Search Results

Search found 255653 results on 10227 pages for 'exception stack trace'.

Page 212/10227 | < Previous Page | 208 209 210 211 212 213 214 215 216 217 218 219  | Next Page >

• Cannot execute a program. The command being executed "dqiitg0c.cmdline"

  - by Laxman

  i have used impersonation in this application. whenever this error occurs i required to restart the IIS.. please guide me to solve this issue. Error: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline". Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Runtime.InteropServices.ExternalException: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline".

  Read the article

• SQL Server (2005) Linked Server Issue

  - by David.Chu.ca

  I have SQL Server 2005 with several linked server defined. One of them is a connection to an Oracle server and another one is an ODBC bridge to another server on a remote machine (ODBC server). Recently I tried to use the linked server to Oracle to update data with two large size tables by using several joints. The update query took too long time and finally there was exception thrown: Update O set value = l.value FROM OracleServer..schema.largesizeTable O Join localLargeSizeTable l on .... The problem is that after the exception, I realized that another linked server to ODBC was not working any more. I had to restart SQL server to get the ODBC linked server back. It looks that the linked server pool could be crashed if any of them failed(not like sandbox in Chrome for each tab and no impact on other tabs or Chrome application at all). I am not sure if my assumption is correct or not. Is this a known issue of SQL server 2005?

  Read the article

• If XmlException.SourceUri is read-only, what good is it?

  - by East of Nowhere

  I have a couple places in my code where it throwing a new System.Xml.XmlException seems appropriate. I could just do throw new XmlException("Your XML sucks go fix it then try again."); But I think it's better to take advantage whenever possible of members particular to the exception class (otherwise ya might as well throw a plain ol' Exception every time). SourceUri and LineNumber would be helpful, but they only have get methods, there's no way I can assign a value to them! There's only 3 constructor overloads and none of them have parameters for those members either; I can only initialize Message, nothing else. There has got to be some way to populate those data members with values, otherwise why does XmlException bother with them? I suppose I could make a new class that inherits XmlException and write a new constructor that initializes SourceUri etc. but still, there must be a way to just use XmlException. Right?

  Read the article

• Android serialization: ImageView

  - by embo

  I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

  Read the article

• LINQ-to-entities - Null reference

  - by BlueRaja

  I could swear this was working the other day: var resultSet = (from o in _entities.Table1 where o.Table2.Table3.SomeColumn == SomeProperty select o ).First(); SelectedItem = resultSet.Table2.SomeOtherColumn; I am getting a null reference exception on the last line: resultSet.Table2 is null. Not only am I sure that all the foreign keys and whatnot have the correct values, but I don't see how Table2 could be null, since o.Table2.Table3.SomeColumn == SomeProperty. resultSet is being returned with all its properties set to the correct values, with the exception that Table2 is null.

  Read the article

• How to use third party themes in swing application?

  - by swift

  I want to use some third party themes (like synthetica http://www.javasoft.de/synthetica/themes/) in my swing appliaction. i am using eclipse ide, got the jar file of theme and did the following modification(according to the readme file from the theme) in my code try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); } but after this modification its showing the following error The type de.javasoft.plaf.synthetica.SyntheticaLookAndFeel cannot be resolved. It is indirectly referenced from required .class files what does this mean? i tried searching on net but cant really find any useful answers Contents of Readme file: System Requirements =================== Java SE 5 (JRE 1.5.0) or above Synthetica V2.2.0 or above Integration =========== 1. Ensure that your classpath contains all Synthetica libraries (including Synthetica's core library 'synthetica.jar'). 2. Enable the Synthetica Look and Feel at startup time in your application: import de.javasoft.plaf.synthetica.SyntheticaBlackMoonLookAndFeel; try { UIManager.setLookAndFeel(new SyntheticaBlackMoonLookAndFeel()); } catch (Exception e) { e.printStackTrace(); }

  Read the article

• Techniques to avoid DeadlineExceededException in GAE/J?

  - by Tahir Akram

  I am developing an Twitter4J web application in Google App Engine/Java. I need to show two lists. One is Twitter friends and other is followers. With photo and screen name. It is working fine for people who have 20-30 followers and friends. But it gave me DeadlineExceededException when I try a user who has 150+ followers and friends. GAE throws this exception if web request take time more than 30 seconds. So what techniques I can adopt to avoid this exception. Should I generate two AJAX calls for each of my list. After page loads. So that every call will have its own 30 secs limit? Or what else you think? I am gone make it. Please help.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• C# MDX RenderToSurface, where to reset after device is lost?

