let us run following script where we Shrink the database and REORGANIZE. -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Check Fragmentations in the database SELECT avg_fragmentation_in_percent, fragment_count FROM sys.dm_db_index_physical_stats (DB_ID(), OBJECT_ID('SecondTable'), NULL, NULL, 'LIMITED') GO -- Shrink the Database DBCC SHRINKDATABASE (ShrinkIsBed); GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Check Fragmentations in the database SELECT avg_fragmentation_in_percent, fragment_count FROM sys.dm_db_index_physical_stats (DB_ID(), OBJECT_ID('SecondTable'), NULL, NULL, 'LIMITED') GO -- Rebuild Index on FirstTable ALTER INDEX IX_SecondTable_ID ON SecondTable REORGANIZE GO -- Name of the Database and Size SELECT name, (size*8) Size_KB FROM sys.database_files GO -- Check Fragmentations in the database SELECT avg_fragmentation_in_percent, fragment_count FROM sys.dm_db_index_physical_stats (DB_ID(), OBJECT_ID('SecondTable'), NULL, NULL, 'LIMITED') GO You can see that REORGANIZE does not increase the size of the database or remove the fragmentation. Again, I no way suggest that REORGANIZE is the solution over here. This is purely observation using demo. Read the blog post of Paul Randal. Following script will clean up the database -- Clean up USE MASTER GO ALTER DATABASE ShrinkIsBed SET SINGLE_USER WITH ROLLBACK IMMEDIATE GO DROP DATABASE ShrinkIsBed GO There are few valid cases of the Shrinking database as well, but that is not covered in this blog post. We will cover that area some other time in future. Additionally, one can rebuild index in the tempdb as well, and we will also talk about the same in future. Brent has written a good summary blog post as well. Are you Shrinking your database? Well, when are you going to stop Shrinking it? Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: Pinal Dave, PostADay, SQL, SQL Authority, SQL Index, SQL Performance, SQL Query, SQL Scripts, SQL Server, SQL Tips and Tricks, SQLServer, T SQL, Technology

    Read the article

  • AFP, SMB, NFS which is the best data transfer protocol ?

    - by Kami
    I have a computer with large hard disks running Gentoo. I have to serve med/big files via a wired network to Apple devices (all of them running OS X). Which protocol is the best for the following needs ? : Speed Ease of use (by the clients and the server) Less limited (max file size, limited charset for filenames) Security

    Read the article

  • How to store millions of pictures about 2k each in size

    - by LuftMensch
    We're creating an ASP.Net MVC site that will need to store 1 million+ pictures, all around 2k-5k in size. From previous ressearch, it looks like a file server is probably better than a db (feel free to comment otherwise). Is there anything special to consider when storing this many files? Are there any issues with Windows being able to find the photo quickly if there are so many files in one folder? Does a segmented directory structure need to be created, for example dividing them up by filename? It would be nice if the solution would scale to at least 10 million pictures for potential future expansion needs.

    Read the article

  • USB device Set Attribute in C#

    - by p19lord
    I have this bit of code: DriveInfo[] myDrives = DriveInfo.GetDrives(); foreach (DriveInfo myDrive in myDrives) { if (myDrive.DriveType == DriveType.Removable) { string path = Convert.ToString(myDrive.RootDirectory); DirectoryInfo mydir = new DirectoryInfo(path); String[] dirs = new string[] {Convert.ToString(mydir.GetDirectories())}; String[] files = new string[] {Convert.ToString(mydir.GetFiles())}; foreach (var file in files) { File.SetAttributes(file, ~FileAttributes.Hidden); File.SetAttributes(file, ~FileAttributes.ReadOnly); } foreach (var dir in dirs) { File.SetAttributes(dir, ~FileAttributes.Hidden); File.SetAttributes(dir, ~FileAttributes.ReadOnly); } } } I have a problem. It is trying the code for Floppy Disk drive first which and because no Floppy disk in it, it threw the error The device is not ready. How can I prevent that?

    Read the article

  • File Sync Solution for Batch Processing (ETL)

    - by KenFar
    I'm looking for a slightly different kind of sync utility - not one designed to keep two directories identical, but rather one intended to keep files flowing from one host to another. The context is a data warehouse that currently has a custom-developed solution that moves 10,000 files a day, some of which are 1+ gbytes gzipped files, between linux servers via ssh. Files are produced by the extract process, then moved to the transform server where a transform daemon is waiting to pick them up. The same process happens between transform & load. Once the files are moved they are typically archived on the source for a week, and the downstream process likewise moves them to temp then archive as it consumes them. So, my requirements & desires: It is never used to refresh updated files - only used to deliver new files. Because it's delivering files to downstream processes - it needs to rename the file once done so that a partial file doesn't get picked up. In order to simplify recovery, it should keep a copy of the source files - but rename them or move them to another directory. If the transfer fails (network down, file system full, permissions, file locked, etc), then it should retry periodically - and never fail in a non-recoverable way, or a way that sends the file twice or never sends the file. Should be able to copy files to 2+ destinations. Should have a consolidated log so that it's easy to find problems Should have an optional checksum feature Any recommendations? Can Unison do this well?