  - by Moritz Schöfl

  Hi, I got a problem with the RenderToSurface class. When I resize the Form of my Device, the Draw method is still called, but doesnt throw an Exception, it looks like this: device.Clear(ClearFlags.Target, Color.Red, 0, 0); device.BeginScene(); // here is out commented code device.EndScene(); device.Present(); In another method, I wrote this: renderToSurface.BeginScene(surfaces[currentIndex]); // here is out commented code renderToSurface.EndScene(Filter.None); and this method seems to throw a nullpointer exception when I resize the window; So my question is: - where to reset / restore / handle the renderToSurface class? (i tried it with the DeviceReset event like following - void OnDeviceReset(object sender, EventArgs e) { renderToSurface = new RenderToSurface(Game.Device, Game.ClientSize.Width, Game.ClientSize.Height, Format.A8R8G8B8, true, DepthFormat.D16); } )

  Read the article

• NHibernate ManyToMany Relationship Cascading AllDeleteOrphan StackOverflowException

  - by Chris

  I have two objects that have a ManyToMany relationship with one another through a mapping table. Though, when I try to save it, I get a stack overflow exception. The following is the code for the mappings: //EventMapping.cs HasManyToMany(x => x.Performers).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("EventId").ChildKeyColumn("PerformerId"); //PerformerMapping.cs HasManyToMany<Event>(x => x.Events).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("PerformerId").ChildKeyColumn("EventId"); When I change the performermapping.cs to Cascade.None() I get rid of the exception but then my Event Object doesn't have the performer I associate with it. //In a unit test, paraphrased event.Performers.Add(performer); //Event eventRepository.Save<Event>(event); eventResult = eventRepository.GetById<Event>(event.id); //Event eventResult.Performers[0]; //is null, should have performer in it How should I be writing this properly? Thanks

  Read the article

• Request header is too large

  - by stck777

  I found serveral IllegalStateException Exception in the logs: [#|2009-01-28T14:10:16.050+0100|SEVERE|sun-appserver2.1|javax.enterprise.system.container.web|_ThreadID=26;_ThreadName=httpSSLWorkerThread-80-53;_RequestID=871b8812-7bc5-4ed7-85f1-ea48f760b51e;|WEB0777: Unblocking keep-alive exception java.lang.IllegalStateException: PWC4662: Request header is too large at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:740) at org.apache.coyote.http11.InternalInputBuffer.parseHeader(InternalInputBuffer.java:657) at org.apache.coyote.http11.InternalInputBuffer.parseHeaders(InternalInputBuffer.java:543) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.parseRequest(DefaultProcessorTask.java:712) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.doProcess(DefaultProcessorTask.java:577) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.process(DefaultProcessorTask.java:831) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.executeProcessorTask(DefaultReadTask.java:341) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:263) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:214) at com.sun.enterprise.web.portunif.PortUnificationPipeline$PUTask.doTask(PortUnificationPipeline.java:380) at com.sun.enterprise.web.connector.grizzly.TaskBase.run(TaskBase.java:265) at com.sun.enterprise.web.connector.grizzly.ssl.SSLWorkerThread.run(SSLWorkerThread.java:106) |#] Does anybody know configuration changes to fix this?

  Read the article

• jQuery/Ajax/javascript in FireFox Error when using $.post/$.get

  - by IsenGrim

  uncaught exception: [Exception... "Component returned failure code: 0x80004005 (NS_ERROR_FAILURE)" nsresult: "0x80004005 (NS_ERROR_FAILURE)" location: "JS frame :: http://localhost/scripts/jQuery.js :: anonymous :: line 808" data: no] Line 0 is the error i get when i bring up firebug. This only happens in firefox (and maybe other browsers) but the code works fine in IE8. I have codes like this in jquery: $("#Logout").live("click", function (e) { e.preventDefault(e); $.post("/logout.php", {}, function () { //--a bunch of animations--// window.location = "/login.php"; } }); I have no idea whats wrong as even the error message is not helpful at all.. inside logout.php: <?php session_start(); session_destroy(); ?> Also dont work if I used GET or inserted phantom data. Or is there a more elegant way to do this?

  Read the article

• jQuery: Use of undefined constant data assumed 'data'

  - by morpheous

  I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

  Read the article

• Django - I got TemplateSyntaxError when I try open the admin page. (http://DOMAIN_NAME/admin)

  - by user140827

  I use grappelly plugin. When I try open the admin page (/admin) I got TemplateSyntaxError. It says 'get_generic_relation_list' is invalid block tag. TemplateSyntaxError at /admin/ Invalid block tag: 'get_generic_relation_list', expected 'endblock' Request Method: GET Request URL: http://DOMAIN_NAME/admin/ Django Version: 1.4 Exception Type: TemplateSyntaxError Exception Value: Invalid block tag: 'get_generic_relation_list', expected 'endblock' Exception Location: /opt/python27/django/1.4/lib/python2.7/site-packages/django/template/base.py in invalid_block_tag, line 320 Python Executable: /opt/python27/django/1.4/bin/python Python Version: 2.7.0 Python Path: ['/home/vhosts/DOMAIN_NAME/httpdocs/media', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov/lib', '/home/vhosts/DOMAIN_NAME/httpdocs/', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private', '/opt/python27/django/1.4', '/home/vhosts/DOMAIN_NAME/httpdocs', '/opt/python27/django/1.4/lib/python2.7/site-packages/setuptools-0.6c12dev_r88846-py2.7.egg', '/opt/python27/django/1.4/lib/python2.7/site-packages/pip-0.8.1-py2.7.egg', '/opt/python27/django/1.4/lib/python27.zip', '/opt/python27/django/1.4/lib/python2.7', '/opt/python27/django/1.4/lib/python2.7/plat-linux2', '/opt/python27/django/1.4/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/lib-old', '/opt/python27/django/1.4/lib/python2.7/lib-dynload', '/opt/python27/lib/python2.7', '/opt/python27/lib/python2.7/plat-linux2', '/opt/python27/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/setuptools-0.6c11-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/flup-1.0.3.dev_20100525-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/virtualenv-1.5.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLAlchemy-0.6.4-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLObject-0.14.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/FormEncode-1.2.3dev-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/MySQL_python-1.2.3-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/psycopg2-2.2.2-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/pysqlite-2.6.0-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/PIL'] Server time: ???, 7 ??? 2012 04:19:42 +0700 Error during template rendering In template /home/vhosts/DOMAIN_NAME/httpdocs/templates/grappelli/admin/base.html, error at line 28 Invalid block tag: 'get_generic_relation_list', expected 'endblock' 18 <!--[if lt IE 8]> 19 <script src="http://ie7-js.googlecode.com/svn/version/2.0(beta3)/IE8.js" type="text/javascript"></script> 20 <![endif]--> 21 {% block javascripts %} 22 <script type="text/javascript" src="{% admin_media_prefix %}jquery/jquery-1.3.2.min.js"></script> 23 <script type="text/javascript" src="{% admin_media_prefix %}js/admin/Bookmarks.js"></script> 24 <script type="text/javascript"> 25 // Admin URL 26 var ADMIN_URL = "{% get_admin_url %}"; 27 // Generic Relations 28 {% get_generic_relation_list %} 29 // Get Bookmarks 30 $(document).ready(function(){ 31 $.ajax({ 32 type: "GET", 33 url: '{% url grp_bookmark_get %}', 34 data: "path=" + escape(window.location.pathname + window.location.search), 35 dataType: "html", 36 success: function(data){ 37 $('ul#bookmarks').replaceWith(data); 38 }

  Read the article

• Problem with building with csc task in Ant

  - by Wing C. Chen

  I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

  Read the article

• Java multiple connections downloading file

  - by weulerjunior

  Hello friends, I was wanting to add multiple connections in the code below to be able to download files faster. Could someone help me? Thanks in advance. public void run() { RandomAccessFile file = null; InputStream stream = null; try { // Open connection to URL. HttpURLConnection connection = (HttpURLConnection) url.openConnection(); // Specify what portion of file to download. connection.setRequestProperty("Range", "bytes=" + downloaded + "-"); // Connect to server. connection.connect(); // Make sure response code is in the 200 range. if (connection.getResponseCode() / 100 != 2) { error(); } // Check for valid content length. int contentLength = connection.getContentLength(); if (contentLength < 1) { error(); } /* Set the size for this download if it hasn't been already set. */ if (size == -1) { size = contentLength; stateChanged(); } // Open file and seek to the end of it. file = new RandomAccessFile("C:\\"+getFileName(url), "rw"); file.seek(downloaded); stream = connection.getInputStream(); while (status == DOWNLOADING) { /* Size buffer according to how much of the file is left to download. */ byte buffer[]; if (size - downloaded > MAX_BUFFER_SIZE) { buffer = new byte[MAX_BUFFER_SIZE]; } else { buffer = new byte[size - downloaded]; } // Read from server into buffer. int read = stream.read(buffer); if (read == -1) { break; } // Write buffer to file. file.write(buffer, 0, read); downloaded += read; stateChanged(); } /* Change status to complete if this point was reached because downloading has finished. */ if (status == DOWNLOADING) { status = COMPLETE; stateChanged(); } } catch (Exception e) { error(); } finally { // Close file. if (file != null) { try { file.close(); } catch (Exception e) { } } // Close connection to server. if (stream != null) { try { stream.close(); } catch (Exception e) { } } } }