    Read the article

  • Inconsistent file downloads of (what should be) the same file

    - by Austin A.
    I'm working on a system that archives large collections of timetstamped images. Part of the system deals with saving an image to a growing .zip file. This morning I noticed that the log system said that an image was successfully downloaded and placed in the zip file, but when I downloaded the .zip (from an apache alias running on our server), the images didn't match the log. For example, although the log said that camera 3484 captured on January 17, 2011, when I download from the apache alias, the downloaded zip file only contains images up to January 14. So, I sshed onto the server, and unzipped the file in its own directory, and that zip file has images from January 14 to today (January 17). What strikes me as odd is that this should be the exact same file as the one I downloaded from the apache alias. Other experiments: I scp-ed the file from the server to my local machine, and the zip file has the newer images. But when I use an SCP client (in this case, Fugu for OSX), I get the zip file for the older images. In short: unzipping a file on the server or after downloading through scp or after downloading through wget gives one zip file, but unzipping a file from Chrome, Firefox, or SCP client gives a different zip file, when they should be exactly the same. Unzipping on the server... [user@server ~]$ cd /export1/amos/images/2011/84/3484/00003484/ [user@server 00003484]$ ls -la total 6180 drwxr-sr-x 2 user groupname 24 Jan 17 11:20 . drwxr-sr-x 4 user groupname 36 Jan 11 19:58 .. -rw-r--r-- 1 user groupname 6309980 Jan 17 12:05 2011.01.zip [user@server 00003484]$ unzip 2011.01.zip Archive: 2011.01.zip extracting: 20110114_140547.jpg extracting: 20110114_143554.jpg replace 20110114_143554.jpg? [y]es, [n]o, [A]ll, [N]one, [r]ename: y extracting: 20110114_143554.jpg extracting: 20110114_153458.jpg (...bunch of files...) extracting: 20110117_170459.jpg extracting: 20110117_173458.jpg extracting: 20110117_180501.jpg Using the wget through apache alias. local:~ user$ wget http://example.com/zipfiles/2011/84/3484/00003484/2011.01.zip --12:38:13-- http://example.com/zipfiles/2011/84/3484/00003484/2011.01.zip => `2011.01.zip' Resolving example.com... ip.ip.ip.ip Connecting to example.com|ip.ip.ip.ip|:80... connected. HTTP request sent, awaiting response... 200 OK Length: 6,327,747 (6.0M) [application/zip] 100% [=====================================================================================================>] 6,327,747 1.03M/s ETA 00:00 12:38:56 (143.23 KB/s) - `2011.01.zip' saved [6327747/6327747] local:~ user$ unzip 2011.01.zip Archive: 2011.01.zip extracting: 20110114_140547.jpg (... same as before...) extracting: 20110117_183459.jpg Using scp to grab the zip local:~ user$ scp user@server:/export1/amos/images/2011/84/3484/00003484/2011.01.zip . 2011.01.zip 100% 6179KB 475.3KB/s 00:13 local:~ user$ unzip 2011.01.zip Archive: 2011.01.zip extracting: 20110114_140547.jpg (...same as before...) extracting: 20110117_183459.jpg Using Fugu to download 2011.01.zip from /export1/amos/images/2011/84/3484/00003484/ gives images 20110113_090457.jpg through 201100114_010554.jpg Using Firefox to download 2011.01.zip from http://example.com/zipfiles/2011/84/3484/00003484/2011.01.zip gives images 20110113_090457.jpg through 201100114_010554.jpg Using Chrome gives same results as Firefox. Relevant section from apache httpd.conf: # ScriptAlias: This controls which directories contain server scripts. # ScriptAliases are essentially the same as Aliases, except that # documents in the realname directory are treated as applications and # run by the server when requested rather than as documents sent to the client. # The same rules about trailing "/" apply to ScriptAlias directives as to # Alias. # ScriptAlias /cgi-bin/ "/var/www/cgi-bin/" Alias /zipfiles/ /export1/amos/images/

    Read the article

  • Windows 7 delayed file delete

    - by GregoryM
    I'm stuck with a pretty rare problem that happens on Windows 7 OS only. Every time I'm deleting the file with *.exe extension through explorer, the file doesn't get deleted immediately. I'm forced to wait for around one-two minutes before the system will delete the file. The main problem is that I cannot develop in such situation, because every time I build my solution, the old executable gets 'deleted', but is still there. So the new one cannot be created by Visual Studio. This problem breaks the Steam update progress and a few other installers functionality too. Fresh installed Win7 doesn't have this kind of trouble, so I guess this must be some bad registry entries or some services. Browsing the internet for solutions I found only this: http://www.sevenforums.com/software/72091-several-minute-delay-when-deleting-any-exe-file.html. But the solution the author found is not working (change the userName :)). Is there any ideas how to find what causes this to happen? BTW: when I place the file into Trash bin, no delay occurs. When I delete file with Total Commander - no delay too. Tech details: Windows 7 x64 Ultimate.

    Read the article

  • Windows 7 delayed file delete

    - by GregoryM
    I'm stuck with a pretty rare problem that happens on Windows 7 OS only. Every time I'm deleting the file with *.exe extension through explorer, the file doesn't get deleted immediately. I'm forced to wait for around one-two minutes before the system will delete the file. The main problem is that I cannot develop in such situation, because every time I build my solution, the old executable gets 'deleted', but is still there. So the new one cannot be created by Visual Studio. This problem breaks the Steam update progress and a few other installers functionality too. Fresh installed Win7 doesn't have this kind of trouble, so I guess this must be some bad registry entries or some services. Browsing the internet for solutions I found only this: http://www.sevenforums.com/software/72091-several-minute-delay-when-deleting-any-exe-file.html. But the solution the author found is not working (change the userName :)). Is there any ideas how to find what causes this to happen? BTW: when I place the file into Trash bin, no delay occurs. When I delete file with Total Commander - no delay too. Tech details: Windows 7 x64 Ultimate. UPD: maybe some shadow copying or system restore services (though I have the system restore turned off) block the files? Can't even guess...

    Read the article

  • How do i mount my SD Card? I am using ubuntu 10.04

    - by shobhit
    root@shobhit:/media# lsusb Bus 002 Device 017: ID 14cd:125c Super Top Bus 002 Device 003: ID 0c45:6421 Microdia Bus 002 Device 002: ID 8087:0020 Bus 002 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub Bus 001 Device 011: ID 413c:8160 Dell Computer Corp. Bus 001 Device 006: ID 413c:8162 Dell Computer Corp. Bus 001 Device 005: ID 413c:8161 Dell Computer Corp. Bus 001 Device 004: ID 138a:0008 DigitalPersona, Inc Bus 001 Device 003: ID 0a5c:4500 Broadcom Corp. BCM2046B1 USB 2.0 Hub (part of BCM2046 Bluetooth) Bus 001 Device 002: ID 8087:0020 Bus 001 Device 001: ID 1d6b:0002 Linux Foundation 2.0 root hub root@shobhit:/home/shobhit/scripts/internalUtilities# sudo lspci -v -nn 00:1a.0 USB Controller [0c03]: Intel Corporation 5 Series/3400 Series Chipset USB2 Enhanced Host Controller [8086:3b3c] (rev 06) (prog-if 20) Subsystem: Dell Device [1028:0441] Flags: bus master, medium devsel, latency 0, IRQ 16 Memory at fbc08000 (32-bit, non-prefetchable) [size=1K] Capabilities: [50] Power Management version 2 Capabilities: [58] Debug port: BAR=1 offset=00a0 Capabilities: [98] PCIe advanced features <?> Kernel driver in use: ehci_hcd 00:1d.0 USB Controller [0c03]: Intel Corporation 5 Series/3400 Series Chipset USB2 Enhanced Host Controller [8086:3b34] (rev 06) (prog-if 20) Subsystem: Dell Device [1028:0441] Flags: bus master, medium devsel, latency 0, IRQ 23 Memory at fbc07000 (32-bit, non-prefetchable) [size=1K] Capabilities: [50] Power Management version 2 Capabilities: [58] Debug port: BAR=1 offset=00a0 Capabilities: [98] PCIe advanced features <?> Kernel driver in use: ehci_hcd 00:1e.0 PCI bridge [0604]: Intel Corporation 82801 Mobile PCI Bridge [8086:2448] (rev a6) (prog-if 01) Flags: bus master, fast devsel, latency 0 Bus: primary=00, secondary=20, subordinate=20, sec-latency=32 Capabilities: [50] Subsystem: Dell Device [1028:0441] 00:1f.0 ISA bridge [0601]: Intel Corporation Mobile 5 Series Chipset LPC Interface Controller [8086:3b0b] (rev 06) Subsystem: Dell Device [1028:0441] Flags: bus master, medium devsel, latency 0 Capabilities: [e0] Vendor Specific Information <?> Kernel modules: iTCO_wdt 00:1f.2 SATA controller [0106]: Intel Corporation 5 Series/3400 Series Chipset 6 port SATA AHCI Controller [8086:3b2f] (rev 06) (prog-if 01) Subsystem: Dell Device [1028:0441] Flags: bus master, 66MHz, medium devsel, latency 0, IRQ 29 I/O ports at f070 [size=8] I/O ports at f060 [size=4] I/O ports at f050 [size=8] I/O ports at f040 [size=4] I/O ports at f020 [size=32] Memory at fbc06000 (32-bit, non-prefetchable) [size=2K] Capabilities: [80] Message Signalled Interrupts: Mask- 64bit- Queue=0/0 Enable+ Capabilities: [70] Power Management version 3 Capabilities: [a8] SATA HBA <?> Capabilities: [b0] PCIe advanced features <?> Kernel driver in use: ahci Kernel modules: ahci 00:1f.3 SMBus [0c05]: Intel Corporation 5 Series/3400 Series Chipset SMBus Controller [8086:3b30] (rev 06) Subsystem: Dell Device [1028:0441] Flags: medium devsel, IRQ 3 Memory at fbc05000 (64-bit, non-prefetchable) [size=256] I/O ports at f000 [size=32] Kernel modules: i2c-i801 00:1f.6 Signal processing controller [1180]: Intel Corporation 5 Series/3400 Series Chipset Thermal Subsystem [8086:3b32] (rev 06) Subsystem: Dell Device [1028:0441] Flags: bus master, fast devsel, latency 0, IRQ 3 Memory at fbc04000 (64-bit, non-prefetchable) [size=4K] Capabilities: [50] Power Management version 3 Capabilities: [80] Message Signalled Interrupts: Mask- 64bit- Queue=0/0 Enable- 12:00.0 Network controller [0280]: Broadcom Corporation Device [14e4:4727] (rev 01) Subsystem: Dell Device [1028:0010] Flags: bus master, fast devsel, latency 0, IRQ 17 Memory at fbb00000 (64-bit, non-prefetchable) [size=16K] Capabilities: [40] Power Management version 3 Capabilities: [58] Vendor Specific Information <?> Capabilities: [48] Message Signalled Interrupts: Mask- 64bit+ Queue=0/0 Enable- Capabilities: [d0] Express Endpoint, MSI 00 Capabilities: [100] Advanced Error Reporting <?> Capabilities: [13c] Virtual Channel <?> Capabilities: [160] Device Serial Number cb-c0-8b-ff-ff-38-00-00 Capabilities: [16c] Power Budgeting <?> Kernel driver in use: wl Kernel modules: wl 13:00.0 Ethernet controller [0200]: Realtek Semiconductor Co., Ltd. RTL8111/8168B PCI Express Gigabit Ethernet controller [10ec:8168] (rev 03) Subsystem: Dell Device [1028:0441] Flags: bus master, fast devsel, latency 0, IRQ 28 I/O ports at e000 [size=256] Memory at d0b04000 (64-bit, prefetchable) [size=4K] Memory at d0b00000 (64-bit, prefetchable) [size=16K] Expansion ROM at fba00000 [disabled] [size=128K] Capabilities: [40] Power Management version 3 Capabilities: [50] Message Signalled Interrupts: Mask- 64bit+ Queue=0/0 Enable+ Capabilities: [70] Express Endpoint, MSI 01 Capabilities: [ac] MSI-X: Enable- Mask- TabSize=4 Capabilities: [cc] Vital Product Data <?> Capabilities: [100] Advanced Error Reporting <?> Capabilities: [140] Virtual Channel <?> Capabilities: [160] Device Serial Number 00-e0-4c-68-00-00-00-03 Kernel driver in use: r8169 Kernel modules: r8169 root@shobhit:/home/shobhit/scripts/internalUtilities# sudo lshw shobhit description: Portable Computer product: Vostro 3500 vendor: Dell Inc. version: A10 serial: FV1L3N1 width: 32 bits capabilities: smbios-2.6 dmi-2.6 smp-1.4 smp configuration: boot=normal chassis=portable cpus=2 uuid=44454C4C-5600-1031-804C-C6C04F334E31 *-core description: Motherboard product: 0G2R51 vendor: Dell Inc. physical id: 0 version: A10 serial: .FV1L3N1.CN7016612H00PW. slot: To Be Filled By O.E.M. *-cpu:0 description: CPU product: Intel(R) Core(TM) i5 CPU M 480 @ 2.67GHz vendor: Intel Corp. physical id: 4 bus info: cpu@0 version: 6.5.5 serial: 0002-0655-0000-0000-0000-0000 slot: CPU 1 size: 1197MHz capacity: 2926MHz width: 64 bits clock: 533MHz capabilities: boot fpu fpu_exception wp vme de pse tsc msr pae mce cx8 apic mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe nx rdtscp x86-64 constant_tsc arch_perfmon pebs bts xtopology nonstop_tsc aperfmperf pni dtes64 monitor ds_cpl vmx est tm2 ssse3 cx16 xtpr pdcm sse4_1 sse4_2 popcnt lahf_lm ida arat tpr_shadow vnmi flexpriority ept vpid cpufreq configuration: id=4 *-cache:0 description: L1 cache physical id: 5 slot: L1-Cache size: 64KiB capacity: 64KiB capabilities: internal write-back unified *-cache:1 description: L2 cache physical id: 6 slot: L2-Cache size: 512KiB capacity: 512KiB capabilities: internal varies unified *-cache:2 description: L3 cache physical id: 7 slot: L3-Cache size: 3MiB capacity: 3MiB capabilities: internal varies unified *-logicalcpu:0 description: Logical CPU physical id: 4.1 width: 64 bits capabilities: logical *-logicalcpu:1 description: Logical CPU physical id: 4.2 width: 64 bits capabilities: logical *-logicalcpu:2 description: Logical CPU physical id: 4.3 width: 64 bits capabilities: logical *-logicalcpu:3 description: Logical CPU physical id: 4.4 width: 64 bits capabilities: logical *-logicalcpu:4 description: Logical CPU physical id: 4.5 width: 64 bits capabilities: logical *-logicalcpu:5 description: Logical CPU physical id: 4.6 width: 64 bits capabilities: logical *-logicalcpu:6 description: Logical CPU physical id: 4.7 width: 64 bits capabilities: logical *-logicalcpu:7 description: Logical CPU physical id: 4.8 width: 64 bits capabilities: logical *-logicalcpu:8 description: Logical CPU physical id: 4.9 width: 64 bits capabilities: logical *-logicalcpu:9 description: Logical CPU physical id: 4.a width: 64 bits capabilities: logical *-logicalcpu:10 description: Logical CPU physical id: 4.b width: 64 bits capabilities: logical *-logicalcpu:11 description: Logical CPU physical id: 4.c width: 64 bits capabilities: logical *-logicalcpu:12 description: Logical CPU physical id: 4.d width: 64 bits capabilities: logical *-logicalcpu:13 description: Logical CPU physical id: 4.e width: 64 bits capabilities: logical *-logicalcpu:14 description: Logical CPU physical id: 4.f width: 64 bits capabilities: logical *-logicalcpu:15 description: Logical CPU physical id: 4.10 width: 64 bits capabilities: logical *-memory description: System Memory physical id: 1d slot: System board or motherboard size: 3GiB *-bank:0 description: DIMM Synchronous 1333 MHz (0.8 ns) product: HMT112S6TFR8C-H9 vendor: AD80 physical id: 0 serial: 5525C935 slot: DIMM_A size: 1GiB width: 64 bits clock: 1333MHz (0.8ns) *-bank:1 description: DIMM Synchronous 1333 MHz (0.8 ns) product: HMT125S6TFR8C-H9 vendor: AD80 physical id: 1 serial: 3441D6CA slot: DIMM_B size: 2GiB width: 64 bits clock: 1333MHz (0.8ns) *-firmware description: BIOS vendor: Dell Inc. physical id: 0 version: A10 (10/25/2010) size: 64KiB capacity: 1984KiB capabilities: mca pci upgrade shadowing escd cdboot bootselect socketedrom edd int13floppy1200 int13floppy720 int13floppy2880 int5printscreen int9keyboard int14serial int17printer int10video acpi usb zipboot biosbootspecification *-cpu:1 physical id: 1 bus info: cpu@1 version: 6.5.5 serial: 0002-0655-0000-0000-0000-0000 size: 1197MHz capacity: 1197MHz capabilities: vmx ht cpufreq configuration: id=4 *-logicalcpu:0 description: Logical CPU physical id: 4.1 capabilities: logical *-logicalcpu:1 description: Logical CPU physical id: 4.2 capabilities: logical *-logicalcpu:2 description: Logical CPU physical id: 4.3 capabilities: logical *-logicalcpu:3 description: Logical CPU physical id: 4.4 capabilities: logical *-logicalcpu:4 description: Logical CPU physical id: 4.5 capabilities: logical *-logicalcpu:5 description: Logical CPU physical id: 4.6 capabilities: logical *-logicalcpu:6 description: Logical CPU physical id: 4.7 capabilities: logical *-logicalcpu:7 description: Logical CPU physical id: 4.8 capabilities: logical *-logicalcpu:8 description: Logical CPU physical id: 4.9 capabilities: logical *-logicalcpu:9 description: Logical CPU physical id: 4.a capabilities: logical *-logicalcpu:10 description: Logical CPU physical id: 4.b capabilities: logical *-logicalcpu:11 description: Logical CPU physical id: 4.c capabilities: logical *-logicalcpu:12 description: Logical CPU physical id: 4.d capabilities: logical *-logicalcpu:13 description: Logical CPU physical id: 4.e capabilities: logical *-logicalcpu:14 description: Logical CPU physical id: 4.f capabilities: logical *-logicalcpu:15 description: Logical CPU physical id: 4.10 capabilities: logical *-pci description: Host bridge product: Core Processor DRAM Controller vendor: Intel Corporation physical id: 100 bus info: pci@0000:00:00.0 version: 18 width: 32 bits clock: 33MHz configuration: driver=agpgart-intel resources: irq:0 *-display description: VGA compatible controller product: Core Processor Integrated Graphics Controller vendor: Intel Corporation physical id: 2 bus info: pci@0000:00:02.0 version: 18 width: 64 bits clock: 33MHz capabilities: msi pm bus_master cap_list rom configuration: driver=i915 latency=0 resources: irq:30 memory:fac00000-faffffff memory:c0000000-cfffffff(prefetchable) ioport:f080(size=8) *-communication UNCLAIMED description: Communication controller product: 5 Series/3400 Series Chipset HECI Controller vendor: Intel Corporation physical id: 16 bus info: pci@0000:00:16.0 version: 06 width: 64 bits clock: 33MHz capabilities: pm msi bus_master cap_list configuration: latency=0 resources: memory:fbc09000-fbc0900f *-usb:0 description: USB Controller product: 5 Series/3400 Series Chipset USB2 Enhanced Host Controller vendor: Intel Corporation physical id: 1a bus info: pci@0000:00:1a.0 version: 06 width: 32 bits clock: 33MHz capabilities: pm debug bus_master cap_list configuration: driver=ehci_hcd latency=0 resources: irq:16 memory:fbc08000-fbc083ff *-multimedia description: Audio device product: 5 Series/3400 Series Chipset High Definition Audio vendor: Intel Corporation physical id: 1b bus info: pci@0000:00:1b.0 version: 06 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list configuration: driver=HDA Intel latency=0 resources: irq:22 memory:fbc00000-fbc03fff *-pci:0 description: PCI bridge product: 5 Series/3400 Series Chipset PCI Express Root Port 1 vendor: Intel Corporation physical id: 1c bus info: pci@0000:00:1c.0 version: 06 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm bus_master cap_list configuration: driver=pcieport resources: irq:24 ioport:2000(size=4096) memory:bc000000-bc1fffff memory:bc200000-bc3fffff(prefetchable) *-pci:1 description: PCI bridge product: 5 Series/3400 Series Chipset PCI Express Root Port 2 vendor: Intel Corporation physical id: 1c.1 bus info: pci@0000:00:1c.1 version: 06 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm bus_master cap_list configuration: driver=pcieport resources: irq:25 ioport:3000(size=4096) memory:fbb00000-fbbfffff memory:bc400000-bc5fffff(prefetchable) *-network description: Wireless interface product: Broadcom Corporation vendor: Broadcom Corporation physical id: 0 bus info: pci@0000:12:00.0 logical name: eth1 