  Read the article

• Updating to Spring 2.5.5 causes a javax.servlet.UnavailableException: org.springframework.web.struts

  - by Averroes

  I have been told to update some application from Spring 2.0.8 to Spring 2.5.5. This application is using Struts 1.2.7. Once I change the Spring.jar I get the following exception while loading in JBoss 4.0.5: 10:14:57,579 ERROR [[/PortalRRHH]] Servlet /PortalRRHH threw load() exception javax.servlet.UnavailableException: org.springframework.web.struts.DelegatingTilesRequestProcessor This is defined in the struts-config.xml this way: <controller locale="true"> <set-property property="processorClass" value="org.springframework.web.struts.DelegatingTilesRequestProcessor"/> </controller> I have no clue of what is happening since it works with the old version of Spring and the DelegatingTilesRequestProcessor is still available in Spring 2.5.5. I have no previous experience with Struts so if you need anything else to figure what the problem is please ask and I will update the question. Thanks.

  Read the article

• How to display specific data from a file

  - by user1067332

  My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

  Read the article

• enterprise library configuration 4.0

  - by prince23

  hi, i am using enterprise libaray confiuration 4.0. and here i have set the file size as rollSizeKB="20" but once my file size reaches 9kb. a new file is created. what is te issue. why is it creating new file once it reaches 9KB. <add fileName="c:\Exception.log" footer="----------------------------------------" formatter="Text Formatter" header="----------------------------------------" rollFileExistsBehavior="Increment" rollInterval="None" rollSizeKB="20" timeStampPattern="yyyy-MM-dd" listenerDataType="Microsoft.Practices.EnterpriseLibrary.Logging.Configuration.RollingFlatFileTraceListenerData, Microsoft.Practices.EnterpriseLibrary.Logging, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" traceOutputOptions="Timestamp" filter="All" type="Microsoft.Practices.EnterpriseLibrary.Logging.TraceListeners.RollingFlatFileTraceListener, Microsoft.Practices.EnterpriseLibrary.Logging, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" name="Exception Policy" /> any help would be great thank you

  Read the article

• java.io.IOException: Invalid argument

  - by Luixv

  Hi I have a web application running in cluster mode with a load balancer. It consists in two tomcats (T1, and T2) addressing only one DB. T2 is nfs mounted to T1. This is the only dofference between both nodes. I have a java method generating some files. If the request runs on T1 there is no problem but if the request is running on node 2 I get an exception as follows: java.io.IOException: Invalid argument at java.io.FileOutputStream.close0(Native Method) at java.io.FileOutputStream.close(FileOutputStream.java:279) The corresponding code is as follows: for (int i = 0; i < dataFileList.size(); i++) { outputFileName = outputFolder + fileNameList.get(i); FileOutputStream fileOut = new FileOutputStream(outputFileName); fileOut.write(dataFileList.get(i), 0, dataFileList.get(i).length); fileOut.flush(); fileOut.close(); } The exception appears at the fileOut.close() Any hint? Luis

  Read the article

• How to get the place name by latitude and longitude using openstreetmap in android

  - by Gaurav kumar

  In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

  Read the article

• XML validation in Java - why does this fail?