version: 01 serial: c0:cb:38:8b:aa:d8 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=wl0 driverversion=5.60.48.36 ip=10.0.1.50 latency=0 multicast=yes wireless=IEEE 802.11 resources: irq:17 memory:fbb00000-fbb03fff *-pci:2 description: PCI bridge product: 5 Series/3400 Series Chipset PCI Express Root Port 3 vendor: Intel Corporation physical id: 1c.2 bus info: pci@0000:00:1c.2 version: 06 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm bus_master cap_list configuration: driver=pcieport resources: irq:26 ioport:e000(size=4096) memory:fba00000-fbafffff ioport:d0b00000(size=1048576) *-network description: Ethernet interface product: RTL8111/8168B PCI Express Gigabit Ethernet controller vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:13:00.0 logical name: eth0 version: 03 serial: 78:2b:cb:cc:0e:2a size: 10MB/s capacity: 1GB/s width: 64 bits clock: 33MHz capabilities: pm msi pciexpress msix vpd bus_master cap_list rom ethernet physical tp mii 10bt 10bt-fd 100bt 100bt-fd 1000bt 1000bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=r8169 driverversion=2.3LK-NAPI duplex=half latency=0 link=no multicast=yes port=MII speed=10MB/s resources: irq:28 ioport:e000(size=256) memory:d0b04000-d0b04fff(prefetchable) memory:d0b00000-d0b03fff(prefetchable) memory:fba00000-fba1ffff(prefetchable) *-pci:3 description: PCI bridge product: 5 Series/3400 Series Chipset PCI Express Root Port 5 vendor: Intel Corporation physical id: 1c.4 bus info: pci@0000:00:1c.4 version: 06 width: 32 bits clock: 33MHz capabilities: pci pciexpress msi pm bus_master cap_list configuration: driver=pcieport resources: irq:27 ioport:d000(size=4096) memory:fb000000-fb9fffff ioport:d0000000(size=10485760) *-usb:1 description: USB Controller product: 5 Series/3400 Series Chipset USB2 Enhanced Host Controller vendor: Intel Corporation physical id: 1d bus info: pci@0000:00:1d.0 version: 06 width: 32 bits clock: 33MHz capabilities: pm debug bus_master cap_list configuration: driver=ehci_hcd latency=0 resources: irq:23 memory:fbc07000-fbc073ff *-pci:4 description: PCI bridge product: 82801 Mobile PCI Bridge vendor: Intel Corporation physical id: 1e bus info: pci@0000:00:1e.0 version: a6 width: 32 bits clock: 33MHz capabilities: pci bus_master cap_list *-isa description: ISA bridge product: Mobile 5 Series Chipset LPC Interface Controller vendor: Intel Corporation physical id: 1f bus info: pci@0000:00:1f.0 version: 06 width: 32 bits clock: 33MHz capabilities: isa bus_master cap_list configuration: latency=0 *-storage description: SATA controller product: 5 Series/3400 Series Chipset 6 port SATA AHCI Controller vendor: Intel Corporation physical id: 1f.2 bus info: pci@0000:00:1f.2 logical name: scsi0 logical name: scsi1 version: 06 width: 32 bits clock: 66MHz capabilities: storage msi pm bus_master cap_list emulated configuration: driver=ahci latency=0 resources: irq:29 ioport:f070(size=8) ioport:f060(size=4) ioport:f050(size=8) ioport:f040(size=4) ioport:f020(size=32) memory:fbc06000-fbc067ff *-disk description: ATA Disk product: WDC WD3200BEKT-7 vendor: Western Digital physical id: 0 bus info: scsi@0:0.0.0 logical name: /dev/sda version: 01.0 serial: WD-WX21AC0W1945 size: 298GiB (320GB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 signature=77e3ed41 *-volume:0 description: Windows NTFS volume physical id: 1 bus info: scsi@0:0.0.0,1 logical name: /dev/sda1 version: 3.1 serial: aa69-51c0 size: 98MiB capacity: 100MiB capabilities: primary bootable ntfs initialized configuration: clustersize=4096 created=2012-04-03 02:00:15 filesystem=ntfs label=System Reserved state=clean *-volume:1 description: Windows NTFS volume physical id: 2 bus info: scsi@0:0.0.0,2 logical name: /dev/sda2 version: 3.1 serial: 9854ff5c-1dea-a147-84a6-624e758f44b8 size: 48GiB capacity: 48GiB capabilities: primary ntfs initialized configuration: clustersize=4096 created=2012-04-10 13:55:31 filesystem=ntfs modified_by_chkdsk=true mounted_on_nt4=true resize_log_file=true state=dirty upgrade_on_mount=true *-volume:2 description: Extended partition physical id: 3 bus info: scsi@0:0.0.0,3 logical name: /dev/sda3 size: 48GiB capacity: 48GiB capabilities: primary extended partitioned partitioned:extended *-logicalvolume:0 description: Linux swap / Solaris partition physical id: 5 logical name: /dev/sda5 capacity: 1952MiB capabilities: nofs *-logicalvolume:1 description: Linux filesystem partition physical id: 6 logical name: /dev/sda6 logical name: / capacity: 46GiB configuration: mount.fstype=ext4 mount.options=rw,relatime,errors=remount-ro,barrier=1,data=ordered state=mounted *-volume:3 description: Windows NTFS volume physical id: 4 bus info: scsi@0:0.0.0,4 logical name: /dev/sda4 logical name: /media/56AA8094AA807273 version: 3.1 serial: 22a29e8d-56c7-9a4a-adea-528103948f6d size: 200GiB capacity: 200GiB capabilities: primary ntfs initialized configuration: clustersize=4096 created=2012-04-02 20:17:15 filesystem=ntfs modified_by_chkdsk=true mount.fstype=fuseblk mount.options=rw,nosuid,nodev,relatime,user_id=0,group_id=0,default_permissions,allow_other,blksize=4096 mounted_on_nt4=true resize_log_file=true state=mounted upgrade_on_mount=true *-cdrom description: DVD-RAM writer product: DVD+-RW TS-L633J vendor: TSSTcorp physical id: 1 bus info: scsi@1:0.0.0 logical name: /dev/cdrom logical name: /dev/cdrw logical name: /dev/dvd logical name: /dev/dvdrw logical name: /dev/scd0 logical name: /dev/sr0 version: D200 capabilities: removable audio cd-r cd-rw dvd dvd-r dvd-ram configuration: ansiversion=5 status=nodisc *-serial UNCLAIMED description: SMBus product: 5 Series/3400 Series Chipset SMBus Controller vendor: Intel Corporation physical id: 1f.3 bus info: pci@0000:00:1f.3 version: 06 width: 64 bits clock: 33MHz configuration: latency=0 resources: memory:fbc05000-fbc050ff ioport:f000(size=32) *-generic UNCLAIMED description: Signal processing controller product: 5 Series/3400 Series Chipset Thermal Subsystem vendor: Intel Corporation physical id: 1f.6 bus info: pci@0000:00:1f.6 version: 06 width: 64 bits clock: 33MHz capabilities: pm msi bus_master cap_list configuration: latency=0 resources: memory:fbc04000-fbc04fff *-scsi physical id: 2 bus info: usb@2:1.1 logical name: scsi15 capabilities: emulated scsi-host configuration: driver=usb-storage *-disk description: SCSI Disk physical id: 0.0.0 bus info: scsi@15:0.0.0 logical name: /dev/sdb I have tried all options like fdisk /dev/sdb , pmount /dev/sdb but nothing is working .Pls guide me

    Read the article

  • How to simulate inner join on very large files in java (without running out of memory)

    - by Constantin
    I am trying to simulate SQL joins using java and very large text files (INNER, RIGHT OUTER and LEFT OUTER). The files have already been sorted using an external sort routine. The issue I have is I am trying to find the most efficient way to deal with the INNER join part of the algorithm. Right now I am using two Lists to store the lines that have the same key and iterate through the set of lines in the right file once for every line in the left file (provided the keys still match). In other words, the join key is not unique in each file so would need to account for the Cartesian product situations ... left_01, 1 left_02, 1 right_01, 1 right_02, 1 right_03, 1 left_01 joins to right_01 using key 1 left_01 joins to right_02 using key 1 left_01 joins to right_03 using key 1 left_02 joins to right_01 using key 1 left_02 joins to right_02 using key 1 left_02 joins to right_03 using key 1 My concern is one of memory. I will run out of memory if i use the approach below but still want the inner join part to work fairly quickly. What is the best approach to deal with the INNER join part keeping in mind that these files may potentially be huge public class Joiner { private void join(BufferedReader left, BufferedReader right, BufferedWriter output) throws Throwable { BufferedReader _left = left; BufferedReader _right = right; BufferedWriter _output = output; Record _leftRecord; Record _rightRecord; _leftRecord = read(_left); _rightRecord = read(_right); while( _leftRecord != null && _rightRecord != null ) { if( _leftRecord.getKey() < _rightRecord.getKey() ) { write(_output, _leftRecord, null); _leftRecord = read(_left); } else if( _leftRecord.getKey() > _rightRecord.getKey() ) { write(_output, null, _rightRecord); _rightRecord = read(_right); } else { List<Record> leftList = new ArrayList<Record>(); List<Record> rightList = new ArrayList<Record>(); _leftRecord = readRecords(leftList, _leftRecord, _left); _rightRecord = readRecords(rightList, _rightRecord, _right); for( Record equalKeyLeftRecord : leftList ){ for( Record equalKeyRightRecord : rightList ){ write(_output, equalKeyLeftRecord, equalKeyRightRecord); } } } } if( _leftRecord != null ) { write(_output, _leftRecord, null); _leftRecord = read(_left); while(_leftRecord != null) { write(_output, _leftRecord, null); _leftRecord = read(_left); } } else { if( _rightRecord != null ) { write(_output, null, _rightRecord); _rightRecord = read(_right); while(_rightRecord != null) { write(_output, null, _rightRecord); _rightRecord = read(_right); } } } _left.close(); _right.close(); _output.flush(); _output.close(); } private Record read(BufferedReader reader) throws Throwable { Record record = null; String data = reader.readLine(); if( data != null ) { record = new Record(data.split("\t")); } return record; } private Record readRecords(List<Record> list, Record record, BufferedReader reader) throws Throwable { int key = record.getKey(); list.add(record); record = read(reader); while( record != null && record.getKey() == key) { list.add(record); record = read(reader); } return record; } private void write(BufferedWriter writer, Record left, Record right) throws Throwable { String leftKey = (left == null ? "null" : Integer.toString(left.getKey())); String leftData = (left == null ? "null" : left.getData()); String rightKey = (right == null ? "null" : Integer.toString(right.getKey())); String rightData = (right == null ? "null" : right.getData()); writer.write("[" + leftKey + "][" + leftData + "][" + rightKey + "][" + rightData + "]\n"); } public static void main(String[] args) { try { BufferedReader leftReader = new BufferedReader(new FileReader("LEFT.DAT")); BufferedReader rightReader = new BufferedReader(new FileReader("RIGHT.DAT")); BufferedWriter output = new BufferedWriter(new FileWriter("OUTPUT.DAT")); Joiner joiner = new Joiner(); joiner.join(leftReader, rightReader, output); } catch (Throwable e) { e.printStackTrace(); } } } After applying the ideas from the proposed answer, I changed the loop to this private void join(RandomAccessFile left, RandomAccessFile right, BufferedWriter output) throws Throwable { long _pointer = 0; RandomAccessFile _left = left; RandomAccessFile _right = right; BufferedWriter _output = output; Record _leftRecord; Record _rightRecord; _leftRecord = read(_left); _rightRecord = read(_right); while( _leftRecord != null && _rightRecord != null ) { if( _leftRecord.getKey() < _rightRecord.getKey() ) { write(_output, _leftRecord, null); _leftRecord = read(_left); } else if( _leftRecord.getKey() > _rightRecord.getKey() ) { write(_output, null, _rightRecord); _pointer = _right.getFilePointer(); _rightRecord = read(_right); } else { long _tempPointer = 0; int key = _leftRecord.getKey(); while( _leftRecord != null && _leftRecord.getKey() == key ) { _right.seek(_pointer); _rightRecord = read(_right); while( _rightRecord != null && _rightRecord.getKey() == key ) { write(_output, _leftRecord, _rightRecord ); _tempPointer = _right.getFilePointer(); _rightRecord = read(_right); } _leftRecord = read(_left); } _pointer = _tempPointer; } } if( _leftRecord != null ) { write(_output, _leftRecord, null); _leftRecord = read(_left); while(_leftRecord != null) { write(_output, _leftRecord, null); _leftRecord = read(_left); } } else { if( _rightRecord != null ) { write(_output, null, _rightRecord); _rightRecord = read(_right); while(_rightRecord != null) { write(_output, null, _rightRecord); _rightRecord = read(_right); } } } _left.close(); _right.close(); _output.flush(); _output.close(); } UPDATE While this approach worked, it was terribly slow and so I have modified this to create files as buffers and this works very well. Here is the update ... private long getMaxBufferedLines(File file) throws Throwable { long freeBytes = Runtime.getRuntime().freeMemory() / 2; return (freeBytes / (file.length() / getLineCount(file))); } private void join(File left, File right, File output, JoinType joinType) throws Throwable { BufferedReader leftFile = new BufferedReader(new FileReader(left)); BufferedReader rightFile = new BufferedReader(new FileReader(right)); BufferedWriter outputFile = new BufferedWriter(new FileWriter(output)); long maxBufferedLines = getMaxBufferedLines(right); Record leftRecord; Record rightRecord; leftRecord = read(leftFile); rightRecord = read(rightFile); while( leftRecord != null && rightRecord != null ) { if( leftRecord.getKey().compareTo(rightRecord.getKey()) < 0) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); } else if( leftRecord.getKey().compareTo(rightRecord.getKey()) > 0 ) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); } else if( leftRecord.getKey().compareTo(rightRecord.getKey()) == 0 ) { String key = leftRecord.getKey(); List<File> rightRecordFileList = new ArrayList<File>(); List<Record> rightRecordList = new ArrayList<Record>(); rightRecordList.add(rightRecord); rightRecord = consume(key, rightFile, rightRecordList, rightRecordFileList, maxBufferedLines); while( leftRecord != null && leftRecord.getKey().compareTo(key) == 0 ) { processRightRecords(outputFile, leftRecord, rightRecordFileList, rightRecordList, joinType); leftRecord = read(leftFile); } // need a dispose for deleting files in list } else { throw new Exception("DATA IS NOT SORTED"); } } if( leftRecord != null ) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); while(leftRecord != null) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.LeftExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, leftRecord, null); } leftRecord = read(leftFile); } } else { if( rightRecord != null ) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); while(rightRecord != null) { if( joinType == JoinType.RightOuterJoin || joinType == JoinType.RightExclusiveJoin || joinType == JoinType.FullExclusiveJoin || joinType == JoinType.FullOuterJoin ) { write(outputFile, null, rightRecord); } rightRecord = read(rightFile); } } } leftFile.close(); rightFile.close(); outputFile.flush(); outputFile.close(); } public void processRightRecords(BufferedWriter outputFile, Record leftRecord, List<File> rightFiles, List<Record> rightRecords, JoinType joinType) throws Throwable { for(File rightFile : rightFiles) { BufferedReader rightReader = new BufferedReader(new FileReader(rightFile)); Record rightRecord = read(rightReader); while(rightRecord != null){ if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.RightOuterJoin || joinType == JoinType.FullOuterJoin || joinType == JoinType.InnerJoin ) { write(outputFile, leftRecord, rightRecord); } rightRecord = read(rightReader); } rightReader.close(); } for(Record rightRecord : rightRecords) { if( joinType == JoinType.LeftOuterJoin || joinType == JoinType.RightOuterJoin || joinType == JoinType.FullOuterJoin || joinType == JoinType.InnerJoin ) { write(outputFile, leftRecord, rightRecord); } } } /** * consume all records having key (either to a single list or multiple files) each file will * store a buffer full of data. The right record returned represents the outside flow (key is * already positioned to next one or null) so we can't use this record in below while loop or * within this block in general when comparing current key. The trick is to keep consuming * from a List. When it becomes empty, re-fill it from the next file until all files have * been consumed (and the last node in the list is read). The next outside iteration will be * ready to be processed (either it will be null or it points to the next biggest key * @throws Throwable * */ private Record consume(String key, BufferedReader reader, List<Record> records, List<File> files, long bufferMaxRecordLines ) throws Throwable { boolean processComplete = false; Record record = records.get(records.size() - 1); while(!processComplete){ long recordCount = records.size(); if( record.getKey().compareTo(key) == 0 ){ record = read(reader); while( record != null && record.getKey().compareTo(key) == 0 && recordCount < bufferMaxRecordLines ) { records.add(record); recordCount++; record = read(reader); } } processComplete = true; // if record is null, we are done if( record != null ) { // if the key has changed, we are done if( record.getKey().compareTo(key) == 0 ) { // Same key means we have exhausted the buffer. // Dump entire buffer into a file. The list of file // pointers will keep track of the files ... processComplete = false; dumpBufferToFile(records, files); records.clear(); records.add(record); } } } return record; } /** * Dump all records in List of Record objects to a file. Then, add that * file to List of File objects * * NEED TO PLACE A LIMIT ON NUMBER OF FILE POINTERS (check size of file list) * * @param records * @param files * @throws Throwable */ private void dumpBufferToFile(List<Record> records, List<File> files) throws Throwable { String prefix = "joiner_" + files.size() + 1; String suffix = ".dat"; File file = File.createTempFile(prefix, suffix, new File("cache")); BufferedWriter writer = new BufferedWriter(new FileWriter(file)); for( Record record : records ) { writer.write( record.dump() ); } files.add(file); writer.flush(); writer.close(); }