  - by jd

  hi, first time dealing with xml, so please be patient. the code below is probably evil in a million ways (I'd be very happy to hear about all of them), but the main problem is of course that it doesn't work :-) public class Test { private static final String JSDL_SCHEMA_URL = "http://schemas.ggf.org/jsdl/2005/11/jsdl"; private static final String JSDL_POSIX_APPLICATION_SCHEMA_URL = "http://schemas.ggf.org/jsdl/2005/11/jsdl-posix"; public static void main(String[] args) { System.out.println(Test.createJSDLDescription("/bin/echo", "hello world")); } private static String createJSDLDescription(String execName, String args) { Document jsdlJobDefinitionDocument = getJSDLJobDefinitionDocument(); String xmlString = null; // create the elements Element jobDescription = jsdlJobDefinitionDocument.createElement("JobDescription"); Element application = jsdlJobDefinitionDocument.createElement("Application"); Element posixApplication = jsdlJobDefinitionDocument.createElementNS(JSDL_POSIX_APPLICATION_SCHEMA_URL, "POSIXApplication"); Element executable = jsdlJobDefinitionDocument.createElement("Executable"); executable.setTextContent(execName); Element argument = jsdlJobDefinitionDocument.createElement("Argument"); argument.setTextContent(args); //join them into a tree posixApplication.appendChild(executable); posixApplication.appendChild(argument); application.appendChild(posixApplication); jobDescription.appendChild(application); jsdlJobDefinitionDocument.getDocumentElement().appendChild(jobDescription); DOMSource source = new DOMSource(jsdlJobDefinitionDocument); validateXML(source); try { Transformer transformer = TransformerFactory.newInstance().newTransformer(); transformer.setOutputProperty(OutputKeys.INDENT, "yes"); StreamResult result = new StreamResult(new StringWriter()); transformer.transform(source, result); xmlString = result.getWriter().toString(); } catch (Exception e) { e.printStackTrace(); } return xmlString; } private static Document getJSDLJobDefinitionDocument() { DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance(); DocumentBuilder builder = null; try { builder = factory.newDocumentBuilder(); } catch (Exception e) { e.printStackTrace(); } DOMImplementation domImpl = builder.getDOMImplementation(); Document theDocument = domImpl.createDocument(JSDL_SCHEMA_URL, "JobDefinition", null); return theDocument; } private static void validateXML(DOMSource source) { try { URL schemaFile = new URL(JSDL_SCHEMA_URL); Sche maFactory schemaFactory = SchemaFactory.newInstance(XMLConstants.W3C_XML_SCHEMA_NS_URI); Schema schema = schemaFactory.newSchema(schemaFile); Validator validator = schema.newValidator(); DOMResult result = new DOMResult(); validator.validate(source, result); System.out.println("is valid"); } catch (Exception e) { e.printStackTrace(); } } } it spits out a somewhat odd message: org.xml.sax.SAXParseException: cvc-complex-type.2.4.a: Invalid content was found starting with element 'JobDescription'. One of '{"http://schemas.ggf.org/jsdl/2005/11/jsdl":JobDescription}' is expected. Where am I going wrong here? Thanks a lot

  Read the article

• Fluent NHibernate MappingException : could not instantiate id generator

  - by Mark Simpson

  I'm pottering around with Fluent NHibernate to try and get a simple app up and running. I'm running through this Fluent NHibernate Tutorial. Everything seems to be going fine and I've created the required classes etc. and it all builds, but when I run the test, I get an exception. Someone in the comments section of the tutorial has the same problem, but I can't find any good information on what's causing it. Any help appreciated. It's probably something trivial. Exception details: FluentNHTest.Tests.Mappings.CustomerMappingTests.ValidateMappings: FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- NHibernate.MappingException : could not instantiate id generator ---- System.FormatException : Input string was not in a correct format.

  Read the article

• Class declaration bug

  - by aladine

  Please advise me what's wrong with this class declaration: ExchEngine.java package engine; public class ExchEngine { public ExchEngine() { } public static void main(String[] args) { ExchEngine engine=new ExchEngine() ; } } When I compile this file, I always get exception: java.lang.NoClassDefFoundError: test_engine/ExchEngine Caused by: java.lang.ClassNotFoundException: test_engine.ExchEngine at java.net.URLClassLoader$1.run(URLClassLoader.java:202) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:190) at java.lang.ClassLoader.loadClass(ClassLoader.java:307) at sun.misc.Launcher$AppClassLoader.loadClass(Launcher.java:301) at java.lang.ClassLoader.loadClass(ClassLoader.java:248) Exception in thread "main" This seems very weird that ExchEngine.java is inside a package and it cannot run itself. Thanks for any help.

  Read the article

• Handle mysql restart in SQLAlchemy

  - by wRAR

  My Pylons app uses local MySQL server via SQLAlchemy and python-MySQLdb. When the server is restarted, open pooled connections are apparently closed, but the application doesn't know about this and apparently when it tries to use such connection it receives "MySQL server has gone away": File '/usr/lib/pymodules/python2.6/sqlalchemy/engine/default.py', line 277 in do_execute cursor.execute(statement, parameters) File '/usr/lib/pymodules/python2.6/MySQLdb/cursors.py', line 166 in execute self.errorhandler(self, exc, value) File '/usr/lib/pymodules/python2.6/MySQLdb/connections.py', line 35 in defaulterrorhandler raise errorclass, errorvalue OperationalError: (OperationalError) (2006, 'MySQL server has gone away') This exception is not caught anywhere so it bubbles up to the user. If I should handle this exception somewhere in my code, please show the place for such code in a Pylons WSGI app. Or maybe there is a solution in SA itself?

  Read the article

< Previous Page | 208 209 210 211 212 213 214 215 216 217 218 219  | Next Page >