    Read the article

  • Flash AS3 load file xml

    - by Elias
    Hello, I'm just trying to load an xml file witch can be anywere in the hdd, this is what I have done to browse it, but later when I'm trying to load the file it would only look in the same path of the swf file here is the code package { import flash.display.Sprite; import flash.events.; import flash.net.; public class cargadorXML extends Sprite { public var cuadro:Sprite = new Sprite(); public var file:FileReference; public var req:URLRequest; public var xml:XML; public var xmlLoader:URLLoader = new URLLoader(); public function cargadorXML() { cuadro.graphics.beginFill(0xFF0000); cuadro.graphics.drawRoundRect(0,0,100,100,10); cuadro.graphics.endFill(); cuadro.addEventListener(MouseEvent.CLICK,browser); addChild(cuadro); } public function browser(e:Event) { file = new FileReference(); file.addEventListener(Event.SELECT,bien); file.browse(); } public function bien(e:Event) { xmlLoader.addEventListener(Event.COMPLETE, loadXML); req=new URLRequest(file.name); xmlLoader.load(req); } public function loadXML(e:Event) { xml=new XML(e.target.data); //xml.name=file.name; trace(xml); } } } when I open a xml file that isnt it the same directory as the swf, it gives me an unfound file error. is there anything I can do? cause for example for mp3 there is an especial class for loading the file, see http://www.flexiblefactory.co.uk/flexible/?p=46 thanks

    Read the article

  • max file upload size change in web.config

    - by Christopher Johnson
    using .net mvc 3 and trying to increase the allowable file upload size. This is what I've added to web.config: <system.webServer> <validation validateIntegratedModeConfiguration="false"/> <modules runAllManagedModulesForAllRequests="true"> <add name="ErrorLog" type="Elmah.ErrorLogModule, Elmah" preCondition="managedHandler" /> <add name="ErrorMail" type="Elmah.ErrorMailModule, Elmah" preCondition="managedHandler" /> <add name="ErrorFilter" type="Elmah.ErrorFilterModule, Elmah" preCondition="managedHandler" /> </modules> <handlers> <add name="Elmah" path="elmah.axd" verb="POST,GET,HEAD" type="Elmah.ErrorLogPageFactory, Elmah" preCondition="integratedMode" /> </handlers> <security> <requestFiltering> <requestLimits maxAllowedContentLength="104857600"/> </requestFiltering> </security> *ignore the elmah stuff. it's still not allowing file sizes larger than 50MB and this should allow up to 100MB no? any ideas?

    Read the article

  • Unable to access Java-created file -- sometimes

    - by BlairHippo
    In Java, I'm working with code running under WinXP that creates a file like this: public synchronized void store(Properties props, byte[] data) { try { File file = filenameBasedOnProperties(props); if ( file.exists() ) { return; } File temp = File.createTempFile("tempfile", null); FileOutputStream out = new FileOutputStream(temp); out.write(data); out.flush(); out.close(); file.getParentFile().mkdirs(); temp.renameTo(file); } catch (IOException ex) { // Complain and whine and stuff } } Sometimes, when a file is created this way, it's just about totally inaccessible from outside the code (though the code responsible for opening and reading the file has no problem), even when the application isn't running. When accessed via Windows Explorer, I can't move, rename, delete, or even open the file. Under Cygwin, I get the following when I ls -l the directory: ls: cannot access [big-honkin-filename] total 0 ?????????? ? ? ? ? ? [big-honkin-filename] As implied, the filenames are big, but under the 260-character max for XP (though they are slightly over 200 characters). To further add to the sense the my computer just wants me to feel stupid, sometimes the files created by this code are perfectly normal. The only pattern I've spotted is that once one file in the directory "locks", the rest are screwed. Anybody ever run into something like this before, or have any insights into what's going on here?

    Read the article

  • Modifying File while in use using Java

    - by Marquinio
    Hi all, I have this recurrent Java JAR program tasks that tries to modify a file every 60seconds. Problem is that if user is viewing the file than Java program will not be able to modify the file. I get the typical IOException. Anyone knows if there is a way in Java to modify a file currently in use? Or anyone knows what would be the best way to solve this problem? I was thinking of using the File canRead(), canWrite() methods to check if file is in use. If file is in use then I'm thinking of making a backup copy of data that could not be written. Then after 60 seconds add some logic to check if backup file is empty or not. If backup file is not empty then add its contents to main file. If empty then just add new data to main file. Of course, the first thing I will always do is check if file is in use. Thanks for all your ideas.

    Read the article

  • How to compare two file structures in PHP?

    - by OM The Eternity
    I have a function which gives me the complete file structure upto n-level, function getDirectory($path = '.', $ignore = '') { $dirTree = array (); $dirTreeTemp = array (); $ignore[] = '.'; $ignore[] = '..'; $dh = @opendir($path); while (false !== ($file = readdir($dh))) { if (!in_array($file, $ignore)) { if (!is_dir("$path/$file")) { //display of file and directory name with their modification time $stat = stat("$path/$file"); $statdir = stat("$path"); $dirTree["$path"][] = $file. " === ". date('Y-m-d H:i:s', $stat['mtime']) . " Directory == ".$path."===". date('Y-m-d H:i:s', $statdir['mtime']) ; } else { $dirTreeTemp = getDirectory("$path/$file", $ignore); if (is_array($dirTreeTemp))$dirTree = array_merge($dirTree, $dirTreeTemp); } } } closedir($dh); return $dirTree; } $ignore = array('.htaccess', 'error_log', 'cgi-bin', 'php.ini', '.ftpquota'); //function call $dirTree = getDirectory('.', $ignore); //file structure array print print_r($dirTree); Now here my requirement is , I have two sites The Development/Test Site- where i do testing of all the changes The Production Site- where I finally post all the changes as per test in development site Now, for example, I have tested an image upload in the Development/test site, and i found it appropriate to publish on Production site then i will completely transfer the Development/Test DB detail to Production DB, but now I want to compare the files structure as well to transfer the corresponding image file to Production folder. There could be the situation when I update the image by editing the image and upload it with same name, now in this case the image file would be already present there, which will restrict the use of "file_exist" logic, so for these type of situations....HOW CAN I COMPARE THE TWO FILE STRUCTURE TO GET THE SYNCHRONIZATION DONE AS PER REQUIREMENT??

    Read the article

  • File mkdirs() method not working in android/java

    - by Leif Andersen
    I've been pulling out my hair on this for a while now. The following method is supposed to download a file, and save it to the location specified on the hard drive. private static void saveImage(Context context, boolean backgroundUpdate, URL url, File file) { if (!Tools.checkNetworkState(context, backgroundUpdate)) return; // Get the image try { // Make the file file.getParentFile().mkdirs(); // Set up the connection URLConnection uCon = url.openConnection(); InputStream is = uCon.getInputStream(); BufferedInputStream bis = new BufferedInputStream(is); // Download the data ByteArrayBuffer baf = new ByteArrayBuffer(50); int current = 0; while ((current = bis.read()) != -1) { baf.append((byte) current); } // Write the bits to the file OutputStream os = new FileOutputStream(file); os.write(baf.toByteArray()); os.close(); } catch (Exception e) { // Any exception is probably a newtork faiilure, bail return; } } Also, if the file doesn't exist, it is supposed to make the directory for the file. (And if there is another file already in that spot, it should just not do anything). However, for some reason, the mkdirs() method never makes the directory. I've tried everything from explicit parentheses, to explicitly making the parent file class, and nothing seems to work. I'm fairly certain that the drive is writable, as it's only called after that has already been determined, also that is true after running through it while debugging. So the method fails because the parent directories aren't made. Can anyone tell me if there is anything wrong with the way I'm calling it? Also, if it helps, here is the source for the file I'm calling it in: https://github.com/LeifAndersen/NetCatch/blob/master/src/net/leifandersen/mobile/android/netcatch/services/RSSService.java Thank you

    Read the article

  • Unset the system immutable bit in Mac OS X

    - by skylarking
    In theory I believe you can unlock and remove the system immutable bit with: chflags noschg /Path/To/File But how can you do this when you've set the bit as root? I have a file that is locked, and even running this command as root will not work as the operation is not permitted. I tried logging in as Single-User mode to no avail. I seem to remember that even though you are in as root you are in at level '1'. And to be able to remove the system-immutable flag you need to be logged in at level '0'. Does this have something to do with this issue?

    Read the article

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

< Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >